[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00227.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
    1::180     3e-99 100%  180 aa  RL5_LACS1 RecName: Full=50S ribosomal protein L5;
    1::179     3e-86  85%  179 aa  RL5_ENTFA RecName: Full=50S ribosomal protein L5;
    1::180     1e-84  83%  180 aa  RL5_LACLS RecName: Full=50S ribosomal protein L5;
    1::180     1e-84  83%  180 aa  RL5_LACLM RecName: Full=50S ribosomal protein L5;
    1::180     1e-84  83%  180 aa  RL5_LACLA RecName: Full=50S ribosomal protein L5;
    1::180     1e-84  82%  180 aa  RL5_LACRJ RecName: Full=50S ribosomal protein L5;
    1::180     1e-84  82%  180 aa  RL5_LACRD RecName: Full=50S ribosomal protein L5;
    1::179     2e-84  83%  179 aa  RL5_GEOTN RecName: Full=50S ribosomal protein L5;
    1::180     7e-84  81%  180 aa  RL5_LACSS RecName: Full=50S ribosomal protein L5;
    1::179     7e-84  83%  179 aa  RL5_GEOKA RecName: Full=50S ribosomal protein L5;
    1::179     8e-84  82%  179 aa  RL5_BACSU RecName: Full=50S ribosomal protein L5;AltName: Full=BL6;
    1::180     1e-83  80%  180 aa  RL5_LACPL RecName: Full=50S ribosomal protein L5;
    1::179     1e-83  82%  180 aa  RL5_LACBA RecName: Full=50S ribosomal protein L5;
    1::179     1e-83  83%  179 aa  RL5_BACST RecName: Full=50S ribosomal protein L5;       
    1::179     1e-83  81%  179 aa  RL5_BACLD RecName: Full=50S ribosomal protein L5;
    1::180     2e-83  81%  180 aa  RL5_PEDPA RecName: Full=50S ribosomal protein L5;
    1::180     2e-83  82%  180 aa  RL5_STRSY RecName: Full=50S ribosomal protein L5;
    1::180     2e-83  82%  180 aa  RL5_STRS2 RecName: Full=50S ribosomal protein L5;
    1::180     3e-83  81%  180 aa  RL5_LEUMM RecName: Full=50S ribosomal protein L5;
    1::180     3e-83  82%  180 aa  RL5_LEUCK RecName: Full=50S ribosomal protein L5;
    1::179     6e-83  80%  179 aa  RL5_BACA2 RecName: Full=50S ribosomal protein L5;
    1::179     7e-83  82%  179 aa  RL5_EXIS2 RecName: Full=50S ribosomal protein L5;
    1::179     7e-83  82%  179 aa  RL5_ANOFW RecName: Full=50S ribosomal protein L5;
    1::179     9e-83  80%  179 aa  RL5_BACHD RecName: Full=50S ribosomal protein L5;
    1::179     2e-82  82%  179 aa  RL5_BACSK RecName: Full=50S ribosomal protein L5;
    1::179     3e-82  80%  179 aa  RL5_LYSSC RecName: Full=50S ribosomal protein L5;
    1::180     3e-82  80%  180 aa  RL5_LACF3 RecName: Full=50S ribosomal protein L5;
    1::179     3e-82  82%  179 aa  RL5_GEOSW RecName: Full=50S ribosomal protein L5;
    1::179     4e-82  80%  179 aa  RL5_BACCQ RecName: Full=50S ribosomal protein L5;
    1::179     4e-82  80%  179 aa  RL5_BACC7 RecName: Full=50S ribosomal protein L5;
    1::179     4e-82  80%  179 aa  RL5_BACC1 RecName: Full=50S ribosomal protein L5;
    1::180     5e-82  78%  180 aa  RL5_LACCB RecName: Full=50S ribosomal protein L5;
    1::180     5e-82  78%  180 aa  RL5_LACC3 RecName: Full=50S ribosomal protein L5;
    1::179     5e-82  80%  179 aa  RL5_BACP2 RecName: Full=50S ribosomal protein L5;
    1::180     6e-82  79%  180 aa  RL5_LACGA RecName: Full=50S ribosomal protein L5;
    1::179     1e-81  80%  179 aa  RL5_BACCN RecName: Full=50S ribosomal protein L5;
    1::179     2e-81  78%  179 aa  RL5_EXISA RecName: Full=50S ribosomal protein L5;
    1::179     2e-81  80%  179 aa  RL5_BACWK RecName: Full=50S ribosomal protein L5;
    1::180     5e-81  77%  180 aa  RL5_BREBN RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISW6 RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISMO RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISMH RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISMF RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISMC RecName: Full=50S ribosomal protein L5;
    1::179     9e-81  80%  179 aa  RL5_LISIN RecName: Full=50S ribosomal protein L5;
    1::180     9e-81  78%  180 aa  RL5_LACJO RecName: Full=50S ribosomal protein L5;
    1::180     9e-81  79%  180 aa  RL5_LACDB RecName: Full=50S ribosomal protein L5;
    1::180     9e-81  79%  180 aa  RL5_LACDA RecName: Full=50S ribosomal protein L5;
    1::180     1e-80  78%  180 aa  RL5_OENOB RecName: Full=50S ribosomal protein L5;
    1::179     1e-80  79%  179 aa  RL5_BACC2 RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  78%  179 aa  RL5_OCEIH RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACHK RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACCZ RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACCR RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACC4 RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACC3 RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACC0 RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACAN RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACAH RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACAC RecName: Full=50S ribosomal protein L5;
    1::179     2e-80  79%  179 aa  RL5_BACAA RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAW RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAT RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAS RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAR RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAN RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAM RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAE RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAC RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAAB RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAA9 RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAA8 RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAA3 RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAA2 RecName: Full=50S ribosomal protein L5;
    1::179     3e-80  78%  179 aa  RL5_STAA1 RecName: Full=50S ribosomal protein L5;
    1::179     6e-80  78%  179 aa  RL5_STACT RecName: Full=50S ribosomal protein L5;
    1::179     3e-79  77%  179 aa  RL5_STAHJ RecName: Full=50S ribosomal protein L5;
    1::180     5e-79  78%  180 aa  RL5_LACAC RecName: Full=50S ribosomal protein L5;
    1::179     6e-79  76%  179 aa  RL5_STAES RecName: Full=50S ribosomal protein L5;
    1::179     6e-79  76%  179 aa  RL5_STAEQ RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRZT RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRZP RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRZJ RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRR6 RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRPS RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRPN RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRPJ RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRPI RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRP7 RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRP4 RecName: Full=50S ribosomal protein L5;
    1::180     8e-79  78%  180 aa  RL5_STRP2 RecName: Full=50S ribosomal protein L5;
    1::180     1e-78  79%  180 aa  RL5_STRMU RecName: Full=50S ribosomal protein L5;
    1::180     2e-78  78%  180 aa  RL5_STRTD RecName: Full=50S ribosomal protein L5;
    1::180     2e-78  78%  180 aa  RL5_STRS7 RecName: Full=50S ribosomal protein L5;
    1::180     2e-78  78%  180 aa  RL5_STRPZ RecName: Full=50S ribosomal protein L5;
    1::180     2e-78  78%  180 aa  RL5_STREM RecName: Full=50S ribosomal protein L5;
    1::180     2e-78  78%  180 aa  RL5_STRE4 RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPM RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPG RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPF RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPD RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPC RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRPB RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRP8 RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRP6 RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRP3 RecName: Full=50S ribosomal protein L5;
    1::180     3e-78  78%  180 aa  RL5_STRP1 RecName: Full=50S ribosomal protein L5;
    1::180     5e-78  78%  180 aa  RL5_STRSV RecName: Full=50S ribosomal protein L5;
    1::180     5e-78  78%  180 aa  RL5_STRA5 RecName: Full=50S ribosomal protein L5;
    1::180     5e-78  78%  180 aa  RL5_STRA3 RecName: Full=50S ribosomal protein L5;
    1::180     5e-78  78%  180 aa  RL5_STRA1 RecName: Full=50S ribosomal protein L5;
    1::179     7e-78  75%  179 aa  RL5_STAS1 RecName: Full=50S ribosomal protein L5;
    1::179     7e-78  75%  179 aa  RL5_MACCJ RecName: Full=50S ribosomal protein L5;
    1::180     9e-78  77%  180 aa  RL5_LACH4 RecName: Full=50S ribosomal protein L5;
    1::180     1e-77  77%  180 aa  RL5_STRU0 RecName: Full=50S ribosomal protein L5;
    1::180     1e-77  78%  180 aa  RL5_STRGC RecName: Full=50S ribosomal protein L5;
    1::180     2e-77  77%  180 aa  RL5_STRT2 RecName: Full=50S ribosomal protein L5;
    1::180     2e-77  77%  180 aa  RL5_STRT1 RecName: Full=50S ribosomal protein L5;
    1::179     1e-72  69%  179 aa  RL5_THEPX RecName: Full=50S ribosomal protein L5;
    1::179     1e-72  69%  179 aa  RL5_THEP3 RecName: Full=50S ribosomal protein L5;
    3::179     2e-72  69%  179 aa  RL5_DESHY RecName: Full=50S ribosomal protein L5;
    6::180     4e-72  72%  180 aa  RL5_ACHLI RecName: Full=50S ribosomal protein L5;
    3::179     7e-72  68%  179 aa  RL5_DESHD RecName: Full=50S ribosomal protein L5;
    1::179     1e-71  68%  179 aa  RL5_CLOPS RecName: Full=50S ribosomal protein L5;
    1::179     1e-71  68%  179 aa  RL5_CLOPE RecName: Full=50S ribosomal protein L5;
    1::179     1e-71  68%  179 aa  RL5_CLOP1 RecName: Full=50S ribosomal protein L5;
    4::180     2e-71  71%  181 aa  RL5_CLOK5 RecName: Full=50S ribosomal protein L5;
    4::180     2e-71  71%  181 aa  RL5_CLOK1 RecName: Full=50S ribosomal protein L5;
    3::177     8e-71  67%  178 aa  RL5_SYNWW RecName: Full=50S ribosomal protein L5;
    1::179     3e-70  66%  179 aa  RL5_CLOBB RecName: Full=50S ribosomal protein L5;
    1::179     3e-70  66%  179 aa  RL5_CLOBA RecName: Full=50S ribosomal protein L5;
    1::179     4e-70  66%  179 aa  RL5_THETN RecName: Full=50S ribosomal protein L5;
    1::179     4e-70  67%  179 aa  RL5_CLOB8 RecName: Full=50S ribosomal protein L5;
    1::179     5e-70  66%  180 aa  RL5_CLOTE RecName: Full=50S ribosomal protein L5;
    6::182     2e-69  67%  182 aa  RL5_GLOVI RecName: Full=50S ribosomal protein L5;
    3::179     6e-69  66%  179 aa  RL5_ALKOO RecName: Full=50S ribosomal protein L5;
    1::180     8e-69  65%  180 aa  RL5_CLOBM RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOBL RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOBK RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOBJ RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOBH RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOB6 RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  65%  180 aa  RL5_CLOB1 RecName: Full=50S ribosomal protein L5;
    1::180     1e-68  64%  180 aa  RL5_CLOAB RecName: Full=50S ribosomal protein L5;
    3::177     3e-68  69%  180 aa  RL5_MOOTA RecName: Full=50S ribosomal protein L5;
    3::179     3e-68  64%  181 aa  RL5_DESRM RecName: Full=50S ribosomal protein L5;
    1::179     3e-68  66%  179 aa  RL5_CLOPH RecName: Full=50S ribosomal protein L5;
    1::179     4e-68  64%  180 aa  RL5_CLOCE RecName: Full=50S ribosomal protein L5;
    3::179     5e-68  63%  179 aa  RL5_CARHZ RecName: Full=50S ribosomal protein L5;
    1::179     1e-67  64%  179 aa  RL5_CLONN RecName: Full=50S ribosomal protein L5;
    3::177     4e-67  65%  179 aa  RL5_GEOSF RecName: Full=50S ribosomal protein L5;
    3::177     7e-67  64%  180 aa  RL5_HELMI RecName: Full=50S ribosomal protein L5;
    1::180     4e-66  63%  180 aa  RL5_MYCMS RecName: Full=50S ribosomal protein L5;
    1::178     5e-66  62%  180 aa  RL5_ROSCS RecName: Full=50S ribosomal protein L5;
    3::177     5e-66  63%  179 aa  RL5_GEOUR RecName: Full=50S ribosomal protein L5;
    3::177     5e-66  65%  179 aa  RL5_GEOSL RecName: Full=50S ribosomal protein L5;
    4::176     5e-66  62%  180 aa  RL5_DESAP RecName: Full=50S ribosomal protein L5;
    1::180     6e-66  63%  180 aa  RL5_MYCCT RecName: Full=50S ribosomal protein L5;
    1::179     6e-66  63%  179 aa  RL5_EUBR3 RecName: Full=50S ribosomal protein L5;
    1::180     1e-65  62%  180 aa  RL5_CYAP7 RecName: Full=50S ribosomal protein L5;
    3::179     1e-65  62%  179 aa  RL5_ALKMQ RecName: Full=50S ribosomal protein L5;
    3::177     2e-65  65%  179 aa  RL5_SYNFM RecName: Full=50S ribosomal protein L5;
    3::177     2e-65  64%  179 aa  RL5_GEOMG RecName: Full=50S ribosomal protein L5;
    3::178     4e-65  60%  179 aa  RL5_NATTJ RecName: Full=50S ribosomal protein L5;
    1::179     4e-65  63%  179 aa  RL5_DESAA RecName: Full=50S ribosomal protein L5;
    1::178     4e-65  61%  180 aa  RL5_CHLSY RecName: Full=50S ribosomal protein L5;
    1::178     4e-65  61%  180 aa  RL5_CHLAA RecName: Full=50S ribosomal protein L5;
    1::178     4e-65  62%  180 aa  RL5_ANADF RecName: Full=50S ribosomal protein L5;
    3::177     2e-64  64%  179 aa  RL5_GEOBB RecName: Full=50S ribosomal protein L5;
    1::180     2e-64  63%  180 aa  RL5_MESFL RecName: Full=50S ribosomal protein L5;
    3::177     3e-64  64%  179 aa  RL5_GEOSM RecName: Full=50S ribosomal protein L5;
    3::179     3e-64  59%  179 aa  RL5_SHESR RecName: Full=50S ribosomal protein L5;
    3::179     3e-64  59%  179 aa  RL5_SHESM RecName: Full=50S ribosomal protein L5;
    1::178     3e-64  60%  180 aa  RL5_ANASK RecName: Full=50S ribosomal protein L5;
    1::178     3e-64  60%  180 aa  RL5_ANADE RecName: Full=50S ribosomal protein L5;
    1::178     3e-64  60%  180 aa  RL5_ANAD2 RecName: Full=50S ribosomal protein L5;
    4::177     6e-64  63%  179 aa  RL5_DESAH RecName: Full=50S ribosomal protein L5;
