[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00205.1

[Show Plain Result]


## Summary of Sequence Search
    1::148
  110::171     7e-04  29%  339 aa  SYFA_RUTMC RecName: Full=Phenylalanyl-tRNA synthetase alpha chain; 
    1::148

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxTSDYNKVRGVIVENSNKVGLHGKVTITKLYWTALEIPTYHVT
SYFA_RUTMC      ----------------------------TITLNRIQSLFVKNSFEVVLGPEIEDNFYNFTALNIPEHHPA


                         .         .         *         .         .         .         .:140
query           YTYSEKTYLDQKVVLEKNTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SYFA_RUTMC      RAMHDTFYFDKNTVLRTHTS--------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxx
SYFA_RUTMC      --------