[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00173.1

[Show Plain Result]


## Summary of Sequence Search
    1::195
   33::140     4e-16  46%  160 aa  YVSG_BACSU RecName: Full=Uncharacterized protein yvsG;Flags:
   47::133     2e-14  48%  200 aa  YDJM_SHIFL RecName: Full=Inner membrane protein ydjM;Flags:
   47::133     2e-14  48%  200 aa  YDJM_ECOLI RecName: Full=Inner membrane protein ydjM;Flags:
    6::120     2e-05  32%  173 aa  YBCI_ECOLI RecName: Full=Inner membrane protein ybcI;
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxTHITTTLALGLPLMSLTNELTLVNVGVLAVGSLLPDIDHPSSYLGKRHKMVSGVTNKAFGHRGITH
YVSG_BACSU      --------------------------------AVGALIPDICHTQSKIGRKFPILSKVVSSVFGHRTFTH
YDJM_SHIFL      ------------------------------------LLPDIDHPKSFLGQRLKWISKPIARAFGHRGFTH
YDJM_ECOLI      ------------------------------------LLPDIDHPKSFLGQRLKWISKPIARAFGHRGFTH
YBCI_ECOLI      ----THAAVPLCIGLGLGSKVIPPRLLFAGIIL--AMLPDADVLSFKFGVAYGNV-------FGHRGFTH


                         .         .         *         .         .         .         .:140
query           SLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVKWLYPFTKSGSSFGGKFAFYK
YVSG_BACSU      SLL-FML---IMFFITSTYIPDK--NISAGLMIGMASHLILDAWTVNGIKLLFP-----STIRVRLPLYK
YDJM_SHIFL      SLLAFALLATFYLKVPEGWFADALQGMV----LGYLSHILADMLTPAGVPLLWP----------------
YDJM_ECOLI      SLLAFALLATFYLKVPEGWFADALQGMV----LGYLSHILADMLTPAGVPLLWP----------------
YBCI_ECOLI      SLVFAFVVPLLCVFIGRRWF--RAGLIRCWXXXXXXXXXXXXTTGGKGVGWLWPWS--------------


                         +         .         .         .         .         *         .:210
query           TGQLSEYLVMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YVSG_BACSU      TGSFSEQLVL---------------------------------------------
YDJM_SHIFL      -------------------------------------------------------
YDJM_ECOLI      -------------------------------------------------------
YBCI_ECOLI      -------------------------------------------------------