    3::179     7e-64  59%  179 aa  RL5_SHEB9 RecName: Full=50S ribosomal protein L5;
    3::179     7e-64  59%  179 aa  RL5_SHEB8 RecName: Full=50S ribosomal protein L5;
    3::179     7e-64  59%  179 aa  RL5_SHEB5 RecName: Full=50S ribosomal protein L5;
    3::179     7e-64  59%  179 aa  RL5_SHEB2 RecName: Full=50S ribosomal protein L5;
    3::177     7e-64  62%  180 aa  RL5_RUBXD RecName: Full=50S ribosomal protein L5;
    3::179     1e-63  59%  179 aa  RL5_SHESA RecName: Full=50S ribosomal protein L5;
    5::179     1e-63  61%  182 aa  RL5_NOSP7 RecName: Full=50S ribosomal protein L5;
    1::178     1e-63  57%  181 aa  RL5_THEEB RecName: Full=50S ribosomal protein L5;
    3::179     1e-63  59%  179 aa  RL5_SHEON RecName: Full=50S ribosomal protein L5;
    1::178     2e-63  59%  181 aa  RL5_SYNP2 RecName: Full=50S ribosomal protein L5;
    1::178     2e-63  58%  180 aa  RL5_CHLAD RecName: Full=50S ribosomal protein L5;
    6::182     2e-63  60%  192 aa  RL5_ZYMMO RecName: Full=50S ribosomal protein L5;
    4::180     2e-63  62%  184 aa  RL5_PELCD RecName: Full=50S ribosomal protein L5;
    3::179     4e-63  58%  179 aa  RL5_SHESW RecName: Full=50S ribosomal protein L5;
    3::179     4e-63  58%  179 aa  RL5_SHEPC RecName: Full=50S ribosomal protein L5;
    1::179     4e-63  60%  179 aa  RL5_DESPS RecName: Full=50S ribosomal protein L5;
    1::178     5e-63  59%  180 aa  RL5_CYAP8 RecName: Full=50S ribosomal protein L5;
    5::180     6e-63  62%  180 aa  RL5_SPIKU RecName: Full=50S ribosomal protein L5;
    1::179     8e-63  59%  180 aa  RL5_DEIRA RecName: Full=50S ribosomal protein L5;
    3::179     1e-62  57%  179 aa  RL5_SHEDO RecName: Full=50S ribosomal protein L5;
    3::177     1e-62  62%  179 aa  RL5_GEOLS RecName: Full=50S ribosomal protein L5;
    4::182     1e-62  61%  183 aa  RL5_FLAPJ RecName: Full=50S ribosomal protein L5;
    6::182     1e-62  62%  183 aa  RL5_FLAJ1 RecName: Full=50S ribosomal protein L5;
    4::179     1e-62  60%  179 aa  RL5_DICTD RecName: Full=50S ribosomal protein L5;
    4::179     1e-62  60%  179 aa  RL5_DICT6 RecName: Full=50S ribosomal protein L5;
    1::179     2e-62  60%  180 aa  RL5_SYNJA RecName: Full=50S ribosomal protein L5;
    3::179     2e-62  57%  179 aa  RL5_SHEFN RecName: Full=50S ribosomal protein L5;
    4::179     2e-62  56%  179 aa  RL5_CHRSD RecName: Full=50S ribosomal protein L5;
    3::179     2e-62  58%  179 aa  RL5_VIBFM RecName: Full=50S ribosomal protein L5;
    1::177     2e-62  58%  179 aa  RL5_DESOH RecName: Full=50S ribosomal protein L5;
    3::179     3e-62  58%  179 aa  RL5_VIBHB RecName: Full=50S ribosomal protein L5;
    1::178     3e-62  60%  179 aa  RL5_MICAN RecName: Full=50S ribosomal protein L5;
    9::184     3e-62  62%  188 aa  RL5_AQUAE RecName: Full=50S ribosomal protein L5;
    5::179     3e-62  58%  182 aa  RL5_ANASP RecName: Full=50S ribosomal protein L5;
    1::178     3e-62  59%  181 aa  RL5_ACAM1 RecName: Full=50S ribosomal protein L5;
    3::179     4e-62  56%  179 aa  RL5_VIBCM RecName: Full=50S ribosomal protein L5;
    3::179     4e-62  56%  179 aa  RL5_VIBCH RecName: Full=50S ribosomal protein L5;
    3::179     4e-62  56%  179 aa  RL5_VIBC3 RecName: Full=50S ribosomal protein L5;
    3::179     4e-62  56%  179 aa  RL5_SHELP RecName: Full=50S ribosomal protein L5;
    5::179     4e-62  58%  182 aa  RL5_ANAVT RecName: Full=50S ribosomal protein L5;
    1::178     5e-62  58%  180 aa  RL5_SYNY3 RecName: Full=50S ribosomal protein L5;
    8::182     5e-62  61%  193 aa  RL5_SPHWW RecName: Full=50S ribosomal protein L5;
    1::178     5e-62  62%  180 aa  RL5_SOLUE RecName: Full=50S ribosomal protein L5;
    3::177     5e-62  63%  179 aa  RL5_PELPD RecName: Full=50S ribosomal protein L5;
    3::179     5e-62  58%  179 aa  RL5_ALISL RecName: Full=50S ribosomal protein L5;
    1::179     7e-62  61%  180 aa  RL5_SYNJB RecName: Full=50S ribosomal protein L5;
    8::182     7e-62  59%  193 aa  RL5_NOVAD RecName: Full=50S ribosomal protein L5;
    3::179     9e-62  56%  179 aa  RL5_VIBPA RecName: Full=50S ribosomal protein L5;
    1::178     9e-62  56%  181 aa  RL5_TRIEI RecName: Full=50S ribosomal protein L5;
    3::179     9e-62  58%  179 aa  RL5_TOLAT RecName: Full=50S ribosomal protein L5;
    3::177     9e-62  59%  179 aa  RL5_SYNAS RecName: Full=50S ribosomal protein L5;
    3::179     9e-62  56%  179 aa  RL5_SHEAM RecName: Full=50S ribosomal protein L5;
    3::177     9e-62  59%  179 aa  RL5_MAGSA RecName: Full=50S ribosomal protein L5;
    3::179     1e-61  56%  179 aa  RL5_VIBVY RecName: Full=50S ribosomal protein L5;
    3::179     1e-61  56%  179 aa  RL5_VIBVU RecName: Full=50S ribosomal protein L5;
    3::179     1e-61  56%  179 aa  RL5_VIBSL RecName: Full=50S ribosomal protein L5;
    3::176     1e-61  61%  179 aa  RL5_SYNP6 RecName: Full=50S ribosomal protein L5;
    3::176     1e-61  61%  179 aa  RL5_SYNE7 RecName: Full=50S ribosomal protein L5;
    3::179     1e-61  56%  179 aa  RL5_MANSM RecName: Full=50S ribosomal protein L5;
    3::179     2e-61  56%  179 aa  RL5_SHEPW RecName: Full=50S ribosomal protein L5;
    3::179     2e-61  56%  179 aa  RL5_SHEWM RecName: Full=50S ribosomal protein L5;
    3::177     2e-61  61%  179 aa  RL5_POLSJ RecName: Full=50S ribosomal protein L5;
    7::185     2e-61  58%  185 aa  RL5_PARL1 RecName: Full=50S ribosomal protein L5;
    1::178     2e-61  58%  180 aa  RL5_CYAP4 RecName: Full=50S ribosomal protein L5;
    1::178     3e-61  58%  180 aa  RL5_ROSS1 RecName: Full=50S ribosomal protein L5;
    3::179     3e-61  58%  179 aa  RL5_PSEHT RecName: Full=50S ribosomal protein L5;
    4::179     3e-61  60%  185 aa  RL5_MAGSM RecName: Full=50S ribosomal protein L5;
    3::176     3e-61  57%  178 aa  RL5_VIBF1 RecName: Full=50S ribosomal protein L5;
    3::179     3e-61  55%  179 aa  RL5_SHESH RecName: Full=50S ribosomal protein L5;
    3::179     3e-61  56%  179 aa  RL5_SHEHH RecName: Full=50S ribosomal protein L5;
    4::177     3e-61  60%  179 aa  RL5_HALOH RecName: Full=50S ribosomal protein L5;
    3::179     3e-61  56%  179 aa  RL5_HAEDU RecName: Full=50S ribosomal protein L5;
    4::182     3e-61  59%  183 aa  RL5_GRAFK RecName: Full=50S ribosomal protein L5;
    3::179     5e-61  56%  179 aa  RL5_HAEPS RecName: Full=50S ribosomal protein L5;
    3::176     6e-61  57%  179 aa  RL5_SYNR3 RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  56%  179 aa  RL5_SHEPA RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  55%  179 aa  RL5_HAHCH RecName: Full=50S ribosomal protein L5;
    6::183     6e-61  60%  183 aa  RL5_FUSNN RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  56%  179 aa  RL5_AERS4 RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  56%  179 aa  RL5_AERHH RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  55%  179 aa  RL5_ACTPJ RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  55%  179 aa  RL5_ACTP7 RecName: Full=50S ribosomal protein L5;
    3::179     6e-61  55%  179 aa  RL5_ACTP2 RecName: Full=50S ribosomal protein L5;
    3::179     8e-61  55%  179 aa  RL5_PASMU RecName: Full=50S ribosomal protein L5;
    3::177     8e-61  58%  179 aa  RL5_BURMA RecName: Full=50S ribosomal protein L5;
    3::179     1e-60  55%  179 aa  RL5_MARMS RecName: Full=50S ribosomal protein L5;
    3::179     1e-60  55%  179 aa  RL5_IDILO RecName: Full=50S ribosomal protein L5;
    1::178     1e-60  61%  182 aa  RL5_ACIC5 RecName: Full=50S ribosomal protein L5;
    3::179     2e-60  58%  180 aa  RL5_THICR RecName: Full=50S ribosomal protein L5;
    3::179     2e-60  55%  179 aa  RL5_ACTSZ RecName: Full=50S ribosomal protein L5;
    3::177     2e-60  59%  179 aa  RL5_TERTT RecName: Full=50S ribosomal protein L5;
    1::178     2e-60  57%  180 aa  RL5_RALEH RecName: Full=50S ribosomal protein L5;
    3::179     2e-60  55%  179 aa  RL5_PHOPR RecName: Full=50S ribosomal protein L5;
    1::178     2e-60  57%  180 aa  RL5_CUPTR RecName: Full=50S ribosomal protein L5;
    3::179     2e-60  56%  179 aa  RL5_ALTMD RecName: Full=50S ribosomal protein L5;
    1::180     2e-60  57%  181 aa  RK5_CYAPA RecName: Full=50S ribosomal protein L5, cyanelle;
    1::178     3e-60  57%  180 aa  RL5_RALEJ RecName: Full=50S ribosomal protein L5;
   15::193     3e-60  60%  196 aa  RL5_PROA2 RecName: Full=50S ribosomal protein L5;
    5::183     5e-60  58%  183 aa  RL5_TREDE RecName: Full=50S ribosomal protein L5;
    8::183     5e-60  59%  183 aa  RL5_KOSOT RecName: Full=50S ribosomal protein L5;
    3::177     5e-60  60%  179 aa  RL5_ACIAC RecName: Full=50S ribosomal protein L5;
   12::188     7e-60  60%  191 aa  RL5_THEFY RecName: Full=50S ribosomal protein L5;
    3::179     7e-60  58%  179 aa  RL5_RHORT RecName: Full=50S ribosomal protein L5;
    3::177     7e-60  59%  179 aa  RL5_POLNA RecName: Full=50S ribosomal protein L5;
    3::177     7e-60  57%  179 aa  RL5_HERA2 RecName: Full=50S ribosomal protein L5;
    3::179     7e-60  54%  179 aa  RL5_HAES2 RecName: Full=50S ribosomal protein L5;
    3::179     7e-60  54%  179 aa  RL5_HAES1 RecName: Full=50S ribosomal protein L5;
    3::176     9e-60  59%  179 aa  RL5_SYNS9 RecName: Full=50S ribosomal protein L5;
    3::178     9e-60  56%  181 aa  RL5_MYCPU RecName: Full=50S ribosomal protein L5;
    3::176     9e-60  56%  183 aa  RL5_LEGPL RecName: Full=50S ribosomal protein L5;
    6::179     9e-60  56%  186 aa  RL5_LEGPH RecName: Full=50S ribosomal protein L5;
    3::176     9e-60  56%  183 aa  RL5_LEGPC RecName: Full=50S ribosomal protein L5;
    3::176     9e-60  56%  183 aa  RL5_LEGPA RecName: Full=50S ribosomal protein L5;
    3::179     9e-60  54%  179 aa  RL5_HAEIN RecName: Full=50S ribosomal protein L5;
    3::179     9e-60  54%  179 aa  RL5_HAEIG RecName: Full=50S ribosomal protein L5;
    3::179     9e-60  54%  179 aa  RL5_HAEIE RecName: Full=50S ribosomal protein L5;
    3::179     9e-60  54%  179 aa  RL5_HAEI8 RecName: Full=50S ribosomal protein L5;
    3::179     1e-59  55%  179 aa  RL5_PSYIN RecName: Full=50S ribosomal protein L5;
   10::184     1e-59  59%  186 aa  RL5_PARDP RecName: Full=50S ribosomal protein L5;
    1::178     1e-59  56%  180 aa  RL5_RALME RecName: Full=50S ribosomal protein L5;
    7::182     1e-59  59%  187 aa  RL5_MYCPE RecName: Full=50S ribosomal protein L5;
    4::177     1e-59  59%  179 aa  RL5_HALHL RecName: Full=50S ribosomal protein L5;
    3::177     2e-59  56%  179 aa  RL5_METFK RecName: Full=50S ribosomal protein L5;
    3::177     2e-59  56%  179 aa  RL5_METCA RecName: Full=50S ribosomal protein L5;
    8::179     2e-59  59%  179 aa  RL5_BUCAP RecName: Full=50S ribosomal protein L5;
   12::189     2e-59  59%  193 aa  RL5_ARTS2 RecName: Full=50S ribosomal protein L5;
    3::177     2e-59  59%  179 aa  RL5_VEREI RecName: Full=50S ribosomal protein L5;
    3::176     2e-59  58%  179 aa  RL5_SYNSC RecName: Full=50S ribosomal protein L5;
    4::179     2e-59  60%  179 aa  RL5_DEIGD RecName: Full=50S ribosomal protein L5;
    3::177     3e-59  57%  179 aa  RL5_AZOSB RecName: Full=50S ribosomal protein L5;
    8::182     3e-59  57%  184 aa  RL5_AGRT5 RecName: Full=50S ribosomal protein L5;
    3::177     4e-59  56%  178 aa  RL5_PSYA2 RecName: Full=50S ribosomal protein L5;
    3::176     4e-59  57%  179 aa  RL5_PROMM RecName: Full=50S ribosomal protein L5;
    3::177     4e-59  57%  179 aa  RL5_CHRVO RecName: Full=50S ribosomal protein L5;
    5::178     4e-59  57%  181 aa  RK5_PORYE RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::178     6e-59  54%  180 aa  RL5_RALPJ RecName: Full=50S ribosomal protein L5;
    3::177     6e-59  55%  178 aa  RL5_PSYCK RecName: Full=50S ribosomal protein L5;
    3::176     6e-59  57%  179 aa  RL5_PROM3 RecName: Full=50S ribosomal protein L5;
    3::177     6e-59  56%  179 aa  RL5_FRAP2 RecName: Full=50S ribosomal protein L5;
    1::179     6e-59  58%  179 aa  RL5_DESVM RecName: Full=50S ribosomal protein L5;
    1::177     6e-59  56%  179 aa  RL5_BORA1 RecName: Full=50S ribosomal protein L5;
   11::188     6e-59  58%  192 aa  RL5_ARTAT RecName: Full=50S ribosomal protein L5;
    1::178     6e-59  57%  181 aa  RK5_PORPU RecName: Full=50S ribosomal protein L5, chloroplastic;
    6::181     7e-59  59%  181 aa  RL5_THEAB RecName: Full=50S ribosomal protein L5;
    9::183     7e-59  58%  185 aa  RL5_RHISN RecName: Full=50S ribosomal protein L5;
    9::185     7e-59  55%  186 aa  RL5_PHEZH RecName: Full=50S ribosomal protein L5;
   10::184     7e-59  59%  187 aa  RL5_MYCA1 RecName: Full=50S ribosomal protein L5;
   16::192     9e-59  59%  195 aa  RL5_CHLCH RecName: Full=50S ribosomal protein L5;
   16::192     9e-59  58%  220 aa  RK5_SPIOL RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::177     1e-58  57%  179 aa  RL5_THIDA RecName: Full=50S ribosomal protein L5;
    7::183     1e-58  56%  185 aa  RL5_OLICO RecName: Full=50S ribosomal protein L5;
    3::178     1e-58  53%  181 aa  RL5_MYCAP RecName: Full=50S ribosomal protein L5;
    1::179     1e-58  59%  179 aa  RL5_DESDG RecName: Full=50S ribosomal protein L5;
    3::177     1e-58  59%  179 aa  RL5_DELAS RecName: Full=50S ribosomal protein L5;
    9::183     1e-58  56%  185 aa  RL5_CAUSK RecName: Full=50S ribosomal protein L5;
    7::182     2e-58  59%  182 aa  RL5_THEAQ RecName: Full=50S ribosomal protein L5;
    4::179     2e-58  57%  180 aa  RL5_SYMTH RecName: Full=50S ribosomal protein L5;
    8::182     2e-58  59%  185 aa  RL5_STRAW RecName: Full=50S ribosomal protein L5;
    9::183     2e-58  56%  185 aa  RL5_CAUCR RecName: Full=50S ribosomal protein L5;
    9::183     2e-58  56%  185 aa  RL5_CAUCN RecName: Full=50S ribosomal protein L5;
    4::179     2e-58  57%  184 aa  RL5_UREPA RecName: Full=50S ribosomal protein L5;
    4::179     2e-58  57%  184 aa  RL5_UREP2 RecName: Full=50S ribosomal protein L5;
    3::177     2e-58  56%  179 aa  RL5_THISH RecName: Full=50S ribosomal protein L5;
