[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00183.1

[Show Plain Result]


## Summary of Sequence Search
    1::618
   17::601     2e-79  32%  614 aa  YJBQ_BACSU RecName: Full=Putative Na(+)/H(+) antiporter yjbQ;
   47::322     5e-13  28%  383 aa  NAPA_ENTHR RecName: Full=Na(+)/H(+) antiporter;
   65::209     2e-08  28%  436 aa  TRKA_ARCFU RecName: Full=Trk system potassium uptake protein trkA
    5::198     5e-08  28%  216 aa  TRKA_METTH RecName: Full=Trk system potassium uptake protein trkA
   46::283     2e-07  21%  388 aa  NAH3_METJA RecName: Full=Probable Na(+)/H(+) antiporter 3;AltName:
   63::213     1e-06  25%  218 aa  TRKA_METJA RecName: Full=Trk system potassium uptake protein trkA
    5::227     5e-06  25%  458 aa  TRKA_HAEIN RecName: Full=Trk system potassium uptake protein trkA; 
    5::227     9e-05  22%  458 aa  TRKA_VIBAL RecName: Full=Trk system potassium uptake protein trkA; 
   46::194     9e-05  34%  368 aa  MTLD_STAAW RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAT RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAS RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAN RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAM RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAE RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAAC RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAA9 RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAA8 RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAA3 RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAA2 RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   46::194     9e-05  34%  368 aa  MTLD_STAA1 RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   54::214     1e-04  22%  448 aa  TRKA1_METMA RecName: Full=Trk system potassium uptake protein trkA
  136::227     2e-04  30%  458 aa  TRKA_SHIFL RecName: Full=Trk system potassium uptake protein trkA; 
  136::227     2e-04  30%  458 aa  TRKA_SALTY RecName: Full=Trk system potassium uptake protein trkA; 
  136::227     2e-04  30%  458 aa  TRKA_SALTI RecName: Full=Trk system potassium uptake protein trkA; 
  136::227     2e-04  30%  458 aa  TRKA_ECOLI RecName: Full=Trk system potassium uptake protein trkA; 
  136::227     2e-04  30%  458 aa  TRKA_ECOL6 RecName: Full=Trk system potassium uptake protein trkA; 
  136::227     2e-04  30%  458 aa  TRKA_ECO57 RecName: Full=Trk system potassium uptake protein trkA; 
   46::194     2e-04  34%  368 aa  MTLD_STAAR RecName: Full=Mannitol-1-phosphate 5-dehydrogenase;     
   54::208     3e-04  22%  448 aa  TRKA2_METMA RecName: Full=Trk system potassium uptake protein trkA
    1::618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxFITPMVLARFKVSFLPTSVAEXXXXXXXXKSCFNLIHADTLLSWCSTFGVILLMFLSG
YJBQ_BACSU      ------------FLTPILLHRFKLS-IPVVVAEIIMGLIIGKSGLNLVEGDTWLQTLSMLGFIFLMFLSG
NAPA_ENTHR      -----------------------------------------------VHPNILVHDFSEIGVILLMFLAG
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
NAH3_METJA      ---------------------------------------------NILQVDETLKILADFGAIMLMFLAG
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ----------------------------------------------------------------------
TRKA_VIBAL      ----------------------------------------------------------------------
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MEIDFSLFKKNSHTLSPLEAKMAANEPKTSPVRAATYAYAFSLVASLILALLFKVTGLFSDVGLATILFS
YJBQ_BACSU      LEIDFSSFEKGKKKQFLPNGKEAPNT-----FAAASVIFVGIFILSLLLSYGFVLAGFIQNAFLMTLIIS
NAPA_ENTHR      LESDLSLLKKYFKP----------------GMFVALLGILFPVFFGWLTGEAFQVAN--NEAIFFGIILA
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
NAH3_METJA      LEVDNETLKQEFK--NXXXXXXXXXXXPXXXXXXXXXXXXXXXXXSLLYA----------------VIFA
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ----------------------------------------------------------------------
TRKA_VIBAL      ----------------------------------------------------------------------
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TVSLGIMTSLLKENELLSRPFGQTILLFSVLGEVIPMIALTAYSSIYAGKGASLWLITXXXXXXXXXXXX
YJBQ_BACSU      TISLGVVVPTLKEERIMNSNIGQIILLVAVIADLATMILLAVFSSLYGEDSGNMWLILFAAGVVLYFFGR
NAPA_ENTHR      ATSVSISVEVLKELNVVNTKEGSTILGAXXXXXXXXXXXXXXXXXXXTGKSTSXXXXXXXXXXXXXVKWI
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
NAH3_METJA      SHSVAIVYAILEELKMVKTRLGTIILSATIIVDLFTLLLLSVVIKLIGGENVGTFLLETVLYIGVLLLAI
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ----------------------------------------------------------------------
TRKA_VIBAL      ----------------------------------------------------------------------
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXDKINKATTQIDMRLAFFVIIALVLVAETVGAENILGAFVAGIVLKLLEPAEETEHRLDAIGY
YJBQ_BACSU      VFKHRSFVQSMSKGTIQIGTRAIFTLIIVLVALSESLGAENILGAFLAGVLVSLLSPNKELVQQLDSFGY
NAPA_ENTHR      APFLMSLAEKIYANSAIIIMSLV--ICLGMSYLADLIGLSSVIGAFFAGIAVSQTKVKHEVYNNVEALGY
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
NAH3_METJA      PSLSKNILGVFEKLHAQ-RIHYVLXXXXXXXXXXXXXXXHPIVGAFICGVAVSEALTKEEHDENLNAIGY
