[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00186.1

[Show Plain Result]


## Summary of Sequence Search
    1::242
   15::156     4e-04  28%  325 aa  YTRD_BACSU RecName: Full=Probable ABC transporter permease ytrD;
  126::297     5e-04  30%  313 aa  CTAA_BACCN RecName: Full=Heme A synthase;         Short=HAS;       
    1::242

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxKSAIPITLIFFNLVGSLLGTMIFALNRKVLLDGTQAHVLWGQTVFYSSQIFTPILIGIIC
YTRD_BACSU      ----------KVALVITILVF-----ILGNPLSILNMYLIYQGTGKENWVGPCVFYLNSSFISLIWGVVL
CTAA_BACCN      ---------------ISLISFASV-ILLACLIFEIDKKLIMDKKMKFHIYGVTIYSYLVVYTGALVRHEA


                         .         .         *         .         .         .         .:140
query           SISCQFEESNKNWQRLLSIPVKANRIILSKITSLSLVMAISQLIVLLFYIIIALVLKVPFANYLLDFLLW
YTRD_BACSU      AVSLGIERSKSFFDFTLSLPYTRGQIFHAKFLTGGMVIVVPQLIGYVLSVLLIMLLKVYFHNYSLGMIIV
CTAA_BACCN      SLACEFPLCSKNWPTQLHEWVQMGHRVAA--------------ILLFAWIVYAMILAI--RHYKQERVVY


                         +         .         .         .         .         *         .:210
query           SITGWIATITIVTIQIFLSIRLKNFAVPILISAILAMAGLMTLFIGQGLFRIFPYAQIAVGDRARxxxxx
YTRD_BACSU      SMLAY-----------------------------------------------------------------
CTAA_BACCN      --LGWITSFILVTLQAIVGI------LVVYTNASLTMALLHSLFI-SCLFAVLCYL-VMLGTRSK-----


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YTRD_BACSU      --------------------------------
CTAA_BACCN      --------------------------------