    3::177     2e-58  57%  179 aa  RL5_CELJU RecName: Full=50S ribosomal protein L5;
    1::179     2e-58  54%  179 aa  RL5_BUCCC RecName: Full=50S ribosomal protein L5;
    1::179     2e-58  56%  179 aa  RL5_BLOPB RecName: Full=50S ribosomal protein L5;
    9::183     2e-58  58%  185 aa  RL5_AGRRK RecName: Full=50S ribosomal protein L5;
    4::179     3e-58  57%  184 aa  RL5_UREU1 RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATW RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATT RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATO RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATN RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATH RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRATF RecName: Full=50S ribosomal protein L5;
    3::177     3e-58  57%  179 aa  RL5_FRAT1 RecName: Full=50S ribosomal protein L5;
    9::183     3e-58  58%  185 aa  RL5_BRAJA RecName: Full=50S ribosomal protein L5;
    8::182     4e-58  59%  185 aa  RL5_STRGG RecName: Full=50S ribosomal protein L5;
    9::183     4e-58  57%  185 aa  RL5_RHIEC RecName: Full=50S ribosomal protein L5;
    9::183     4e-58  57%  185 aa  RL5_RHIE6 RecName: Full=50S ribosomal protein L5;
   15::189     4e-58  58%  193 aa  RL5_RENSM RecName: Full=50S ribosomal protein L5;
   13::187     4e-58  59%  191 aa  RL5_MICLU RecName: Full=50S ribosomal protein L5;
   13::187     4e-58  59%  191 aa  RL5_MICLC RecName: Full=50S ribosomal protein L5;
    3::179     4e-58  53%  181 aa  RL5_COLP3 RecName: Full=50S ribosomal protein L5;
    4::179     4e-58  55%  179 aa  RL5_BUCAT RecName: Full=50S ribosomal protein L5;
    4::179     4e-58  55%  179 aa  RL5_BUCAI RecName: Full=50S ribosomal protein L5;
    4::179     4e-58  55%  179 aa  RL5_BUCA5 RecName: Full=50S ribosomal protein L5;
    1::178     4e-58  57%  180 aa  RK5_OLTVI RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::178     4e-58  57%  185 aa  RK5_CHLAT RecName: Full=50S ribosomal protein L5, chloroplastic;
    9::183     5e-58  57%  185 aa  RL5_SINMW RecName: Full=50S ribosomal protein L5;
    9::183     5e-58  57%  185 aa  RL5_MESSB RecName: Full=50S ribosomal protein L5;
    8::182     5e-58  58%  183 aa  RL5_CORA7 RecName: Full=50S ribosomal protein L5;
   12::189     5e-58  58%  193 aa  RL5_ARTCA RecName: Full=50S ribosomal protein L5;
    9::184     5e-58  57%  188 aa  RL5_AQUPY RecName: Full=50S ribosomal protein L5;
    3::179     5e-58  55%  186 aa  RK5_LEPTE RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::177     6e-58  57%  179 aa  RL5_PSEAE RecName: Full=50S ribosomal protein L5;
    3::177     6e-58  57%  179 aa  RL5_PSEAB RecName: Full=50S ribosomal protein L5;
    3::177     6e-58  57%  179 aa  RL5_PSEA8 RecName: Full=50S ribosomal protein L5;
   10::184     6e-58  58%  187 aa  RL5_MYCPA RecName: Full=50S ribosomal protein L5;
    3::177     6e-58  56%  179 aa  RL5_AZOVD RecName: Full=50S ribosomal protein L5;
    7::182     8e-58  57%  182 aa  RL5_THETH RecName: Full=50S ribosomal protein L5;AltName:
    7::182     8e-58  57%  182 aa  RL5_THET8 RecName: Full=50S ribosomal protein L5;
    7::182     8e-58  57%  182 aa  RL5_THET2 RecName: Full=50S ribosomal protein L5;
    8::183     8e-58  56%  184 aa  RL5_THEMA RecName: Full=50S ribosomal protein L5;
    3::177     8e-58  58%  179 aa  RL5_RHOFD RecName: Full=50S ribosomal protein L5;
    8::183     8e-58  56%  185 aa  RL5_RHIME RecName: Full=50S ribosomal protein L5;
    3::177     8e-58  56%  179 aa  RL5_PSEA7 RecName: Full=50S ribosomal protein L5;
   10::184     8e-58  57%  186 aa  RL5_MARMM RecName: Full=50S ribosomal protein L5;
    3::177     8e-58  56%  179 aa  RL5_FRATM RecName: Full=50S ribosomal protein L5;
    4::177     8e-58  57%  187 aa  RL5_BRAHW RecName: Full=50S ribosomal protein L5;
    4::181     8e-58  57%  182 aa  RL5_BORHD RecName: Full=50S ribosomal protein L5;
    8::183     1e-57  56%  184 aa  RL5_THESQ RecName: Full=50S ribosomal protein L5;
    4::182     1e-57  57%  191 aa  RL5_SALRD RecName: Full=50S ribosomal protein L5;
   16::190     1e-57  55%  192 aa  RL5_RHILO RecName: Full=50S ribosomal protein L5;
   17::193     1e-57  55%  196 aa  RL5_CHLPB RecName: Full=50S ribosomal protein L5;
    4::181     1e-57  57%  182 aa  RL5_BORT9 RecName: Full=50S ribosomal protein L5;
    1::178     1e-57  56%  181 aa  RK5_RHDSA RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::178     1e-57  56%  179 aa  RK5_CHLRE RecName: Full=50S ribosomal protein L5, chloroplastic;
    6::181     1e-57  59%  182 aa  RL5_THEM4 RecName: Full=50S ribosomal protein L5;
    3::177     1e-57  55%  179 aa  RL5_PSEU5 RecName: Full=50S ribosomal protein L5;
    3::177     1e-57  55%  178 aa  RL5_PROMP RecName: Full=50S ribosomal protein L5;
    3::176     1e-57  55%  179 aa  RL5_PROMA RecName: Full=50S ribosomal protein L5;
   14::188     1e-57  58%  195 aa  RL5_LEIXX RecName: Full=50S ribosomal protein L5;
    9::183     1e-57  57%  185 aa  RL5_AGRVS RecName: Full=50S ribosomal protein L5;
    9::183     2e-57  57%  185 aa  RL5_RHIL3 RecName: Full=50S ribosomal protein L5;
    3::178     2e-57  54%  179 aa  RL5_PROM2 RecName: Full=50S ribosomal protein L5;
    1::179     2e-57  58%  179 aa  RL5_DESVV RecName: Full=50S ribosomal protein L5;
    1::179     2e-57  58%  179 aa  RL5_DESVH RecName: Full=50S ribosomal protein L5;
    8::182     2e-57  58%  185 aa  RL5_STRCO RecName: Full=50S ribosomal protein L5;
    3::179     2e-57  54%  179 aa  RL5_ENT38 RecName: Full=50S ribosomal protein L5;
    1::180     2e-57  57%  183 aa  RL5_CHLTE RecName: Full=50S ribosomal protein L5;
    3::177     3e-57  54%  179 aa  RL5_RICBR RecName: Full=50S ribosomal protein L5;
    3::177     3e-57  54%  179 aa  RL5_RICB8 RecName: Full=50S ribosomal protein L5;
    7::183     3e-57  56%  185 aa  RL5_RHOPT RecName: Full=50S ribosomal protein L5;
    7::183     3e-57  56%  185 aa  RL5_RHOPA RecName: Full=50S ribosomal protein L5;AltName:
    3::177     3e-57  55%  179 aa  RL5_PSEPW RecName: Full=50S ribosomal protein L5;
    3::177     3e-57  55%  179 aa  RL5_PSEPK RecName: Full=50S ribosomal protein L5;
    3::177     3e-57  55%  179 aa  RL5_PSEPG RecName: Full=50S ribosomal protein L5;
    3::177     3e-57  55%  179 aa  RL5_PSEP1 RecName: Full=50S ribosomal protein L5;
    3::178     3e-57  54%  179 aa  RL5_PROMS RecName: Full=50S ribosomal protein L5;
    3::178     3e-57  54%  179 aa  RL5_PROM9 RecName: Full=50S ribosomal protein L5;
    3::178     3e-57  54%  179 aa  RL5_PROM0 RecName: Full=50S ribosomal protein L5;
    4::181     3e-57  57%  182 aa  RL5_BORRA RecName: Full=50S ribosomal protein L5;
    4::181     3e-57  57%  182 aa  RL5_BORDL RecName: Full=50S ribosomal protein L5;
    3::179     3e-57  55%  179 aa  RL5_ALHEH RecName: Full=50S ribosomal protein L5;
    1::178     3e-57  56%  179 aa  RK5_GRATL RecName: Full=50S ribosomal protein L5, chloroplastic;
    9::183     4e-57  55%  185 aa  RL5_BARHE RecName: Full=50S ribosomal protein L5;
    3::177     5e-57  55%  179 aa  RL5_PSEE4 RecName: Full=50S ribosomal protein L5;
    3::177     5e-57  54%  178 aa  RL5_PROM5 RecName: Full=50S ribosomal protein L5;
   10::184     5e-57  57%  187 aa  RL5_MYCTU RecName: Full=50S ribosomal protein L5;
   10::184     5e-57  57%  187 aa  RL5_MYCTA RecName: Full=50S ribosomal protein L5;
   10::184     5e-57  57%  187 aa  RL5_MYCBP RecName: Full=50S ribosomal protein L5;
   10::184     5e-57  57%  187 aa  RL5_MYCBO RecName: Full=50S ribosomal protein L5;
    1::179     5e-57  58%  179 aa  RL5_DESDA RecName: Full=50S ribosomal protein L5;
    1::178     5e-57  57%  181 aa  RK5_GUITH RecName: Full=50S ribosomal protein L5, chloroplastic;
   19::195     7e-57  56%  198 aa  RL5_PROVI RecName: Full=50S ribosomal protein L5;
    3::176     7e-57  56%  179 aa  RL5_PROM4 RecName: Full=50S ribosomal protein L5;
    1::179     7e-57  55%  180 aa  RL5_MYCGE RecName: Full=50S ribosomal protein L5;
    3::179     7e-57  54%  179 aa  RL5_EDWI9 RecName: Full=50S ribosomal protein L5;
    9::183     7e-57  55%  185 aa  RL5_BARQU RecName: Full=50S ribosomal protein L5;
    7::185     9e-57  55%  185 aa  RL5_TREPS RecName: Full=50S ribosomal protein L5;
    7::185     9e-57  55%  185 aa  RL5_TREPA RecName: Full=50S ribosomal protein L5;
    3::177     9e-57  55%  179 aa  RL5_RICRS RecName: Full=50S ribosomal protein L5;
    3::177     9e-57  55%  179 aa  RL5_RICRO RecName: Full=50S ribosomal protein L5;
    3::177     9e-57  54%  179 aa  RL5_NITEU RecName: Full=50S ribosomal protein L5;
    7::183     9e-57  54%  185 aa  RL5_BART1 RecName: Full=50S ribosomal protein L5;
    3::176     9e-57  55%  179 aa  RK5_PAUCH RecName: Full=50S ribosomal protein L5, organellar
    1::178     9e-57  57%  184 aa  RK5_MESVI RecName: Full=50S ribosomal protein L5, chloroplastic;
    9::183     1e-56  55%  185 aa  RL5_RHOP5 RecName: Full=50S ribosomal protein L5;
    3::177     1e-56  54%  178 aa  RL5_PSYWF RecName: Full=50S ribosomal protein L5;
    7::183     2e-56  55%  185 aa  RL5_RHOP2 RecName: Full=50S ribosomal protein L5;
    8::184     2e-56  57%  196 aa  RL5_RHOBA RecName: Full=50S ribosomal protein L5;
    3::179     2e-56  54%  179 aa  RL5_HAMD5 RecName: Full=50S ribosomal protein L5;
    8::184     2e-56  56%  184 aa  RL5_CORK4 RecName: Full=50S ribosomal protein L5;
    3::179     2e-56  53%  179 aa  RL5_PECCP RecName: Full=50S ribosomal protein L5;
   10::184     2e-56  56%  187 aa  RL5_MYCBT RecName: Full=50S ribosomal protein L5;
   12::186     2e-56  56%  189 aa  RL5_KOCRD RecName: Full=50S ribosomal protein L5;
    3::179     2e-56  53%  179 aa  RL5_ERWCT RecName: Full=50S ribosomal protein L5;
    1::179     2e-56  57%  179 aa  RL5_DESMR RecName: Full=50S ribosomal protein L5;
    3::177     2e-56  57%  179 aa  RL5_BURXL RecName: Full=50S ribosomal protein L5;
    3::177     2e-56  57%  179 aa  RL5_BURPP RecName: Full=50S ribosomal protein L5;
    3::177     2e-56  57%  179 aa  RL5_BURP8 RecName: Full=50S ribosomal protein L5;
    9::183     2e-56  55%  185 aa  RL5_BRASO RecName: Full=50S ribosomal protein L5;
    6::177     2e-56  56%  182 aa  RK5_EMIHU RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::177     3e-56  55%  179 aa  RL5_RICFE RecName: Full=50S ribosomal protein L5;
    9::183     3e-56  56%  185 aa  RL5_RHILW RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  54%  179 aa  RL5_PSEMY RecName: Full=50S ribosomal protein L5;
    4::176     3e-56  55%  182 aa  RL5_COXBU RecName: Full=50S ribosomal protein L5;
    4::176     3e-56  55%  182 aa  RL5_COXBR RecName: Full=50S ribosomal protein L5;
    4::176     3e-56  55%  182 aa  RL5_COXBN RecName: Full=50S ribosomal protein L5;
    4::176     3e-56  55%  182 aa  RL5_COXB2 RecName: Full=50S ribosomal protein L5;
    4::176     3e-56  55%  182 aa  RL5_COXB1 RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  56%  179 aa  RL5_BURM1 RecName: Full=50S ribosomal protein L5;
    8::183     3e-56  57%  183 aa  RL5_THELT RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  55%  179 aa  RL5_SACD2 RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  55%  179 aa  RL5_RICCN RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  55%  179 aa  RL5_RICAE RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  55%  179 aa  RL5_PSEPF RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  55%  179 aa  RL5_PSEF5 RecName: Full=50S ribosomal protein L5;
    3::177     3e-56  54%  179 aa  RL5_DICNV RecName: Full=50S ribosomal protein L5;
    9::183     3e-56  55%  185 aa  RL5_BRASB RecName: Full=50S ribosomal protein L5;
    1::178     4e-56  54%  180 aa  RL5_RALSO RecName: Full=50S ribosomal protein L5;
    3::177     4e-56  55%  179 aa  RL5_PSEFS RecName: Full=50S ribosomal protein L5;
    1::178     4e-56  54%  183 aa  RL5_LEPBP RecName: Full=50S ribosomal protein L5;
    1::178     4e-56  54%  183 aa  RL5_LEPBA RecName: Full=50S ribosomal protein L5;
    8::182     4e-56  57%  193 aa  RL5_CORU7 RecName: Full=50S ribosomal protein L5;
   16::192     4e-56  56%  195 aa  RL5_CHLPD RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUSU RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUSI RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUO2 RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUME RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUMB RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUC2 RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUAB RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  54%  185 aa  RL5_BRUA1 RecName: Full=50S ribosomal protein L5;
    9::183     4e-56  56%  185 aa  RL5_BARBK RecName: Full=50S ribosomal protein L5;
    7::183     6e-56  54%  185 aa  RL5_RHOPS RecName: Full=50S ribosomal protein L5;
    3::177     6e-56  55%  179 aa  RL5_PSEU2 RecName: Full=50S ribosomal protein L5;
    3::177     6e-56  55%  179 aa  RL5_PSE14 RecName: Full=50S ribosomal protein L5;
    7::183     6e-56  54%  185 aa  RL5_NITWN RecName: Full=50S ribosomal protein L5;
    1::179     6e-56  55%  181 aa  RL5_CAMHC RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SHISS RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SHIF8 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SHIDS RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SHIBS RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SHIB3 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_SALAR RecName: Full=50S ribosomal protein L5;
    1::177     7e-56  54%  179 aa  RL5_RUTMC RecName: Full=50S ribosomal protein L5;
   10::185     7e-56  58%  187 aa  RL5_ROSDO RecName: Full=50S ribosomal protein L5;
    3::177     7e-56  54%  179 aa  RL5_RICPR RecName: Full=50S ribosomal protein L5;
    3::178     7e-56  52%  179 aa  RL5_PROM1 RecName: Full=50S ribosomal protein L5;