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ----------------------------------------------------------------------
TRKA_VIBAL      ----------------------------------------------------------------------
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GFFTPFFFILTGVNLDIPSLMRSPKTLLLIPLFFVAFILAKLPGYFGFQRRFSKKNSFVGXXXXXXXXXX
YJBQ_BACSU      GFLIPIFFVMVGVKLDIWTLFQDKTXXXXXXXXXXXXXXXXXXPVMYLKKWYDNRTIFASGFLLTSTLSL
NAPA_ENTHR      AVFIPVFFVSVGLEVDFSKF--SEQILFILILTLVAILTKLIGGYIGAKFSSFSSNS-------------
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ----------------------------------------------------------------------
NAH3_METJA      GFFIPIFFLVLGMETNI-----------------------------------------------------
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ----------------------------------------------------------------------
TRKA_VIBAL      ----------------------------------------------------------------------
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXEHLHAITPQQSGAFLLAGILTCIVGPVFFNKQYKPEPEDQKQTSLHIIGVNLVTVSAAQQLS
YJBQ_BACSU      VIAAATIGQQLHVISTNMSGALILVAVIASIFTPICFKKLYKREEQPEEKKTITFIGANQMXXXXXXXXX
NAPA_ENTHR      ----------------------------------------------------------------------
TRKA_ARCFU      ----------------------------------------------------------------------
TRKA_METTH      ------------------------------------------------------IMGGGRVGLTLANLLI
NAH3_METJA      ----------------------------------------------------------------------
TRKA_METJA      ----------------------------------------------------------------------
TRKA_HAEIN      ------------------------------------------------------ILGAGQVGTTLAENLV
TRKA_VIBAL      ------------------------------------------------------ILGAGQVGGTLAENLV
MTLD_STAAW      ----------------------------------------------------------------------
MTLD_STAAT      ----------------------------------------------------------------------
MTLD_STAAS      ----------------------------------------------------------------------
MTLD_STAAN      ----------------------------------------------------------------------
MTLD_STAAM      ----------------------------------------------------------------------
MTLD_STAAE      ----------------------------------------------------------------------
MTLD_STAAC      ----------------------------------------------------------------------
MTLD_STAA9      ----------------------------------------------------------------------
MTLD_STAA8      ----------------------------------------------------------------------
MTLD_STAA3      ----------------------------------------------------------------------
MTLD_STAA2      ----------------------------------------------------------------------
MTLD_STAA1      ----------------------------------------------------------------------
TRKA1_METMA     ----------------------------------------------------------------------
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ----------------------------------------------------------------------
TRKA2_METMA     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKLSLAAKKYGVN
YJBQ_BACSU      XXXYDVRVYQENAEEKLS-ESVFAVETISDYEHETLESLGIFETDILVVATGNEDMNADIALLAKDKGTE
NAPA_ENTHR      ----------------------------------------------------------------------
TRKA_ARCFU      --------------------------------------------DVFLAVTGNDEVNLLSGLAAKKVGAK
TRKA_METTH      SDGHDVTLI----ENEETLCANAAVE-LDALDIKTLEEANISNADVFVAATGNDEANLLSCILVREYSIP
NAH3_METJA      ----------------------------------------------------------------------
TRKA_METJA      ----------------------------------------IEDADMYIAVTGKEEVNLMSSLLAKSYGIN
TRKA_HAEIN      SEDNDITLVDNESPQLQTLQEKHDLRVVQGSSPKVLRDAGAADADLMVAVTASDEINMACQMGYTLFNTP
TRKA_VIBAL      GENNDITIVDNNADRLRELQDKYDLRVVNASHPDVLHEAGAQDADMLVVTNTDETNMAACQVAFTLFNTP
MTLD_STAAW      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAT      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAS      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAN      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAM      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAE      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAAC      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAA9      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAA8      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAA3      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAA2      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
MTLD_STAA1      ---YDV-ILADESKTTTRVN---NVDAINSMQPSEALKQAILEADIITTA---VGVNI-LPIIAKSFATN
TRKA1_METMA     ----------------------------------EILSRVLQNADLLVAVTGVDEVNIVACMTAKLIMKN
TRKA_SHIFL      ----------------------------------------------------------------------
TRKA_SALTY      ----------------------------------------------------------------------
TRKA_SALTI      ----------------------------------------------------------------------
TRKA_ECOLI      ----------------------------------------------------------------------