    4::179     7e-56  52%  179 aa  RL5_MARAV RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_KLEP7 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_KLEP3 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ESCF3 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ENTS8 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOUT RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOSM RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOSE RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOLU RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOLI RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOLC RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOL6 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOL5 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOK1 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOHS RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECODH RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECOBW RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO8A RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO81 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO7I RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO5E RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO57 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO55 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO45 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO27 RecName: Full=50S ribosomal protein L5;
    3::179     7e-56  53%  179 aa  RL5_ECO24 RecName: Full=50S ribosomal protein L5;
   16::192     7e-56  56%  195 aa  RL5_CHLL2 RecName: Full=50S ribosomal protein L5;
    1::178     7e-56  54%  180 aa  RK5_CHLVU RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::179     1e-55  53%  179 aa  RL5_SALTY RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALTI RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALSV RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALPK RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALPC RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALPB RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALPA RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALNS RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALHS RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALG2 RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALEP RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALDC RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALCH RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_SALA4 RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  54%  181 aa  RL5_RICCK RecName: Full=50S ribosomal protein L5;
    3::178     1e-55  52%  179 aa  RL5_PROMT RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_PHOLL RecName: Full=50S ribosomal protein L5;
    3::179     1e-55  53%  179 aa  RL5_CITK8 RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  55%  179 aa  RL5_BURS3 RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  55%  179 aa  RL5_BURCH RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  55%  179 aa  RL5_BURCC RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  55%  179 aa  RL5_BURCA RecName: Full=50S ribosomal protein L5;
    1::178     1e-55  54%  184 aa  RK5_NEPOL RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::179     1e-55  53%  179 aa  RL5_SODGM RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  54%  179 aa  RL5_RICPU RecName: Full=50S ribosomal protein L5;
    3::177     1e-55  55%  179 aa  RL5_PSESM RecName: Full=50S ribosomal protein L5;
    1::179     1e-55  56%  179 aa  RL5_LAWIP RecName: Full=50S ribosomal protein L5;
    9::183     1e-55  53%  185 aa  RL5_BRUA2 RecName: Full=50S ribosomal protein L5;
    1::178     1e-55  54%  184 aa  RK5_OSTTA RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::177     2e-55  54%  179 aa  RL5_RICAH RecName: Full=50S ribosomal protein L5;
    3::179     2e-55  53%  179 aa  RL5_ERWT9 RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  57%  179 aa  RL5_DIAST RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  57%  179 aa  RL5_ACISJ RecName: Full=50S ribosomal protein L5;
   17::193     2e-55  54%  196 aa  RL5_ACIC1 RecName: Full=50S ribosomal protein L5;
    1::178     2e-55  54%  180 aa  RK5_SCEOB RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::178     2e-55  52%  186 aa  RK5_CHAGL RecName: Full=50S ribosomal protein L5, chloroplastic;
    7::183     2e-55  55%  183 aa  RL5_TROWT RecName: Full=50S ribosomal protein L5;
    7::183     2e-55  55%  183 aa  RL5_TROW8 RecName: Full=50S ribosomal protein L5;
   16::192     2e-55  55%  194 aa  RL5_PELLD RecName: Full=50S ribosomal protein L5;
    8::182     2e-55  56%  189 aa  RL5_CORJK RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURTA RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURPS RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURP6 RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURP1 RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURP0 RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURMS RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURM9 RecName: Full=50S ribosomal protein L5;
    3::177     2e-55  55%  179 aa  RL5_BURM7 RecName: Full=50S ribosomal protein L5;
    3::179     2e-55  51%  179 aa  RL5_BUCAK RecName: Full=50S ribosomal protein L5;
    3::176     3e-55  55%  179 aa  RL5_SYNPW RecName: Full=50S ribosomal protein L5;
    3::179     3e-55  52%  179 aa  RL5_SERP5 RecName: Full=50S ribosomal protein L5;
    3::177     3e-55  53%  179 aa  RL5_RICTY RecName: Full=50S ribosomal protein L5;
   10::184     3e-55  57%  186 aa  RL5_RHOSK RecName: Full=50S ribosomal protein L5;
   10::184     3e-55  57%  186 aa  RL5_RHOS4 RecName: Full=50S ribosomal protein L5;
   10::185     3e-55  53%  187 aa  RL5_GLUOX RecName: Full=50S ribosomal protein L5;
    3::177     3e-55  54%  179 aa  RL5_BURVG RecName: Full=50S ribosomal protein L5;
    3::177     3e-55  54%  179 aa  RL5_BURCM RecName: Full=50S ribosomal protein L5;
    3::177     3e-55  54%  179 aa  RL5_BURCJ RecName: Full=50S ribosomal protein L5;
    3::177     3e-55  54%  179 aa  RL5_BURA4 RecName: Full=50S ribosomal protein L5;
    3::179     4e-55  52%  179 aa  RL5_YERE8 RecName: Full=50S ribosomal protein L5;
   10::184     4e-55  57%  186 aa  RL5_RHOS1 RecName: Full=50S ribosomal protein L5;
    3::179     4e-55  52%  179 aa  RL5_PROMH RecName: Full=50S ribosomal protein L5;
    9::183     4e-55  54%  185 aa  RL5_OCHA4 RecName: Full=50S ribosomal protein L5;
    1::177     5e-55  51%  179 aa  RL5_XYLFM RecName: Full=50S ribosomal protein L5;
   16::192     5e-55  55%  195 aa  RL5_PELPB RecName: Full=50S ribosomal protein L5;
    3::177     5e-55  52%  179 aa  RL5_NITEC RecName: Full=50S ribosomal protein L5;
   13::187     5e-55  56%  190 aa  RL5_BIFAA RecName: Full=50S ribosomal protein L5;
    1::177     6e-55  53%  179 aa  RL5_VESOH RecName: Full=50S ribosomal protein L5;
   10::184     6e-55  57%  186 aa  RL5_RHOS5 RecName: Full=50S ribosomal protein L5;
    1::178     6e-55  53%  180 aa  RK5_PSEAK RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::177     8e-55  51%  179 aa  RL5_XYLFT RecName: Full=50S ribosomal protein L5;
    1::177     8e-55  51%  179 aa  RL5_XYLFA RecName: Full=50S ribosomal protein L5;
    1::177     8e-55  51%  179 aa  RL5_XYLF2 RecName: Full=50S ribosomal protein L5;
    2::178     8e-55  54%  178 aa  RL5_WIGBR RecName: Full=50S ribosomal protein L5;
    3::178     8e-55  55%  185 aa  RL5_MYCGA RecName: Full=50S ribosomal protein L5;
    1::165     1e-54  57%  180 aa  RL5_MYCPN RecName: Full=50S ribosomal protein L5;
    1::178     1e-54  54%  182 aa  RL5_LEPIN RecName: Full=50S ribosomal protein L5;
    1::178     1e-54  54%  182 aa  RL5_LEPIC RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPY RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPS RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPP RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPN RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPG RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPE RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPB RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERPA RecName: Full=50S ribosomal protein L5;
    3::179     2e-54  51%  179 aa  RL5_YERP3 RecName: Full=50S ribosomal protein L5;
   10::184     2e-54  57%  186 aa  RL5_SILPO RecName: Full=50S ribosomal protein L5;
    1::157     2e-54  57%  180 aa  RL5_POLSQ RecName: Full=50S ribosomal protein L5;
    1::179     2e-54  54%  179 aa  RL5_DESAD RecName: Full=50S ribosomal protein L5;
    1::178     2e-54  53%  184 aa  RK5_ZYGCR RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::178     2e-54  53%  180 aa  RK5_STIHE RecName: Full=50S ribosomal protein L5, chloroplastic;
   13::187     2e-54  55%  190 aa  RL5_BIFLO RecName: Full=50S ribosomal protein L5;
   13::187     2e-54  55%  190 aa  RL5_BIFLI RecName: Full=50S ribosomal protein L5;
   13::187     2e-54  55%  190 aa  RL5_BIFLD RecName: Full=50S ribosomal protein L5;
    7::183     3e-54  52%  185 aa  RL5_RHOPB RecName: Full=50S ribosomal protein L5;
    1::177     3e-54  53%  179 aa  RL5_BORPD RecName: Full=50S ribosomal protein L5;
   75::253     3e-54  54%  279 aa  RK5_ORYSJ RecName: Full=50S ribosomal protein L5,
    1::178     3e-54  52%  189 aa  RK5_CHAVU RecName: Full=50S ribosomal protein L5, chloroplastic;
    3::177     4e-54  50%  181 aa  RL5_NITOC RecName: Full=50S ribosomal protein L5;
   10::184     4e-54  56%  187 aa  RL5_MYCLE RecName: Full=50S ribosomal protein L5;
   10::184     4e-54  56%  187 aa  RL5_MYCLB RecName: Full=50S ribosomal protein L5;
    4::179     4e-54  53%  181 aa  RL5_HELHP RecName: Full=50S ribosomal protein L5;
   12::179     4e-54  58%  181 aa  RL5_AYWBP RecName: Full=50S ribosomal protein L5;
    3::176     5e-54  52%  190 aa  RL5_BLOFL RecName: Full=50S ribosomal protein L5;
   58::232     5e-54  54%  262 aa  RK5_ARATH RecName: Full=50S ribosomal protein L5,
    7::183     7e-54  51%  185 aa  RL5_NITHX RecName: Full=50S ribosomal protein L5;
    1::178     7e-54  54%  182 aa  RL5_LEPBJ RecName: Full=50S ribosomal protein L5;
    3::178     7e-54  56%  179 aa  RL5_DEHSC RecName: Full=50S ribosomal protein L5;
    3::178     7e-54  56%  179 aa  RL5_DEHSB RecName: Full=50S ribosomal protein L5;
    3::176     9e-54  54%  179 aa  RL5_SYNPX RecName: Full=50S ribosomal protein L5;
    3::178     9e-54  56%  179 aa  RL5_DEHE1 RecName: Full=50S ribosomal protein L5;
    1::177     9e-54  53%  179 aa  RL5_BORPE RecName: Full=50S ribosomal protein L5;
    1::177     9e-54  53%  179 aa  RL5_BORPA RecName: Full=50S ribosomal protein L5;
    1::177     9e-54  53%  179 aa  RL5_BORBR RecName: Full=50S ribosomal protein L5;
   12::179     1e-53  58%  181 aa  RL5_ONYPE RecName: Full=50S ribosomal protein L5;
    8::182     2e-53  52%  192 aa  RL5_SPHAL RecName: Full=50S ribosomal protein L5;
   10::186     2e-53  55%  189 aa  RL5_FRASN RecName: Full=50S ribosomal protein L5;
   10::185     2e-53  57%  187 aa  RL5_SILST RecName: Full=50S ribosomal protein L5;
    1::157     3e-53  56%  180 aa  RL5_POLNS RecName: Full=50S ribosomal protein L5;
    4::179     3e-53  54%  181 aa  RL5_HELPS RecName: Full=50S ribosomal protein L5;
    3::179     3e-53  52%  181 aa  RL5_CAMJD RecName: Full=50S ribosomal protein L5;
    4::179     3e-53  54%  181 aa  RL5_HELAH RecName: Full=50S ribosomal protein L5;
    3::179     3e-53  51%  181 aa  RL5_CAMJR RecName: Full=50S ribosomal protein L5;
    3::179     3e-53  51%  181 aa  RL5_CAMJJ RecName: Full=50S ribosomal protein L5;
    3::179     3e-53  51%  181 aa  RL5_CAMJE RecName: Full=50S ribosomal protein L5;
    3::179     3e-53  51%  181 aa  RL5_CAMJ8 RecName: Full=50S ribosomal protein L5;
    1::179     3e-53  52%  181 aa  RL5_CAMC1 RecName: Full=50S ribosomal protein L5;
    1::179     3e-53  51%  179 aa  RL5_BDEBA RecName: Full=50S ribosomal protein L5;
    3::177     3e-53  51%  178 aa  RL5_ACIBY RecName: Full=50S ribosomal protein L5;
    3::177     3e-53  51%  178 aa  RL5_ACIBT RecName: Full=50S ribosomal protein L5;
    3::177     3e-53  51%  178 aa  RL5_ACIBS RecName: Full=50S ribosomal protein L5;
    3::177     3e-53  51%  178 aa  RL5_ACIB5 RecName: Full=50S ribosomal protein L5;
    3::177     3e-53  51%  178 aa  RL5_ACIB3 RecName: Full=50S ribosomal protein L5;
    3::175     5e-53  55%  177 aa  RL5_WOLTR RecName: Full=50S ribosomal protein L5;
    4::179     5e-53  53%  181 aa  RL5_HELPJ RecName: Full=50S ribosomal protein L5;
    1::179     5e-53  51%  181 aa  RL5_CAMC5 RecName: Full=50S ribosomal protein L5;
    1::178     6e-53  53%  181 aa  RL5_SULNB RecName: Full=50S ribosomal protein L5;
    4::179     6e-53  54%  181 aa  RL5_HELPH RecName: Full=50S ribosomal protein L5;
    3::177     6e-53  50%  178 aa  RL5_ACIAD RecName: Full=50S ribosomal protein L5;
    3::177     8e-53  55%  179 aa  RL5_VARPS RecName: Full=50S ribosomal protein L5;
    3::176     8e-53  53%  179 aa  RL5_SYNS3 RecName: Full=50S ribosomal protein L5;
   10::184     8e-53  55%  187 aa  RL5_MYCA9 RecName: Full=50S ribosomal protein L5;
    1::180     8e-53  51%  184 aa  RK5_BIGNA RecName: Full=50S ribosomal protein L5, chloroplastic;
   12::186     1e-52  55%  189 aa  RL5_KINRD RecName: Full=50S ribosomal protein L5;
    8::182     1e-52  54%  190 aa  RL5_COREF RecName: Full=50S ribosomal protein L5;
    3::179     1e-52  50%  179 aa  RL5_SHIFL RecName: Full=50S ribosomal protein L5;
   10::184     1e-52  55%  186 aa  RL5_JANSC RecName: Full=50S ribosomal protein L5;
    4::179     1e-52  53%  181 aa  RL5_HELPG RecName: Full=50S ribosomal protein L5;
    4::179     1e-52  53%  181 aa  RL5_HELP2 RecName: Full=50S ribosomal protein L5;
    3::179     1e-52  51%  181 aa  RL5_BAUCH RecName: Full=50S ribosomal protein L5;
   10::184     2e-52  56%  187 aa  RL5_NOCFA RecName: Full=50S ribosomal protein L5;
    3::179     2e-52  51%  181 aa  RL5_CAMLR RecName: Full=50S ribosomal protein L5;
    7::179     3e-52  56%  185 aa  RL5_BACV8 RecName: Full=50S ribosomal protein L5;
    9::183     4e-52  51%  185 aa  RL5_XANP2 RecName: Full=50S ribosomal protein L5;
    3::179     4e-52  52%  184 aa  RL5_WOLSU RecName: Full=50S ribosomal protein L5;
    1::153     4e-52  57%  180 aa  RL5_STRMK RecName: Full=50S ribosomal protein L5;
    1::153     4e-52  57%  180 aa  RL5_STRM5 RecName: Full=50S ribosomal protein L5;
   10::184     4e-52  53%  187 aa  RL5_MYCS2 RecName: Full=50S ribosomal protein L5;
    1::155     5e-52  57%  180 aa  RL5_XANOR RecName: Full=50S ribosomal protein L5;
    1::155     5e-52  57%  180 aa  RL5_XANOP RecName: Full=50S ribosomal protein L5;
    1::155     5e-52  57%  180 aa  RL5_XANOM RecName: Full=50S ribosomal protein L5;
   12::183     5e-52  53%  210 aa  RL5_PROAC RecName: Full=50S ribosomal protein L5;
    7::179     5e-52  55%  186 aa  RL5_PORGI RecName: Full=50S ribosomal protein L5;
    7::179     5e-52  55%  186 aa  RL5_PORG3 RecName: Full=50S ribosomal protein L5;
    4::176     5e-52  51%  179 aa  RL5_ALCBS RecName: Full=50S ribosomal protein L5;
    1::178     5e-52  52%  180 aa  RK5_OEDCA RecName: Full=50S ribosomal protein L5, chloroplastic;
    9::183     7e-52  51%  185 aa  RL5_AZOC5 RecName: Full=50S ribosomal protein L5;
   10::184     9e-52  54%  187 aa  RL5_MYCSS RecName: Full=50S ribosomal protein L5;
   10::184     9e-52  54%  187 aa  RL5_MYCSK RecName: Full=50S ribosomal protein L5;
   10::184     9e-52  54%  187 aa  RL5_MYCSJ RecName: Full=50S ribosomal protein L5;
   12::186     1e-51  56%  189 aa  RL5_SALTO RecName: Full=50S ribosomal protein L5;
   12::186     1e-51  56%  189 aa  RL5_SALAI RecName: Full=50S ribosomal protein L5;
    4::179     1e-51  53%  181 aa  RL5_HELPY RecName: Full=50S ribosomal protein L5;
    6::182     1e-51  53%  191 aa  RL5_CORGL RecName: Full=50S ribosomal protein L5;
    6::182     1e-51  53%  191 aa  RL5_CORGB RecName: Full=50S ribosomal protein L5;
    7::179     1e-51  54%  185 aa  RL5_BACTN RecName: Full=50S ribosomal protein L5;
    8::184     1e-51  53%  187 aa  RL5_CORDI RecName: Full=50S ribosomal protein L5;
    7::184     2e-51  54%  187 aa  RL5_SACEN RecName: Full=50S ribosomal protein L5;
   10::185     2e-51  55%  187 aa  RL5_DINSH RecName: Full=50S ribosomal protein L5;
    1::176     2e-51  52%  185 aa  RL5_PARUW RecName: Full=50S ribosomal protein L5;
    3::177     2e-51  51%  179 aa  RL5_DECAR RecName: Full=50S ribosomal protein L5;
    7::179     2e-51  54%  185 aa  RL5_BACFR RecName: Full=50S ribosomal protein L5;
    7::179     2e-51  54%  185 aa  RL5_BACFN RecName: Full=50S ribosomal protein L5;
    4::181     4e-51  51%  182 aa  RL5_BORGA RecName: Full=50S ribosomal protein L5;
    4::181     4e-51  52%  182 aa  RL5_BORBZ RecName: Full=50S ribosomal protein L5;
    4::181     4e-51  52%  182 aa  RL5_BORBU RecName: Full=50S ribosomal protein L5;
    3::156     6e-51  57%  179 aa  RL5_JANMA RecName: Full=50S ribosomal protein L5;
    1::178     6e-51  53%  180 aa  RL5_CHLFF RecName: Full=50S ribosomal protein L5;
    3::177     7e-51  49%  179 aa  RL5_NEIMF RecName: Full=50S ribosomal protein L5;
    3::177     7e-51  49%  179 aa  RL5_NEIMB RecName: Full=50S ribosomal protein L5;
    3::177     7e-51  49%  179 aa  RL5_NEIM0 RecName: Full=50S ribosomal protein L5;
    4::181     7e-51  51%  182 aa  RL5_BORAP RecName: Full=50S ribosomal protein L5;
    3::153     9e-51  56%  179 aa  RL5_NITMU RecName: Full=50S ribosomal protein L5;
    3::177     9e-51  49%  179 aa  RL5_NEIMA RecName: Full=50S ribosomal protein L5;
    1::153     2e-50  56%  180 aa  RL5_XANCP RecName: Full=50S ribosomal protein L5;
    1::153     2e-50  56%  180 aa  RL5_XANCB RecName: Full=50S ribosomal protein L5;
    1::153     2e-50  56%  180 aa  RL5_XANC8 RecName: Full=50S ribosomal protein L5;
    1::153     2e-50  56%  180 aa  RL5_XANAC RecName: Full=50S ribosomal protein L5;
    3::177     2e-50  49%  179 aa  RL5_NEIG1 RecName: Full=50S ribosomal protein L5;
   20::196     2e-50  54%  199 aa  RL5_FRASC RecName: Full=50S ribosomal protein L5;
    1::153     2e-50  56%  180 aa  RL5_XANC5 RecName: Full=50S ribosomal protein L5;
    1::180     2e-50  51%  184 aa  RL5_PELUB RecName: Full=50S ribosomal protein L5;
    3::156     2e-50  56%  179 aa  RL5_HERAR RecName: Full=50S ribosomal protein L5;
    3::175     3e-50  52%  177 aa  RL5_WOLWR RecName: Full=50S ribosomal protein L5;
    3::175     3e-50  52%  177 aa  RL5_WOLPM RecName: Full=50S ribosomal protein L5;
    1::180     5e-50  50%  181 aa  RK5_HETA4 RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::180     5e-50  50%  181 aa  RK5_HETA2 RecName: Full=50S ribosomal protein L5, chloroplastic;
   15::191     8e-50  54%  194 aa  RL5_FRAAA RecName: Full=50S ribosomal protein L5;
    1::178     8e-50  52%  180 aa  RL5_CHLAB RecName: Full=50S ribosomal protein L5;
    3::175     1e-49  51%  178 aa  RL5_WOLPP RecName: Full=50S ribosomal protein L5;
   12::177     1e-49  50%  179 aa  RL5_ANAMM RecName: Full=50S ribosomal protein L5;
   12::177     1e-49  50%  179 aa  RL5_ANAMF RecName: Full=50S ribosomal protein L5;
    1::179     2e-49  48%  182 aa  RL5_MYCMO RecName: Full=50S ribosomal protein L5;
    1::178     2e-49  53%  180 aa  RL5_CHLCV RecName: Full=50S ribosomal protein L5;
    2::175     7e-49  50%  177 aa  RL5_EHRRW RecName: Full=50S ribosomal protein L5;
    7::179     9e-49  53%  185 aa  RL5_PARD8 RecName: Full=50S ribosomal protein L5;
   10::175     9e-49  49%  177 aa  RL5_ANAPZ RecName: Full=50S ribosomal protein L5;
    2::175     2e-48  49%  177 aa  RL5_EHRRG RecName: Full=50S ribosomal protein L5;
    4::179     3e-48  48%  181 aa  RL5_MYCHJ RecName: Full=50S ribosomal protein L5;
    4::179     3e-48  48%  181 aa  RL5_MYCH7 RecName: Full=50S ribosomal protein L5;
    4::179     3e-48  48%  181 aa  RL5_MYCH2 RecName: Full=50S ribosomal protein L5;
    2::175     3e-48  51%  177 aa  RL5_EHRCJ RecName: Full=50S ribosomal protein L5;
    4::177     3e-48  50%  179 aa  RL5_BUCBP RecName: Full=50S ribosomal protein L5;
    3::177     3e-48  49%  179 aa  RL5_AZOSE RecName: Full=50S ribosomal protein L5;
    2::175     4e-48  51%  177 aa  RL5_EHRCR RecName: Full=50S ribosomal protein L5;
    1::178     4e-48  51%  180 aa  RL5_CHLPN RecName: Full=50S ribosomal protein L5;
    1::178     1e-47  51%  180 aa  RL5_CHLMU RecName: Full=50S ribosomal protein L5;
    1::178     1e-47  51%  180 aa  RL5_CHLTB RecName: Full=50S ribosomal protein L5;
    1::178     1e-47  51%  180 aa  RL5_CHLT2 RecName: Full=50S ribosomal protein L5;
    3::178     2e-47  49%  181 aa  RL5_SULDN RecName: Full=50S ribosomal protein L5;
    6::180     3e-47  52%  182 aa  RK5_CYACA RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::177     6e-47  47%  179 aa  RK5_ASTLO RecName: Full=50S ribosomal protein L5, plastid;
    2::175     8e-47  47%  186 aa  RL5_MYCS5 RecName: Full=50S ribosomal protein L5;
    1::178     4e-46  49%  180 aa  RL5_CHLTR RecName: Full=50S ribosomal protein L5;
    1::178     4e-46  49%  180 aa  RL5_CHLTA RecName: Full=50S ribosomal protein L5;
    9::176     7e-46  50%  177 aa  RK5_CYAME RecName: Full=50S ribosomal protein L5, chloroplastic;
    8::183     3e-45  47%  184 aa  RL5_FERNB RecName: Full=50S ribosomal protein L5;
    1::181     3e-43  47%  182 aa  RM05_RECAM RecName: Full=60S ribosomal protein L5, mitochondrial;
    2::175     3e-43  44%  177 aa  RL5_NEOSM RecName: Full=50S ribosomal protein L5;
    1::177     3e-42  44%  179 aa  RK5_EUGGR RecName: Full=50S ribosomal protein L5, chloroplastic;
   47::191     1e-39  49%  238 aa  RK5_ODOSI RecName: Full=50S ribosomal protein L5, chloroplastic;
   23::180     5e-39  47%  186 aa  RL5_SULMW RecName: Full=50S ribosomal protein L5;
   16::180     5e-39  46%  238 aa  RK5_THAPS RecName: Full=50S ribosomal protein L5, chloroplastic;
   16::175     2e-36  45%  238 aa  RK5_PHATR RecName: Full=50S ribosomal protein L5, chloroplastic;
    1::179     2e-24  31%  181 aa  RK5_HELSJ RecName: Full=50S ribosomal protein L5, plastid;
   14::155     3e-19  39%  177 aa  RL5_HALMA RecName: Full=50S ribosomal protein L5P;AltName:
    1::132     4e-19  37%  178 aa  RL5_SULTO RecName: Full=50S ribosomal protein L5P;
   20::141     4e-19  39%  186 aa  RL5_PYRFU RecName: Full=50S ribosomal protein L5P;
   12::136     4e-19  38%  181 aa  RL5_META3 RecName: Full=50S ribosomal protein L5P;
    3::133     6e-19  39%  178 aa  RL5_SULAC RecName: Full=50S ribosomal protein L5P;
   20::141     7e-19  39%  188 aa  RL5_PYRAB RecName: Full=50S ribosomal protein L5P;
   12::136     7e-19  36%  190 aa  RL5_METJA RecName: Full=50S ribosomal protein L5P;
   17::138     1e-18  36%  183 aa  RL5_PYRKO RecName: Full=50S ribosomal protein L5P;
   16::137     2e-18  40%  182 aa  RL5_SULSO RecName: Full=50S ribosomal protein L5P;
   20::141     2e-18  38%  188 aa  RL5_PYRHO RecName: Full=50S ribosomal protein L5P;
   25::148     3e-18  35%  192 aa  RL5_AERPE RecName: Full=50S ribosomal protein L5P;
   13::132     4e-18  37%  176 aa  RL5_NATPD RecName: Full=50S ribosomal protein L5P;
    9::145     5e-18  33%  168 aa  RL5_METHJ RecName: Full=50S ribosomal protein L5P;
  135::287     8e-18  35%  292 aa  RM07_YEAST RecName: Full=54S ribosomal protein L7,
   16::136     1e-17  40%  178 aa  RL5_ARCFU RecName: Full=50S ribosomal protein L5P;
    4::126     2e-17  40%  170 aa  RL5_THEVO RecName: Full=50S ribosomal protein L5P;
    4::144     2e-17  34%  171 aa  RL5_METLZ RecName: Full=50S ribosomal protein L5P;
    5::142     2e-17  36%  186 aa  RL5_METKA RecName: Full=50S ribosomal protein L5P;
    9::126     4e-17  39%  167 aa  RL5_METMJ RecName: Full=50S ribosomal protein L5P;
    2::127     4e-17  36%  169 aa  RL5_METBF RecName: Full=50S ribosomal protein L5P;
   41::210     5e-17  32%  231 aa  RM05_PROWI RecName: Full=60S ribosomal protein L5, mitochondrial;
    5::127     5e-17  38%  169 aa  RL5_METMA RecName: Full=50S ribosomal protein L5P;
    4::126     7e-17  40%  170 aa  RL5_THEAC RecName: Full=50S ribosomal protein L5P;
    1::123     7e-17  37%  165 aa  RL5_METAC RecName: Full=50S ribosomal protein L5P;
   12::136     3e-16  37%  181 aa  RL5_METM7 RecName: Full=50S ribosomal protein L5P;
    5::146     3e-16  33%  169 aa  RL5_METBU RecName: Full=50S ribosomal protein L5P;
   11::133     3e-16  37%  185 aa  RL5_HALWD RecName: Full=50S ribosomal protein L5P;
   12::136     6e-16  36%  181 aa  RL5_METMP RecName: Full=50S ribosomal protein L5P;
   12::136     6e-16  35%  181 aa  RL5_METM6 RecName: Full=50S ribosomal protein L5P;
  125::240     1e-15  33%  287 aa  RM07_SCHPO RecName: Full=Probable 60S ribosomal protein L7,
    5::126     1e-15  37%  169 aa  RL5_NANEQ RecName: Full=50S ribosomal protein L5P;
   12::136     1e-15  35%  181 aa  RL5_METVS RecName: Full=50S ribosomal protein L5P;
   12::136     1e-15  35%  181 aa  RL5_METVA RecName: Full=50S ribosomal protein L5P;
   11::128     1e-15  36%  174 aa  RL5_HALLT RecName: Full=50S ribosomal protein L5P;
   12::136     2e-15  35%  181 aa  RL5_METM5 RecName: Full=50S ribosomal protein L5P;
    1::142     2e-15  34%  165 aa  RL5_METB6 RecName: Full=50S ribosomal protein L5P;
   14::131     5e-15  38%  176 aa  RL5_PICTO RecName: Full=50S ribosomal protein L5P;
   15::136     1e-14  35%  179 aa  RL5_PYRAE RecName: Full=50S ribosomal protein L5P;
    2::125     1e-14  35%  168 aa  RL5_METST RecName: Full=50S ribosomal protein L5P;
    7::176     5e-14  36%  188 aa  RM05_MARPO RecName: Full=60S ribosomal protein L5, mitochondrial;
   23::156     9e-14  32%  202 aa  RL11_DICDI RecName: Full=60S ribosomal protein L11;AltName:
   33::150     4e-13  38%  175 aa  RL5_HALSA RecName: Full=50S ribosomal protein L5P;AltName:
   33::150     4e-13  38%  175 aa  RL5_HALS3 RecName: Full=50S ribosomal protein L5P;
    7::133     2e-12  32%  173 aa  RL5_NITMS RecName: Full=50S ribosomal protein L5P;
    7::130     2e-12  32%  174 aa  RL11_CANGA RecName: Full=60S ribosomal protein L11;
    9::130     4e-12  33%  174 aa  RL11_SCHPO RecName: Full=60S ribosomal protein L11;
    9::130     4e-12  33%  174 aa  RL11B_YEAST RecName: Full=60S ribosomal protein L11-B;AltName:
    9::130     4e-12  33%  174 aa  RL11A_YEAST RecName: Full=60S ribosomal protein L11-A;AltName:
    5::124     7e-12  33%  169 aa  RL5_CENSY RecName: Full=50S ribosomal protein L5P;
    9::130     2e-11  31%  174 aa  RL11_ASHGO RecName: Full=60S ribosomal protein L11;
   17::144     3e-11  30%  196 aa  RL11_CAEEL RecName: Full=60S ribosomal protein L11;
   11::132     3e-11  31%  182 aa  RL11_ORYSJ RecName: Full=60S ribosomal protein L11;
   11::132     3e-11  31%  182 aa  RL11_ORYSI RecName: Full=60S ribosomal protein L11;
   11::132     3e-11  33%  181 aa  RL11_MEDSA RecName: Full=60S ribosomal protein L11;AltName:
   11::132     4e-11  31%  182 aa  RL112_ARATH RecName: Full=60S ribosomal protein L11-2;AltName:
   11::132     4e-11  31%  182 aa  RL111_ARATH RecName: Full=60S ribosomal protein L11-1;AltName:
   11::134     7e-11  33%  174 aa  RL11_NEUCR RecName: Full=60S ribosomal protein L11;
    9::130     1e-10  30%  172 aa  RL11_TETTH RecName: Full=60S ribosomal protein L11;AltName:
   12::133     2e-10  30%  178 aa  RL11_RAT RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_PONAB RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_PIG RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_MOUSE RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_ICTPU RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_HUMAN RecName: Full=60S ribosomal protein L11;AltName:
   12::133     2e-10  30%  178 aa  RL11_CHILA RecName: Full=60S ribosomal protein L11;
   12::133     2e-10  30%  178 aa  RL11_BOVIN RecName: Full=60S ribosomal protein L11;
    4::125     4e-10  30%  168 aa  RL5_METTH RecName: Full=50S ribosomal protein L5P;
   22::148     4e-10  28%  195 aa  RL11_SPOFR RecName: Full=60S ribosomal protein L11;
    4::125     5e-10  29%  170 aa  RL5_METS3 RecName: Full=50S ribosomal protein L5P;
   40::152     5e-10  33%  197 aa  RL5_CALMQ RecName: Full=50S ribosomal protein L5P;
   17::120     8e-10  31%  125 aa  RL11_TOXCA RecName: Full=60S ribosomal protein L11;Flags: Fragment;
    1::121     1e-09  28%  170 aa  RL11_CHLRE RecName: Full=60S ribosomal protein L11;
   22::138     1e-09  29%  184 aa  RL11_DROME RecName: Full=60S ribosomal protein L11;
    3::43      4e-09  51%   43 aa  RL5_SERMA RecName: Full=50S ribosomal protein L5;Flags: Fragment;
    3::43      9e-09  51%   43 aa  RL5_PROVU RecName: Full=50S ribosomal protein L5;Flags: Fragment;
   15::122     1e-08  30%  165 aa  RL11_ENCCU RecName: Full=60S ribosomal protein L11;
   12::170     2e-05  27%  186 aa  RM05_SOLTU RecName: Full=60S ribosomal protein L5, mitochondrial;
  145::268     8e-05  29%  269 aa  THIM_BACWK RecName: Full=Hydroxyethylthiazole kinase;       
   16::132     1e-04  25%  188 aa  RL11_LEICH RecName: Full=60S ribosomal protein L11;
   16::132     2e-04  25%  188 aa  RL11_LEIMA RecName: Full=60S ribosomal protein L11;
    8::169     3e-04  27%  185 aa  RM05_ARATH RecName: Full=60S ribosomal protein L5, mitochondrial;
  145::251     9e-04  31%  269 aa  THIM_BACC4 RecName: Full=Hydroxyethylthiazole kinase;       
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
RL5_LACS1       MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
RL5_ENTFA       -MNRLKEKYIKEVTPSLVEKFNYSSVMQTPKVDKIVINMGVGDAVSNAKNLDKAVEELALITGQKPLITK
RL5_LACLS       MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITK
RL5_LACLM       MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITK
RL5_LACLA       MTNRLKEKYTNEVVPALTEQFNYTSIMAVPKVDKIVINMGVGDAVNNSKNLDKAVAELALISGQKPLITK
RL5_LACRJ       MENRLKAKYENEIRPALIEKFNYSSVMQAPKIDKIVLNMGVGDATTNSKNLDEAVEELGLISGQKPLITK
RL5_LACRD       MENRLKAKYENEIRPALIEKFNYSSVMQAPKIDKIVLNMGVGDATTNSKNLDEAVEELGLISGQKPLITK
RL5_GEOTN       -MNRLKEKYTKEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQRPVVTR
RL5_LACSS       MTNRLKEKYVKEMTPALIEKFNYTSSMQVPKIEKIVLNMGVGDAVSNAKNLDKAVEELGLIAGQKPLITK
RL5_GEOKA       -MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQRPVVTR
RL5_BACSU       -MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFIAGQKPVVTR
RL5_LACPL       MENRLKAQYEKEIVPALVDKFNYTSVMQVPKLAKIVLNMGVGDAVTNAKNLDEAVEELTLISGQKPLVTR
RL5_LACBA       MSARLKEKYVSEITPALVEKFSYSSVMQTPKIEKIVLNMGVGDAVSNAKNLDEAVEELGLISGQKPLVTK
RL5_BACST       -MNRLKEKYVKEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQRPVVTR
RL5_BACLD       -MNRLKEKYNKEITPALMKKFEYKSVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFIAGQKPVVTR
RL5_PEDPA       MANRLKEKFVNEITPDLVKKFDYTSVMQVPKIEKIVLNMGVGDAVTNSKNLDEAVAELELISGQKPLVTK
RL5_STRSY       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDAVSNAKNLEKAAQELALISGQKPLITK
RL5_STRS2       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDAVSNAKNLEKAAQELALISGQKPLITK
RL5_LEUMM       MANALKEKYVNEVQPALIEKFNFKSSMQAPKIDKIVLNMGVGDAVSNSKNLDEAVEELKLIAGQQPVITK
RL5_LEUCK       MANALKEKYVNEVQPALIEKFNFTSPMQAPKIDKIVLNMGVGDAVSNSKNLDEAVEELKLIAGQQPVITK
RL5_BACA2       -MNRLKEKYNKEISPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFIAGQKPVVTR
RL5_EXIS2       -MNRLKAKYQDEIVKVMMEKFNYTSVMQAPKVDKIVINMGVGDAVTNTKALDMAVEELQLLTGQKPLITK
RL5_ANOFW       -MNRLKEKYLKEVVPALMSKFNYKSVMQVPKIEKIVINMGVGDAVQNAKALDNAVEELALISGQKPVVTR
RL5_BACHD       -MNRLKEKYQKEIVPSLTEKFNYSSVMAVPKLEKIVVNMGVGDAVQNAKALDKAVEELTEITGQKPIITK
RL5_BACSK       -MNRLKEKYQNEIVSSLTEKFNYPSVMAVPKIEKIVVNMGIGDAVQNAKVLDKAVEELQAITGQKPVITK
RL5_LYSSC       -MSRLKEKYLNEVSPALMSKFGYKSVMQLPKVEKIVINMGVGDAVQNSKALDAAVEELTIITGQKPVVTK
RL5_LACF3       MENRLKAKYENEVRPSLIEKFDYSSVMAAPKLEKIVLNMGVGDATQNSKNLDEAVEELGLISGQKPLITK
RL5_GEOSW       -MNRLKEKYLKEVTPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQNPKALDSAVEELTLIAGQKPVVTR
RL5_BACCQ       -MNRLKEKFQKEITPALMSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQIAGQKPVVTR
RL5_BACC7       -MNRLKEKFQKEITPALMSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQIAGQKPVVTR
RL5_BACC1       -MNRLKEKFQKEITPALMSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQIAGQKPVVTR
RL5_LACCB       MENRLEERYSKEIAPALVSKFNYKSTMQAPKIEKIVLNMGVGDATQNAKLLDEAVDELTLISGQHPLITK
RL5_LACC3       MENRLEERYSKEIAPALVSKFNYKSTMQAPKIEKIVLNMGVGDATQNAKLLDEAVDELTLISGQHPLITK
RL5_BACP2       -MNRLKEKYVKEITPALVSKFEYKSVMQVPKIEKIVINMGVGDAVQNAKAIDTAVEELTFIAGQKPVVTR
RL5_LACGA       MVNSLVEKYSNEIAPAMNKKFNYDSVMEIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITK
RL5_BACCN       -MNRLKEKFQKEITPALMSKFNYKSVMQVPKIEKIVINVGVGDAVQNSKALDNAVEELTQIAGQKPVITR
RL5_EXISA       -MNRLQEKYKSDIVKAMMDKFNYDSVMQVPKIEKIVINMGVGDAVSNSKALDMAVEELTILSGQKPLVTK
RL5_BACWK       -MNRLKEKFQKEITPALMSKFNYKSVMEVPKIEKIVINTGVGDAVSNSKALDNAVEELTQIAGQKPVVTR
RL5_BREBN       MATRLKEKYTSEIVPSLMSKFNYTSIMQVPKVEKIIINMGVGEAVANAKSLDTAIEDLQIIAGQKPVVTK
RL5_LISW6       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LISMO       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LISMH       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LISMF       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LISMC       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LISIN       -MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATANAKVLDSAVEELALITGQKPVITK
RL5_LACJO       MANSLVEKYSNEIAPAMNKKFNYDSVMEIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITK
RL5_LACDB       MANSFATKYNEEIVPALTKKFNYTSSMQVPKIDKIVLNMGVGDAVANAKNLDEAVEELTLISGQKPMITK
RL5_LACDA       MANSFATKYNEEIVPALTKKFNYTSSMQVPKIDKIVLNMGVGDAVANAKNLDEAVEELTLISGQKPMITK
RL5_OENOB       MVNALKEKYVNEVRPALISKFDYTSLMQAPKLEKIVLNMGVGDAVTNSNNLDEAVSELRLIAGQQPVVTK
RL5_BACC2       -MNRLKEKFQKEITPALVSKFNYKSVMEVPKIEKIVINTGVGDAVSNSKALDNAVEELTQIAGQKPVVTR
RL5_OCEIH       -MNELKQKYQDEIVSSLMDKFNYNSVMEVPKVEKIVINMGVGDAVQNSKALDSAVEELSLISGQKPMITR
RL5_BACHK       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACCZ       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACCR       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACC4       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACC3       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACC0       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACAN       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKTLDNAVEELTQITGQKPVVTR
RL5_BACAH       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKALDNAVEELTQITGQKPVVTR
RL5_BACAC       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKTLDNAVEELTQITGQKPVVTR
RL5_BACAA       -MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVSNSKTLDNAVEELTQITGQKPVVTR
RL5_STAAW       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAT       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAS       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAR       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAN       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAM       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAE       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAC       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAAB       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAA9       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAA8       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAA3       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAA2       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAA1       -MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STACT       -MSRLKEKFNTEVTENLMKEFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLITK
RL5_STAHJ       -MNRLKERYNTEVTENLVKKFNYSSVMEVPKIEKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_LACAC       MASYLAEEYKETVAPALKEKFNYTSSMQIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITK
RL5_STAES       -MNRLKEKFNTEVTENLVKKFNYSSVMEVPKIEKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STAEQ       -MNRLKEKFNTEVTENLVKKFNYSSVMEVPKIEKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTK
RL5_STRZT       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRZP       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRZJ       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRR6       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRPS       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRPN       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRPJ       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRPI       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRP7       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRP4       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRP2       MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAVSNAKSXXXXXXXXXXISGQKPLITK
RL5_STRMU       MANRLKEKYLNEVVPALTEKFNYTSVMAVPKVDKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRTD       MANRLKEKYTNEVIPALTEKFNYSSVMAVPKVDKIVINMGVGEAVNNXXXXXXXXXXXXXISGQKPLITK
RL5_STRS7       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPZ       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STREM       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRE4       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPM       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPG       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPF       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPD       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPC       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRPB       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRP8       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRP6       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRP3       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRP1       MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRSV       MANRLKEKYLKEVVPSLTEKFNYSSVMAVPKVDKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRA5       MANRLKEKYTNEVVPALTEKFNYSSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRA3       MANRLKEKYTNEVVPALTEKFNYSSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRA1       MANRLKEKYTNEVVPALTEKFNYSSVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STAS1       -MNRLKEKFNSEVTQNLVKQFDYSSVMEVPKIEKIVVNMGVGDAVQNTKVLDDAVEELQAITGQKPLITK
RL5_MACCJ       -MTRLKEKFLNEITPEMMKKFEYSSIMEVPKIEKIVVNMGIGDAVQNSKVLDSAVEELQAITGQKPMVTK
RL5_LACH4       MASYLAEEYKEKVAPALAEKFDYKSSMQIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTLISGQKPLITK
RL5_STRU0       MANRLKEKYTNEVIPALSEKFNYTTVMAVPKVEKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRGC       MANRLKEKYLKEVVPALTEKFNYSSVMAVPKVDKIVLNMGVGDAVSXXXXXXXXXXXXXXISGQKPLITK
RL5_STRT2       MANRLKEKYTNEVIPALTEQFNYSSVMAVPKVDKIVINMGVGEAVNNXXXXXXXXXXXXXISGQKPLITK
RL5_STRT1       MANRLKEKYTNEVIPALTEQFNYSSVMAVPKVDKIVINMGVGEAVNNXXXXXXXXXXXXXISGQKPLITK
RL5_THEPX       -MSRLREKYEKEVVPALMERFGYKNIMQVPKVEKVVINIGVGEAKENPKALEAAVDDLTMIAGQKPVITR
RL5_THEP3       -MSRLREKYEKEVVPALMERFGYKNIMQVPKVEKVVINIGVGEAKENPKALEAAVDDLTMIAGQKPVITR
RL5_DESHY       ---RLKDKFSNEIAPALQQKFNYKNVMQIPKLEKVVINVGVGEAIQNSKAIDAAVGDLSKITGQKPVVTR
RL5_ACHLI       -----KELYNTKIVPKLVSDFNYDSVMQVPKLEKIVVNMGVGEAVSNSKLLDQAVEELTLLTGQKPVITK
RL5_DESHD       ---RLKDKFSSEIAPALQQKFNYKNVMQIPKLEKVVINVGVGEAIQNSKAIDAAVGDLSKITGQKPVVTR
RL5_CLOPS       -MNRLQERYEKEVVPAMMEKFGYKNIMQVPKIEKVVINMGVGEAKDNPKVLESAVSDLQIIAGQKPVLTR
RL5_CLOPE       -MNRLQERYEKEVVPAMMEKFGYKNIMQVPKIEKVVINMGVGEAKDNPKVLESAVSDLQIIAGQKPVLTR
RL5_CLOP1       -MNRLQERYEKEVVPAMMEKFGYKNIMQVPKIEKVVINMGVGEAKDNPKVLESAVSDLQIIAGQKPVLTR
RL5_CLOK5       ---RLQEKYEKEVVPALMDKFGYKNIMQAPKLEKIVINMGVGEAKDNPKVLESAVNDLTIITGQKPVLTR
RL5_CLOK1       ---RLQEKYEKEVVPALMDKFGYKNIMQAPKLEKIVINMGVGEAKDNPKVLESAVNDLTIITGQKPVLTR
RL5_SYNWW       ---RLYETYKKDIVPKMMEKFQYDNIMQVPKVERVVVNIGVGEAIQNPKALDGAVNDLSIISGQKPVITR
RL5_CLOBB       -MTRLQEKYSKEVIPAMIEKFGYKNVMEIPKLEKIVINMGVGEAKENQKVLESAVSDLSLIAGQKPILTR
RL5_CLOBA       -MTRLQEKYSKEVIPAMIEKFGYKNVMEIPKLEKIVINMGVGEAKENQKVLESAVSDLSLIAGQKPILTR
RL5_THETN       -MSRLREKYEKEVVPALMERFGYKNIMQVPKLEKVVINIGVGEAKENPKALEAAMNDLMMISGQKPVITR
RL5_CLOB8       -MTRLQEKYQKEVVPAMIEKFGYKNIMEVPKLEKIVINMGVGEAKENQKVLESAVNDLTLIAGQKPVLTR
RL5_CLOTE       MVPRLQEKYEKEVIPALIEKFGYKNIMEVPKLEKIVINMGVGEAKENQKMLESAVSDLSIIAGQKPIVTK
RL5_GLOVI       ---RMKDKYNREVVPRLQEQFNYTNLMQVPKISKIVINRGLGEASQNAKALDGSIAEVARIAGQKPVVTR
RL5_ALKOO       ---RLKDMYKSEVAPAMMEKFGYKSVMEIPKIEKIVVNMGLGDSKDNPKGLEAAVKELGIITGQKPVVTR
RL5_CLOBM       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKALEAAVEDLAKITGQKPILTK
RL5_CLOBL       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOBK       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOBJ       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOBH       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOB6       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOB1       MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAKITGQKPILTK
RL5_CLOAB       MVPRLKEKYEKEVIPALMEKFQYKNIMEVPKLEKIVINMGVGEAKENQKVLESAVADMQLISGQKPILTR
RL5_MOOTA       ---RLKEKYLQEIRKALQAKFGYKNIMEIPKLEKIVINMGVSEATQNPKAIDNAVQDLMTITGQKPVVTK
RL5_DESRM       ---RLKDKYLNEVQPNLMQKFGYKNIMQVPKLEKVIINIGLGEAVQNSKAVDAAVGDLMAITGQRPITTK
RL5_CLOPH       -MTRLKEIYKNEIMAGMQKKFGYKNEMQIPKLDKIVINMGVGEAKDNAKALEAAVKDMEIIAGQKAVITK
RL5_CLOCE       -MTRLKDKYLNEAAPALIEKFKYSSRMQVPKLEKVVLNMGVGEVKDNPKAMDSAVNDMTLITGQKPIVTK
RL5_CARHZ       ---RLKDKYQNDVIPAMMEKFGYKNKMQVPKLEKIVINIGLGEALQNPKAVDAAVADLMAITGQRPVLTK
RL5_CLONN       -MSRLQEKYNKEVIPALMEKFGYKNIMQVPKLEKIVVNMGVGEAKDNSKVLESAIADLQQITGQKPVITR
RL5_GEOSF       ---RLNELYNKELVPQLMKDFNYRNIMQVPKLEKIVINMGLGEAIQNVKILDSAVSEMALIAGQKPVITK