TRKA_ECOL6      ----------------------------------------------------------------------
TRKA_ECO57      ----------------------------------------------------------------------
MTLD_STAAR      ---YDV-ILADESKTTTRVN---NVAAINSMQPSEELKQAILEADIITTAVG---VNI-LPIIAKSFATN
TRKA2_METMA     ----------------------------------DILASVLPDVDILVAVTGVDEVNIVACMTAKLWKET


                         *         .         .         .         .         +         .:560
query           RVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQILTSSESRLYEVVVNDSIFVGV
YJBQ_BACSU      RVIASVGS----PEHEAALKEQGISIFSILLSTKTLLRALIEAPGVMKLLTNQESSLYQINMENSKYDGV
NAPA_ENTHR      ----------------------------------------------------------------------
TRKA_ARCFU      NVIVRVENPEYVDRPIVKEHPLGYDVLICPQLSLAQEAALIGIPGAIEVVTFSGGKVEMIVMEGSKADGK
TRKA_METTH      KIIARVSNP----DHEEAFKKVGIDHISPERTAAGYLEKLITRPKVLIVLGHGDAEILDMEIRSSKVVGK
NAH3_METJA      ----------------------------------------------------------------------
TRKA_METJA      KTIARISE----IEYKDVFERLGVDVVSPELIAANYIEKLIERPGILDIVGRGEAEILEFIIPEKAVVNK
TRKA_HAEIN      TRIARIRNSEYLREKDKLFNNENIHLISPENLVTDEITRLIAYPGALQVAHFANNRISIVVVKGGALVGY
TRKA_VIBAL      NRVARIRSPEYLAEKEALFKSGAIHLIAPEELVTSYIERLIQYPGALQVVSFAEQKVSLVAVK-AYYGGP
MTLD_STAAW      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAT      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAS      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAN      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAM      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAE      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAAC      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAA9      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAA8      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAA3      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAA2      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
MTLD_STAA1      HVIVACENAIMAT---DTLKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
TRKA1_METMA     KTIARVSNPDYIDSPVTSRAQVGVDLMICPELALASVADILSSPSAIEMFAEGKVRMTEFAISESKLVGK
TRKA_SHIFL      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
TRKA_SALTY      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
TRKA_SALTI      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
TRKA_ECOLI      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
TRKA_ECOL6      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
TRKA_ECO57      ---------------------------------------LIEYPGALQVVNFAEGKVSLAVVK-AYYGGP
MTLD_STAAR      HVIVACENAIMATDT---LKKAVLDITGPLGNNIHFANSAVDRIVPLQILDVMVEPFYEWVVEKDAWYGP
TRKA2_METMA     KTIARVSNPDYIDVPVTSRAQVGVDIMICPELALASVAEVLSNPSAIEMFAGGKVQMMEFAIRDNRLVGK


                         .         .         .         *         .         .         .:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESAYFRRKLQRxxx
YJBQ_BACSU      ILREFPLTGDVIFVRIFRGVDSIVPHGDTRLKLGDRLIVTGS----------------
NAPA_ENTHR      ----------------------------------------------------------
TRKA_ARCFU      AIADLYLPQNVVIASIYRNGHIEIPRGDTVLRAGDRVAIVSKTED-------------
TRKA_METTH      RVGDVSPTDKYIIVAIYNNGDLIIPQPDMVLERGTKV---------------------
NAH3_METJA      ----------------------------------------------------------
TRKA_METJA      KIKELGRPQDYLIIAIYDGDELKIPSGDTELKSGDRVLVLVKKDAADAIRK-------
TRKA_HAEIN      ALEHMPHID-CRIMSILRNGKPIRPQGSTIVEAGDEITFICATEHIKAIMGELQR---
TRKA_VIBAL      LVEHMPHIDT-RVAAIFRQGRPIRPQGTTIIEADDEVFFVAASNHIRSVMSELQR---
MTLD_STAAW      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAT      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAS      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAN      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAM      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAE      ELNHIKYVDDLT----------------------------------------------
MTLD_STAAC      ELNHIKYVDDLT----------------------------------------------
MTLD_STAA9      ELNHIKYVDDLT----------------------------------------------
MTLD_STAA8      ELNHIKYVDDLT----------------------------------------------
MTLD_STAA3      ELNHIKYVDDLT----------------------------------------------
MTLD_STAA2      ELNHIKYVDDLT----------------------------------------------
MTLD_STAA1      ELNHIKYVDDLT----------------------------------------------
TRKA1_METMA     HMQDLKLADCCIVSAVFREDQIIIPHGDDLIKANDHMVVVGKPE--------------
TRKA_SHIFL      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
TRKA_SALTY      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
TRKA_SALTI      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
TRKA_ECOLI      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
TRKA_ECOL6      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
TRKA_ECO57      LIEHMPHIDT-RVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQR---
MTLD_STAAR      ELNHIKYVDDLT----------------------------------------------
TRKA2_METMA     RMQDIELEDCCIVSAIFRNNDIIIPHGDDFIKANDHMV--------------------