RL5_HELMI       ---RLKEKIQTDVNAAMMQRFGYKNVMQIPRLEKVVVNMGLGEAIQNPKGLDAAVGDLTRITGQKPVITT
RL5_MYCMS       MKSRLEIKYKDQIVPELFKELNYKSIMQVPKIQKIVINMGIGDATTDPKKLDAAISELEKLSGQKPIVTK
RL5_ROSCS       MVPRLKEKYQTEVVPALMQEFQYRSVMQAPRLEKIVLNIGLGEAIQNSKALDAATSDLAAIAGQKPVITR
RL5_GEOUR       ---RLNELYNKEMVPQLMKDFNYRNVMEVPKLEKIVVNMGLGEAIQNVKILDSAVDEMAVITGQKPIITK
RL5_GEOSL       ---RLKELYHKEIVEQLTKDFGYSNVMQVPKIEKIVVNMGLGEAIQNVKILDSAVEELAAIAGQKAVITK
RL5_DESAP       ----LKQKYIEEVIPAMMDKFKYRNVMEVPRLEKVVINIGMGEAVQNAKAIDAAMQDLRTITGQQPVVTR
RL5_MYCCT       MKSRLEIKYKDQIVPELFKELNYKSIMQVPKIQKIVINMGIGDATTDPKKLDAAIFELEKLSGQKPIVTK
RL5_EUBR3       -MSRLREQYENEIKDAMIKKFGYKNAMEIPKLDKIVVNMGVGEAKENAKVLEAAVKDMEAITGQKAVTTK
RL5_CYAP7       MTQRLKTVYYETIVPKLKEQFNYTNIHQVPKVIKVTVNRGLGDASQNAKALESSIAELATITGQKPVVTR
RL5_ALKMQ       ---RIKDKYRNEVAPAMMEKFGYKSVMQIPRLEKIIINMGLGQAKENQKELEIAVKELGIIAGQKPITTK
RL5_SYNFM       ---RLRETYRNEIAPKLSEQFKYKSPMQIPRLSKIILNMGLGDAIQNIKILDSAAEELGMISGQKPVITR
RL5_GEOMG       ---RLNELYKNEIVPQLTKDFGYSNIMQVPKIEKIVVNMGLGEAIQNVKILDSAVEELAMITGQKSVITK
RL5_NATTJ       ---RLLEHYRGEVKPKLKDEMGYKNIMEVPKLEKVVVNMGIGDAKDNPKILDNAVENLEQVTGQKPVVTK
RL5_DESAA       -MSTLRTEYLENVAPKLQEEFGYSNAMQIPRLSKVVLNMGLGEAIQNNKILEGAVDELTLISGQKPVVTK
RL5_CHLSY       MTVRLREKYQKEVVPALMEEFKFKSIMQVPRLVKIVVNVGVGEAVQNAKAIEAAVNDLATITGQKPVVTR
RL5_CHLAA       MTVRLREKYQKEVVPALMEEFKFKSIMQVPRLVKIVVNVGVGEAVQNAKAIEAAVNDLATITGQKPVVTR
RL5_ANADF       MAARLRERYEKEIRSELMKELGFANPMQAPKLEKIVVNMGLGEAINNGKIIDASVEQLSAITGQKPVVTK
RL5_GEOBB       ---RLAELYNKEMVPALMKDQNYKNIMEVPKLVKIVVNMGLGEAIQNVKILDSAAEELAAITGQRPVITK
RL5_MESFL       MKSRLETRYTEQIAPELFKELGYKSVMQVPKLTKIVINMGVGEATTDPKKLDAAVVELEQLTGQKPLVTK
RL5_GEOSM       ---RLAELYNKEMVPALMKDQNYKNIMEVPKLVKIVVNMGLGEAIQNVKILDSAAEELAAITGQRPVITK
RL5_SHESR       ---KLHDKYQETVVAELTKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHAVRDMTAIAGQKPVVTV
RL5_SHESM       ---KLHDKYQETVVAELTKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHAVRDMTAIAGQKPVVTV
RL5_ANASK       MAARLKERYDKQLRAELMKELGFANPMQAPRLEKIVVNMGLGEAINNGKIIDASVEQLAAITGQKPVVTR
RL5_ANADE       MAARLKERYDKQLRAELMKELGFANPMQAPRLEKIVVNMGLGEAINNGKIIDASVEQLAAITGQKPVVTR
RL5_ANAD2       MAARLKERYDKQLRAELMKELGFANPMQAPRLEKIVVNMGLGEAINNGKIIDASVEQLAAITGQKPVVTR
RL5_DESAH       ----LKEMYEKEIVPGLKETFGYKNPMEVPKLDKIVLNIGLGEAINNVKLLDSAVEDLALIAGQRPVITK
RL5_SHEB9       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKIMDHAVRDMTAIAGQKPVVTV
RL5_SHEB8       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKIMDHAVRDMTAIAGQKPVVTV
RL5_SHEB5       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKIMDHAVRDMTAIAGQKPVVTV
RL5_SHEB2       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKIMDHAVRDMTAIAGQKPVVTV
RL5_RUBXD       ---RLKDRYRQEVAPALKERFGIDNPMRVPTLEKIVVNMGVGEAAQDSRKLDGAMEDLARITGQKPQVRR
RL5_SHESA       ---KLHDKYQETVVAELTKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHAVRDMTAIAGQKPVVTV
RL5_NOSP7       ---RLKSLYQETIVPKLINQFQYTNVHQVPKLVKVTINRGLGEAAQNAKSLEASINEIALVTGQKPVVTR
RL5_THEEB       MSQRLKDHYNKTVVPQLMQQFQYKNIHQVPKIVKVTVNRGLGEAAQNAKALEATLAEIATITGQKPVVTR
RL5_SHEON       ---KLHDKYQETVVAELTQKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHAVRDMTAIAGQKPVVTV
RL5_SYNP2       MSQRLKTLYQDSIVPKLTEQFGYSNVHEVPKLVKISVNRGLGEASSNAKAMESSIKELSTITGQRPVITR
RL5_CHLAD       MTVRLREKYYKEVVPALMEEFKFKSIMQVPRLVKIVVNVGVGEAVQNAKAIEAAVNDVAAITGQKPVVTR
RL5_ZYMMO       -VPRLKKQYDDEIIKAMTEKFGYKNAFEVPKLTKIVLNMGVGEATQDKKKVDQAAAEMELIAGQKPVVTR
RL5_PELCD       ---RLKEVYSTEIAPALVKRLQLKNVMEVPRVEKVVLNMGLGEAIQNIKVLESAVEELTRICGQKPVVTK
RL5_SHESW       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_SHEPC       ---KLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_DESPS       -MSALKEYYTNECVPALKDQLGYTNPMQIPKIEKIVLNMGLGEAVQNPKIVEGAAEELTKIAGQRAVVTK
RL5_CYAP8       MPQRLKQVYQDTIVPKLTEQFSYKNPHEVPKVVKITVNRGLGEASQNAKALESSINELSTITGQKPVVTR
RL5_SPIKU       ----LEKKYKNTIVKELFKEQRFQSIMQVPVVKKIVVNMGAGDATQNSKVIEDITNELALITGLRPVVTK
RL5_DEIRA       -MQQLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDKAAKELALITLQKPIITK
RL5_SHEDO       ---KLHDKYQETVVAELAKKFGYSSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPIVTV
RL5_GEOLS       ---RLKDVYQNEVVQKLRAEFNYKNIMEVPRIEKVVINMGLGEAIQNVKILDSAASELGKITGQKAVITK
RL5_FLAPJ       -IPRLKEEYKSRVISALTEEFGYKNVMQVPKLEKIVISKGVGAAVSDKKLIDYAVEELTKITGQKAVATI
RL5_FLAJ1       ---RLKEEYKSRVISALKEEFGYTNVMQVPKLEKIVLSRGVGAAVSDKKLIDYAVDELTKITGQKAVSTI
RL5_DICTD       ----LREKYIKEVVPAMMRKFGYKNPMAVPKIEKIVVNIGVSEAVQNPGAIEAAARDLAIITGQKPIVRK
RL5_DICT6       ----LKQKYIQEVVPAMMKKFGYKNPMAVPKIEKIVVNIGVSEAVQNPGAIEAAARDLAIITGQRPIVRK
RL5_SYNJA       MPQRLQILYNTVIVPKLQKELGYTNIHQVPRLEKIVINRGLGDASQNAKALESSIAEISAITGQRPVITR
RL5_SHEFN       ---KLHDKYQETVVAELAKKFGYSSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPIVTV
RL5_CHRSD       ----LKERYQNEVAAQLQEQFSYANVMQIPRITKVTLNMGIGDATSDKKLIDNAMGDLEKLSGQRPVITK
RL5_VIBFM       ---KLHDYYKSSVVAELTKEFSYTSVMQVPRVEKITLNMGVGEAINDKKLLENAAADMAIISGQKPLITK
RL5_DESOH       -MSSFKEFYTTEVVPKLQETFGYKNVMQIPKLEKIVLNMGLGEAISNIKIIDSAVEELKLISGQQPVIRR
RL5_VIBHB       ---KLHDYYKSSVVAELTKQFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAAADMATISGQKPLITK
RL5_MICAN       MSQKLKTTYQETIVPKLKEQFGYTNIHQVPKVIKITVNRGLGEASQNAKALESSKAELSTITGQQPVVTR
RL5_AQUAE       -VPRLYKKYKEEVVPILQKKFNYKSPMQIPRLQKIVVNMGVGEAVQDIRQLERAVEDLRAITGQQPVITR
RL5_ANASP       ---RLKTLYQETIVPKLTQQFQYTNVHQVPKLVKITVNRGLGEAAQNAKSLEASLTEIATITGQKPVVTR
RL5_ACAM1       MTVRLKTLYLDTAVPKLQEQFKYKNAHEIPKVTKVSVNRGLGEASQNAKALERSLEELAVITGQRPVVTR
RL5_VIBCM       ---KLHDYYKSSVVAELTKQFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAASDMAIISGQKPLITK
RL5_VIBCH       ---KLHDYYKSSVVAELTKQFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAASDMAIISGQKPLITK
RL5_VIBC3       ---KLHDYYKSSVVAELTKQFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAASDMAIISGQKPLITK
RL5_SHELP       ---KLHDKYKETVIAELSKKFGYTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_ANAVT       ---RLKTLYQETIIPKLTQQFQYTNVHQVPKLVKITVNRGLGEAAQNAKSLEASLTEIATITGQKPVVTR
RL5_SYNY3       MTQRLKTLYQETILPKLQEEFGYKNIHQVPKLTKVTVNRGLGEASQNAKALESSLTELATITGQKPVVTR
RL5_SPHWW       ---RFRKLYDETIVKAMTEKFGYKNHMEVPKITKIVLNMGVGEATQDKKKVEQAALEMTKIAGQKAVITK
RL5_SOLUE       MAARLREHYQTKTVPALTKEFSYKNVMAVPKLEKITINIGMGEATQNAKLMDGAVNELGQIAGQKPVITK
RL5_PELPD       ---RLKEIYHKDVMQKLRSDFSYANIMEVPKIVKVVVNMGLGEAIQNVKILDSAAAELAAITGQKTVITK
RL5_ALISL       ---KLHDYYKSSVVAELTKEFSYSSVMQVPRVEKITLNMGVGEAINDKKLLENAAADMAIISGQKPLITK
RL5_SYNJB       MPQRLQILYNTVIVPKLQKELGYTNIHQVPRLEKIVINRGLGEASQNAKALESSIAEISAITGQRPVITR
RL5_NOVAD       ---RLKGKYDAEIAAAMQAKFGYKNALEIPRIEKITLNMGVGEASQDKKKVTTAAAEMELIAGQKPVITK
RL5_VIBPA       ---KLHDYYKSSVVAELTKQFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAASDMATISGQKPLITK
RL5_TRIEI       MSDTLKKYYYKKIVPKLIDQFKYKNIHQVPKLVKVTINRGLGEASQNAKALDSSIKEIATITGQKPVVTR
RL5_TOLAT       ---KLHDTYRQTVVQELMNQFGYNSVMQVPRIEKITLNMGVGEALADKKVLENAAGDLAAISGQKPLITK
RL5_SYNAS       ---RLKDYYKKEVIPALISEFGYKNPMQVPVMKKIVVNMGLGEAIQNVKILDSAAGELEMITGQKVVITK
RL5_SHEAM       ---KLHDKYKETVIAELSKKFGYTSVMQVPRIEKITLNMGVGEAVADKKIMENAVRDMTAIAGQKPVVTV
RL5_MAGSA       ---RLRKHYDTVVKPALQKEFNYANPMQVPKLQKIVINMGVGEAAQDSKKIESALAELTLISGQKPVSTK
RL5_VIBVY       ---KLHDYYKSSVVAELTKQFGYTSVMQVPRIEKITLNMGVGDAINDKKLLENAAADMATISGQKPLITK
RL5_VIBVU       ---KLHDYYKSSVVAELTKQFGYTSVMQVPRIEKITLNMGVGDAINDKKLLENAAADMATISGQKPLITK
RL5_VIBSL       ---KLHDYYKSSVVAELTKEFSYTSVMQVPRIEKITLNMGVGEAINDKKLLENAASDMATISGQKPLITK
RL5_SYNP6       ----LKTKYRDIIVPKLMKEFGYTNIHQVPKVVKVTINRGLGEGAQNAKALESSLAEIAKIAGQKPVVTR
RL5_SYNE7       ----LKTKYRDIIVPKLMKEFGYTNIHQVPKVVKVTINRGLGEGAQNAKALESSLAEIAKIAGQKPVVTR
RL5_MANSM       ---KLHDYYRDQVVNELKTKFNYASVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_SHEPW       ---KLHDKYQETVSPELVKKFGFTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_SHEWM       ---KLHDKYQETVSPELQKKFGFTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_POLSJ       ---RLQDQYREKIAPSLIEKFGYTSPMQVPRITKITLNMGVSEAVADKKVMDNAVSDMTKIAGQKPVVTK
RL5_PARL1       -IPRLKVQYLEKFRPELTEKFSYKNLLEVPRLDKIVLNMGVGEAVGDSKKIKSAFEDLQAIAGQKPVITK
RL5_CYAP4       MAQRLKTYYLENAVPKLMEQFKYKNIHQVPKLVKITINRGLGEAAQNAKSLEASLNEIALIAGQKPVVTR
RL5_ROSS1       MVPRLKEKYQTEVVPALMQEFRYRSVMQVPRIEKIVLNIGLGEAIQNSKXXXXXXXXXXXXXGQKPVITR
RL5_PSEHT       ---KLHEVYKDKVVAELQEKFGFSSVMQVPLIEKITLNMGVGEALADKKILDNAVADLAAISGQKPLITK
RL5_MAGSM       ----LKQVYHDKVVPELQAKFGYSNVMQVPRLQKIVVNMGVGEAIADKNFLNNAIGNLEAITGQKAQTTY
RL5_VIBF1       ---KLHDYYKSSVVAELTKEFSYTSVMQVPRVEKITLNMGVGEAINDKKLLENAAADMAIISGQKPLITK
RL5_SHESH       ---KLHDKYQETVSPELAKKFGFTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_SHEHH       ---KLHDKYKETVSPELVKKFGFTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_HALOH       ----LAEQYKEEIVPKLMDKFDYENIMAVPRVEKVVVNVGMGELKEDPKLIDVVVNDIASITGQKPVITR
RL5_HAEDU       ---KLHDYYRDQVVNELKTKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_GRAFK       -VPRLRQEYNERVKSALKEEFSYSNIMEVPKLTKIVISRGVGGAVADKKLIDHAIDELSAISGQKAVSTI
RL5_HAEPS       ---KLHDYYRDTVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_SYNR3       ----LKKRYREAIQPKLLKDLNFSNLHQVPKVVKVTVNRGLGEAAQNAKSLEASVEEIATITGQKPVVTR
RL5_SHEPA       ---KLHDKYKETVSPELVTKFGFTSVMQVPRIEKITLNMGVGEAVADKKVMEHALRDMTAIAGQKPVVTV
RL5_HAHCH       ---KYKEVYQKEVIPALMKEMSYSSVMQVPRIEKITLNMGVGEALGDKKQIEAAAADLEAITGQKVVVTK
RL5_FUSNN       --SRYHKFYDEVVVPKLMKELEIKNIMECPKLEKIIVNMGVGEATQNSKLIDAAMADLTIITGQKPLLRK
RL5_AERS4       ---KLHDYYKSDVVNELAKQFGYKTIMQVPRIEKITLNMGVGEAISDKKLLENAAADMAAISGQKPLITK
RL5_AERHH       ---KLHDYYKSDVVNELSKQFGYKTIMQVPRIEKITLNMGVGEAISDKKLLENAAADMAAISGQKPLITK
RL5_ACTPJ       ---KLHDYYRDQVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_ACTP7       ---KLHDYYRDQVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_ACTP2       ---KLHDYYRDQVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLTAISGQKPLITK
RL5_PASMU       ---KLHDYYRDQVVNELKDKFNYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLITK
RL5_BURMA       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_MARMS       ---RLKQVYKDQVVAKLTEEFSYKNVMEVPKITKITLNMGVGEAIADKKLLEHAVNDLEALSGQKVVVTK
RL5_IDILO       ---KLHDFYRESVVPELMKEFSYNSVMQVPRIDKITLNMGVGEALADKKVLDNAVADLEAISGQKPIRTV
RL5_ACIC5       MAARLKEKFIKEIRPALQKELGLENTMAVPRIEKIVLNMGLGEATQNSKLLDPLVADLAAIAGQKPVTTR
RL5_THICR       ---RLQKIYNDQVVPALVEKFGYKSVMQAPKLTKITINMGVGEAIGDKKILDNAVSDMEAITGQKPVKTL
RL5_ACTSZ       ---KLHDYYRDQVVNELKTKFNYASVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLITK
RL5_TERTT       ---RLKEKYLNEIAPKLKEELGVANVMEIPRITKITLNMGVGEAIGDKKVLENAVADLEKIAGQKPVITK
RL5_RALEH       MAARLQEFYKEQVVPKLIEQFGYKSVMEVPRITKITLNMGLGEAINDKKIIENAVGDLTKIAGQKPVVTK
RL5_PHOPR       ---KLHDYYKETVVKELVEKFEYKSIMQVPRIEKITLNMGVGEAINDKKLLENAAADMTAIAGQKPLITK
RL5_CUPTR       MAARLQEFYKEQVVPKLIEQFGYKSVMEVPRITKITLNMGLGEAINDKKIIENAVGDLTKIAGQKPVVTK
RL5_ALTMD       ---KLHDFYKETVVAELAKQFGYKSVMQVPRIEKITLNMGLGEAVADKKVLENAQADMTAIAGQKPVVTV
RK5_CYAPA       MVQRLKTVYEQEVIKQLMTRFQYKNIHEVPKLKKITVNRGLGEAAQNAKILEASVKEITEITGQKAIVTR
RL5_RALEJ       MAARLQEFYKEKVVPKLIEQFGYKSVMEVPRITKITLNMGLGEAINDKKIIENAVGDLTKIAGQKPVVTK
RL5_PROA2       -VSRLAESYKEKVVPALMERFQYKNIMMVPKLTKISINIGVGEAASEPKLLETAMQELAQITGQKPQIRK
RL5_TREDE       -VPRLKKVYTEQIMPELKKEFNYSSVMQIPRLKKVVVSMGVGVALTNRKLLDAAVTDLETITGQKAVKTK
RL5_KOSOT       ----LKEKYEKEVVPSMMKEFGYKNKLQVPRLEKIVINMGIGEGSRNADLIEIHARELMAIAGQKPVVTK
RL5_ACIAC       ---RLQQHYREKIVPELTKQFGYTSPMEVPRLTKITLNMGVSEAVSDKKVMDNAVADLTKIAGQKPVVTK
RL5_THEFY       -IPRLKQKYREEIIPALREEFGYTNIMQVPGLTKIVVNMGVGDAARDAKLIQGAIADLSAITGQKPKINR
RL5_RHORT       ---RLQEHYQTVVKKALLEKFQYGNVMEIPRLEKIVINMGVGEASQDRKLIEGALTDMTAISGQKPIITR
RL5_POLNA       ---RLQDQYREKIAPALIEKFGYTTPMQVPRITKITLNMGVSEAVADKKVMDNAVADMAKIAGQKPVVTK
RL5_HERA2       ---RLKDVYLKTVAPALFKDFGFKSPMQVPRITKIVINIGLGEALQNPKAVEAAIGDLTMIAGQKPVVTR
RL5_HAES2       ---KLHDYYRDTVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_HAES1       ---KLHDYYRDTVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_SYNS9       ----LKKRYRETIQPKLLKDLSLTNIHEVPKVMKVTINRGLGEAATNAKSLEASVKELAQITGQKVVVTR
RL5_MYCPU       ----LKEKYLKEVKSNLQKQFNYSSSMEIPRIEKVILNMTAGKEVTNAKAIEEVINELTLISGQKPYQTV
RL5_LEGPL       ---RLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTK
RL5_LEGPH       ---RLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTK
RL5_LEGPC       ---RLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTK
RL5_LEGPA       ---RLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVGDKKVMNHAIEDMTLISGQKPVVTK
RL5_HAEIN       ---KLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_HAEIG       ---KLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_HAEIE       ---KLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_HAEI8       ---KLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALTDKKLLDNAVADLAAISGQKPLVTK
RL5_PSYIN       ---KLHDFYKDNVVSDLQTQFGYTSVMQVPRIEKITLNMGVGEALADKKVLENAASDMAAISGQKPLITK
RL5_PARDP       ---RLKAQFRETIRAALKEEFGYKNDMQIPRLDKIVLNMGIGEAVKDTKKVKQGAEELSLIAGQKAVITK
RL5_RALME       MTARLQEFYKEQVVPALMKQFGYKSVMEVPRFTKITLNMGLGEAINDKKVIELAVGDLTKIAGQKPVVTK
RL5_MYCPE       ----LYDKYKKDVTKSLMKEFNYKSTMEIPRLEKIVINSGLGDATSDSKIVEIGLKELHLITGQKPIATK
RL5_HALHL       ----LRKVYREEVTPALKERFGYQNVMQVPQLQKIVINMGLGEATKDKKILEAAQEDLAKIAGQKPVVTR
RL5_METFK       ---RLKDFYKDTVVKQLVEQFGYKSVMEVPRIEKITLNMGVGEAVADKKVMENAVADLEKIAGQKAVVTK
RL5_METCA       ---RLENHYKEKVVPELMARFGYKSVMEVPRLVKITLNMGVGEAVADKKILQNAVENMQAIGGQKPIVTH
RL5_BUCAP       --------YKSKIVKKLMMELNYSSIMQVPKIDKITLNMGVGAASSDKKVLDNAVLDLTAISGQKPLITK
RL5_ARTS2       IVPRLKTKYADSIKSTLIEEFKYENVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTLITGQKPQVTK
RL5_VEREI       ---RLQAIYRDKLVPELIRQFGYSSPMQVPRLSKITLNMGVSEAVSDKKVMDSAVADLTRIAGQKPVVTK
RL5_SYNSC       ----LKKRYRETIQPKLQKDLSLTNIHEVPKVLKVTVNRGLGEAAANAKSLEASVNELAQITGQKVVVTR
RL5_DEIGD       ----LKAKYNEQVRPALMQQFGYSSIMAVPRIEKIVINEGLGXXXXXXXXXXXXXXELALITLQKPVITK
RL5_AZOSB       ---RLQQFYKDEVVPQLLKQFGYKSVMEVPRITKITLNMGVGEAVGDKKVLENAIGDMTKIAGQKPVATK
RL5_AGRT5       ---RLKTEYVSRIRGAMQEKFSYANVMMIPKLDKIVINMGVGEATADSKKPTIAAGDLAAIAGQKPVITK
RL5_PSYA2       ---RLKSLYNEELKQQIKEELGLANVMQVPKITKITLNMGVGGASQDKKLLEGAVADMTAIAGQKPVVTK
RL5_PROMM       ----LKQRYRETIQPKLLKDLSLSNIHEVPKVLKITVNRGLGEAAQNAKSLEASITELATITGQKVVVTR
RL5_CHRVO       ---RLYDFYKDSVVPELMKQFGYKSIMQVPRIEKITVNMGVGEAVADKKVMEFAVGDLEKIAGQKPVVTT
RK5_PORYE       ----LKEKYKTTVTQSLKDEFQYKNVHEVPRFTKITINRGLGEASQNAKALESSIQELTLITGQKPIVTK
RL5_RALPJ       MTARLQEFYKEKVVPELIKQFGYKSVMEVPRITKITLNMGLGEAINDKKVIEHATGDLIKIAGQKPIVTK
RL5_PSYCK       ---RLKSLYNEELKQQIKEELGLANVMQVPKITKITLNMGVGGASQDKKLLEGAVADMTAIAGQKPVVTK
RL5_PROM3       ----LKQRYRETIQPKLLKDLSLSNIHEVPKVLKITVNRGLGEAAQNAKSLEASITELATITGQKVVVTR
RL5_FRAP2       ---RLKDYYQNEVVAKLKSELNLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTM
RL5_DESVM       -MTRLEQIYREKVVPVLQKEFNYTSSMQVPGIEKVSLNIGLGAASQNNKLMEEAIKELTAIAGQKAVVTR
RL5_BORA1       -MSRLQDFYKSKVAVDLQAKFGYKSVMEVPRITKITLNMGVSEAVADKKVIEHAVSDLTKIAGQKPVITK
RL5_ARTAT       IVPRLKTKYAETIKKSLQDEFSYANVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTLITGQKPQVTK
RK5_PORPU       MVIGLKEKYKTTVTQALKEEFQYENIHEVPRFTKITINRGLGEASQNAKALESSIQELTLITGQKPIVTR
RL5_THEAB       ----LKEKYENEIKPAMMKEFGYKNIHQVPRLEKIVINMGIGEGSRNKDVIDIHAKELALIAGQKPVVTK
RL5_RHISN       ---RLKKEYVERIRKAMQEKFSYANEMQIPRLDKIVINMGVGEATGDSKKPSVAAADLAAIAGQKPVITR
RL5_PHEZH       ---RLKTEYRERIRKSLKDRFGYSNEMQIPKLEKIVINMGVGEAVADSKKIQSAMADLAKIAGQKPVSTK
RL5_MYCA1       ---RLKERYRNEIRDSLQQQFGYANVMQIPTVTKVVVNMGIGEAARDAKLINGAVNDLALITGQRPEIRR
RL5_CHLCH       ---RLDTYYREKVVPALMERFQYKNIMEVPRLQKIAINIGVGDAAGEPKLLDVAVGELTQIAGQKPQIRK
RK5_SPIOL       -INRLKTNYIEKMVPLLKEEFSYSNILEVPKVVKIVVNCGIGDASQNAKGLDAAINELALITGQRPVKTK
RL5_THIDA       ---RFQEFYRETVVPKLIEQFGYKSVMEVPRIQKITLNMGVGEAVADKKVMDHAVADMQKIAGQKPVVTK
RL5_OLICO       -IPRLREVYDRDIRSKLTEQFGLTNVMQVPRLDKVVINMGVGEAVNDRKKVELAAGDLALIAGQKPIVTH
RL5_MYCAP       ----LKQKYLTDVVPALMKQYGYKSIMQVPRLEKIVLNMTAGKEVTNSKAIEEVLNELTQISGQKPFQTR
RL5_DESDG       -MTRLQNIYREQVAPVLQKEFNYKSSMQLPKLEKISLNIGLGEASQNQKLLEEAVKELTAIAGQKAVITR
RL5_DELAS       ---RLQKLYREKIAAELKEKFGYTSSMEVPRLTKITLNMGVSEAVADKKVMDNAVADLTKIAGQKPVVTK
RL5_CAUSK       ---RLKSEYRARIRAAMKEQFAYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLMAIAGQKPVATK
RL5_THEAQ       ----LKKKYYDEVRPELIRRFGYQNIWEVPRLEKVVINQGLGEAKEDARILEKASKELALIAGQKPAITR
RL5_SYMTH       ----LKTKYQQEVAPALQKQFNYKNVMMIPRLEKIVINVGLGEXXXXXXXXXXXXXXXXXXXGQRPVITR
RL5_STRAW       ---RLKTKYREEIAGKLQEEFSYENVMQTPGLVKIVVNMGVGDAARDSKLIDGAIRDLTTITGQKPAVTK
RL5_CAUCR       ---RLKTVYRERIRAAMKEQFGYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLQAIAGQKPVATK
RL5_CAUCN       ---RLKTVYRERIRAAMKEQFGYTNEMQIPKLDKIVLNMGIGEAVADSKKAQTALKDLQAIAGQKPVATK
RL5_UREPA       ----LKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETK
RL5_UREP2       ----LKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETK
RL5_THISH       ---RLKEFYRDTVMKQLMEKFQYSNVMEVPRITKITLNMGLGEAVGDKKIIEHAVSDMTAIAGQKPVVTK
RL5_CELJU       ---RLKELYTKELAPKLKEELGLANVMEVPRITKITINMGVGEAVGDKKVLENAVNDLVKIAGQKVVVTK
RL5_BUCCC       -MSRLYLYYKNKVIPNLIKKFNYSSIMAVPQIIKITLNMGIGKSIINKKILDYAIDDLTKISGQKPIITI
RL5_BLOPB       -MTKLYDYYKNNIIQNLMHKFNYRSIMQVPKIKKITINMGVGKSVTNKKLLEKATEDLMVISGQKPVITT
RL5_AGRRK       ---RLKKEYVARIRAALQEKFSYANEMQIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITH
RL5_UREU1       ----LKDLYKNKVAKDLQKEFAYSSVMQIPKIEKVVINAGIGNAVADKKHLEAAISELTLITGQRPVETK
RL5_FRATW       ---RLKDYYQKELVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRATT       ---RLKDYYQKELVAKLKTELGLDNIMEVPTIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRATO       ---RLKDYYQKELVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRATN       ---RLKDYYQKELVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRATH       ---RLKDYYQKELVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRATF       ---RLKDYYQKELVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_FRAT1       ---RLKDYYQKELVAKLKTELGLDNIMEVPTIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_BRAJA       ---RLRAEYDAKIRTAMTEKFGYENVMQVPRLDKVVLNMGVGDSVNDRKKAETAAAELTQIAGQKAIVTY
RL5_STRGG       ---RLKTRYREEIAGKLREEFSYENVMQVPGLVKIVVNMGVGDAARDSKLIDGAVKDLTTITGQKPAVTK
RL5_RHIEC       ---RLKKEYVERIRKAMQEKFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITR
RL5_RHIE6       ---RLKKEYVERIRKAMQEKFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITR
RL5_RENSM       ---RLKTRYADEIKKTLQDDFSYVNVNQVPRLVKVVVNMGVGEAARDSKVIDGAVRDLTLITGQKPMVTK
RL5_MICLU       ---RLKTKYREEIRGRLQEQFQYGNVMQVPGLVKVVVNMGVGEAAKDSKIIDDAVTDLTAITGQKPMITK
RL5_MICLC       ---RLKTKYREEIRGALQEQFQYGNVMQVPGLVKVVVNMGVGEAAKDSKIIDGAVTDLTAITGQKPMITK
RL5_COLP3       ---KLHDLYKDTVVAELQKQFGYKSVMQVPRIEKITLNMGVGEAISDKKVLEHATNDLTAISGQKPITTV
RL5_BUCAT       ----LYDYYKSKVITQLMHELNYSSVMQVPKIDKITLNMGVGGAASDKKILDNAILDLTAISGQKPLITK
RL5_BUCAI       ----LYDYYKSKVITQLMHELNYSSVMQVPKIDKITLNMGVGGAASDKKILDNAILDLTAISGQKPLITK
RL5_BUCA5       ----LYDYYKSKVITQLMHELNYSSVMQVPKIDKITLNMGVGGAASDKKILDNAILDLTAISGQKPLITK
RK5_OLTVI       MAQRFKELYLQTIVPKLKDEFGYKNSHQVPEIKKIVINRGLGDASQNAKILDSSLNELSIIAGQRGVVTR
RK5_CHLAT       MVQRLKAIYLEKAAPRLREMFEYKNVHQIPRIEKIIINCGLGEASQNAKSLDSAMKELSIIAGQKGVITR
RL5_SINMW       ---RLKKEYVERIRKAIQEQFSYANEMQIPRLDKIVINMGVGEATGDSKKPTVAAADLAAIAGQKPVITR
RL5_MESSB       ---RLKKHYEEAIRKQLLETFKYENEMQVPRIDKVVINMGVGEATGDSKKPSVAAEDLALIAGQKAVITR
RL5_CORA7       ---RLKTRYREEIKKALNEEFKYENVMQIPGVTKVVVNMGVGDAARDSKMINGALEDLTAITGQKPQVRR
RL5_ARTCA       IVPRLKTKYAESIKATLQDEFKYENVNQVPRLVKVVVNMGVGDAAKDSKLIDGAVRDLTQITGQKPQVTK
RL5_AQUPY       -VPRLYKKYKEEVVPKLIQKFQYKNPMQVPRLVKIVVNMGVGEAVQDIKQLERAVEDLRAITGQQPMITR
RK5_LEPTE       -INRLKKYYLQTIVPKLIEQFAYKNQMQVPRLEKIVINRGIGDASQNAKVLESSLKELTIIAGQKGIITR
RL5_PSEAE       ---RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIENAVADLEKITGQKPVVTY
RL5_PSEAB       ---RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIENAVADLEKITGQKPVVTY
RL5_PSEA8       ---RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIENAVADLEKITGQKPVVTY
RL5_MYCPA       ---RLKERYRNEIRDSLQQQFGSANVMQIPTVTKVVVNMGIGEAARDAKLINGAVNDLALITGQRPEIRR
RL5_AZOVD       ---RLKEIYRNEIAPKLKNELQLVNVMEVPRITKITLNMGLGEAVGDKKVIENAVADLEKITGQKPVVTY
RL5_THETH       ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
RL5_THET8       ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
RL5_THET2       ----LKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
RL5_THEMA       ----LKDQYEKEIVPALMKEFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTR
RL5_RHOFD       ---RLQQHFREKLAPELMAKFGYTSPMQVPRLTKITLNMGVSEAVADKKVMDHAVSDLGKIAGQKPVVTM
RL5_RHIME       --SRLKKEYVERIRKAMQEQFSYANEMQIPRLDKIVINMGVGEATGDSKKPTVAAADLAAIAGQKPVITR
RL5_PSEA7       ---RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIENAVADLEKITGQKPIVTY
RL5_MARMM       ---RLRAKYTETIRAAMKEKFGYANDMMIPRLDKIVINMGVGEASQDSKKIKGALEDLEAITGQKPVKTV
RL5_FRATM       ---RLKDYYQKKLVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTK
RL5_BRAHW       ----LKDRYENEIKQSLLKDMNLSSTMAIPKIEKIIINMGVTQAVTDKKYVDSAVEELSQIAGQRAVVTR
RL5_BORHD       -VPELKRHYKDNVIKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAISELSQITGQRAVKTK
RL5_THESQ       ----LKDQYEKEIVPALMKEFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTR
RL5_SALRD       -VPRLQKQYQDEVRPSLTDQFGYENPMEVPRLEKICVNRGVGEVSENQKALDQAVEEMRKITGQHPTIRR
RL5_RHILO       ---RLKQVYNETIRKALQEQFGYDNDMQVPRLDKIVLNMGVGEATADSKKPSVAAEDLALIAGQKAVVTR
RL5_CHLPB       ---RLENTYKDKVVPALMERFKYKNIMMVPRLTKISVNIGVGEAAAEPKLLETAIQELSQITGQKPQIRK
RL5_BORT9       -VPALKKHYKDNIIKELVSEFQYKSIMQAPKIEKIIVSMGVGDAVKNKKLLDSAVYELSQITGQRAVKTK
RK5_RHDSA       MSQSLKTYYKEKVVPLLMETFEYKNIHEVPKITKITINRGLGEASKNNKALESSVQELAIISGQQPVITK
RK5_CHLRE       MTQRLKNLYTKTIVPKLTTNFNYSNMHEVPKIEKIVINRGIGDASQNQKIVESSLKELAMIAGQKGVVTR
RL5_THEM4       ----LKEKYEKEIRNAMMKEFGYKNIHQVPRLEKIVINMGIGEGSRNKDVIDIHAKELALIAGQKPVVTR
RL5_PSEU5       ---RLKEVYRKEIAPKLKEELQLKNVMEVPRITKITLNMGIGEAIGDKKIIDNAVADLEKITGQKVVVTH
RL5_PROMP       ----LKTRYKEAIRPKLLKDLGLKNIHQVPKVIKVNVNRGLGEAASNSKALEASLNEMATITGQKALVTR
RL5_PROMA       ----LKNRYRETIRPKLLKDLGFSNLHQVPKVVKINVNRGLGEAAQNSKALEASLSEVSTITGQKALVTR
RL5_LEIXX       ---RLKQKYKTEIAANLSKDFGFTNVHQVPGLVKIVVNMGMGEAARDGKVIDGAINDLTLITGQKPQVTK
RL5_AGRVS       ---RLKAEYVSRIRQALREQFSYANEMQIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITR
RL5_RHIL3       ---RLKKEYVERIRKALQEQFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITR
RL5_PROM2       ----LKNRYKESIRPKLLKELGLKNIHQVPKVVKVNVNRGLGEAASNSKALEASLNEMATITGQKALVTR
RL5_DESVV       -MTRLENIYREKVVPVLQKEFNYDSSMQVPGIVKVSLNIGLGAASQNNKLMEEALKELTVIAGQKAVVTR
RL5_DESVH       -MTRLENIYREKVVPVLQKEFNYDSSMQVPGIVKVSLNIGLGAASQNNKLMEEALKELTVIAGQKAVVTR
RL5_STRCO       ---RLKTKYREEIAGKLREEFSYENVMQIPGLVKIVVNMGVGDAARDSKLIEGAIRDLTTITGQKPAVTK
RL5_ENT38       ---KLHDYYKDEVVSKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_CHLTE       MPARLEVYYRETVVPKLMERFKYKSIMMVPRLEKISVNIGVGEAAQEPKLLETAMQELGQITGQKPQVRK
RL5_RICBR       ---RFKELYQKEIISNLQKEFSYKNKHEIPAIEKIVINMGVGEAIADSKVIDKAVNDLTLISGQKPFVTS
RL5_RICB8       ---RFKELYQKEIISNLQKEFSYKNKHEIPAIEKIVINMGVGEAIADSKVIDKAVNDLTLISGQKPFVTS
RL5_RHOPT       -VPRLRTEYDRHIRTQLTEKFGYANVMQVPKLDKVVLNMGVGEAVNDRKKAEQAAADLSLIAGQKAVITY
RL5_RHOPA       -VPRLRTEYDRHIRTQLTEKFGYANVMQVPKLDKVVLNMGVGEAVNDRKKAEQAAADLSLIAGQKAVITY
RL5_PSEPW       ---RLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKPVVTF
RL5_PSEPK       ---RLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKPVVTF
RL5_PSEPG       ---RLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKPVVTF
RL5_PSEP1       ---RLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKPVVTF
RL5_PROMS       ----LKNRYKESIRPKLLKDLGLKNIHQVPKVVKVNVNRGLGEAASNSKALEASLNEMATITGQKALVTR
RL5_PROM9       ----LKNRYKESIRPKLLKDLGLKNIHQVPKVVKVNVNRGLGEAASNSKSLEASLNEMATITGQKALVTR
RL5_PROM0       ----LKNRYKESIRPKLLKDLGLKNIHQVPKVVKVNVNRGLGEAASNSKALEASLNEMATITGQKALVTR
RL5_BORRA       -IPELKRRYRDNIVKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAVMELSQITGQKAVKTK
RL5_BORDL       -IPELKRRYRDNIVKELVSEFQYKSIMQAPKIEKIVVSMGVGDAVKNKKLLDSAVMELSQITGQKAVKTK
RL5_ALHEH       ---RLQEQYQAEVKQALRDRFGYDNVMEIPRLSKVTLNMGLGEAVRDKKVLESAQAEMAEIAGQKPILTY
RK5_GRATL       MENTLKTLYNNKICKDLQKKFRYKNIHQIPKLVKITINRGLGEAANNKQVLEKSMNEIAAITGQKPKITK
RL5_BARHE       ---RMKTHYFEVVRKTLQEKFNYKNVMQIPRVDKIVINMGIGEATADSKKPSIAAEDLGLITGQKAVVTR
RL5_PSEE4       ---RLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKPVVTF
RL5_PROM5       ----LKTRYKETIRPKLLKDLGLKNIHQVPKVIKVNVNRGLGEAASNSKALEASLNEMATITGQKALVTR
RL5_MYCTU       ---RLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRR
RL5_MYCTA       ---RLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRR
RL5_MYCBP       ---RLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRR
RL5_MYCBO       ---RLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRR
RL5_DESDA       -MTRLEKIYREKVVPVMQKEFSYSSSMQLPGIEKISLNIGLGAASQNNKLMEEAVAELSAIAGQKAVVTR
RK5_GUITH       MNKSLKEIYYQDVIPGLIEQFNYTNIHQVLKITKITLNRGLGEASKNNKILEASIKEFELISGQHPLINK
RL5_PROVI       ---RLQTLYHEKVVSALTERFKYDNVMNVPKLKKISINIGVGEAASEPKLLETALQELSQITGQKPQIRK
RL5_PROM4       ----LKHRYRETIRPKLLKDLGLSNIHQVPKVVKVNVNRGLGEAAQNSKTLEASLSEMATITGQKALVTR
RL5_MYCGE       -MNNLEKTYKTELVNQLQQQLGFSSIMQVPKLTKIVVNMGVGDAIRDNKFLESALNELHLITGQKPVATK
RL5_EDWI9       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_BARQU       ---RMKTRYFEVIRKTLQEKFNYKNAMQIPRVDKVVVNMGIGEATIDSKRPSLAAEDLGLITGQKAVVTR
RL5_TREPS       -IPELKVRYVQQIVPDMMRDFGYSTVMQVPKLLKIVLSMGLGEALANRKLLDASVADLGVISGQHAVKTR
RL5_TREPA       -IPELKVRYVQQIVPDMMRDFGYSTVMQVPKLLKIVLSMGLGEALANRKLLDASVADLGVISGQHAVKTR
RL5_RICRS       ---RFKELYQQKIIENLQKKFSYKNKHEIPQIKKIVINMGVGEATANSKVINNAVNDLTLISGQKPVVTL
RL5_RICRO       ---RFKELYQQKIIENLQKKFSYKNKHEIPQIKKIVINMGVGEATANSKVINNAVNDLTLISGQKPVVTL
RL5_NITEU       ---RLLEYYRDTVTKELTQKFNYKTVMEVPKITKITLNMGVGEASTDKKIIENAVSDLEKISAQKPVVTK
RL5_BART1       -IPRMKTHYFEVIRKALQEKFNYKNAMQIPRIDKIVINMGIGEATADSKKPSLAAEDLGLITGQKAVVTR
RK5_PAUCH       ----LKQRYRETIQGKLLTELSFSNIHEVPKVTKITVNRGLGEAAQNAKFLEASITELSNITGQKVLVTR
RK5_MESVI       MVQRLKTLYLESAVLKLQETFGYKNPHQIPRIKKIVINCGLSEASQNSKSLESAMKELSIIAGQKGVITR
RL5_RHOP5       ---RLRAEYDQSIRSKLTEEFGYANVMQVPRLDKVVLNMGVGEAVNDRKKAEQAAADLGLIAGQKPIITF
RL5_PSYWF       ---RLKSLYNDQYKQQIKDELGLENVMQVPKITKITLNMGVGGASQDKKLLEGAVADMTAIAGQKPVITK
RL5_RHOP2       -VPRLRAEYDNSIRTQLTEKFGYGNVMQVPRLDKVVLNMGVGEAVNDRKKAEQAAADMALIAGQKAVVTY
RL5_RHOBA       -IPRMQQRYDESVRAALTETYGYKNVHQVPRLLKISMNMGVGAAVGDKKVLDLAIDSMTQITGQKPVTTI
RL5_HAMD5       ---RLHDYYKDIVIKEMMCKFSYASVMQVPRVTKITLNMGVGEAVSDKKLLDSAMSDLAAISAQKPLVTK
RL5_CORK4       ---RLKTRYRSEIRETLNKEFEYANVMQIPGVTKVVVNMGVGDAARDSKLINGALNDLTLITGQKPQIRR
RL5_PECCP       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_MYCBT       ---RLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRR
RL5_KOCRD       ---RFKTKYQETVAPALQEQFGYANVMEMPRXXXXXXNMGLGEAAKDSKLVDNAIKDLTAITGQKPVINR
RL5_ERWCT       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_DESMR       -MTRLEQIYAEKVAPELKKEFGYTSSMQIPRLSFVSLNMGLGEASNNNKLIEEAVVELTAIAGQKAVITR
RL5_BURXL       ---RLQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVITK
RL5_BURPP       ---RLQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVITK
RL5_BURP8       ---RLQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVITK
RL5_BRASO       ---RLRTEYDRKIKSALTEKFGYANVMQVPRLDKVVLNMGIGEAVNDRKKAETAAADLSLIAGQKAVVTY
RK5_EMIHU       -----KNLYKEKIVPSLMEEYGYKNVQLVPKLLKISINRGLGEEARSSKEMDANLKELAVIAGQQPTVNK
RL5_RICFE       ---RFKELYQQKIIENLQKEFSYKSKHEIPQIKKIVINMGVGEAIADSKVINNAVNDLTLISGQKPVVTL
RL5_RHILW       ---RLKKEYVERIRKAMQEQFSYANEMMIPKLDKIVINMGVGEATADSKKPTVAAADLAAIAGQKPVITR
RL5_PSEMY       ---RLKEIYRKEIAPKLKEELKLANVMEVPRITKITLNMGLGEAIGDKKVIENAVADLEKITGQKVVVTH
RL5_COXBU       ----LQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITY
RL5_COXBR       ----LQELYKKTITPTLQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITY
RL5_COXBN       ----LQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITY
RL5_COXB2       ----LQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITY
RL5_COXB1       ----LQELYKKTITPALQKEFGFKSVMAVPRLEKITLNMGLGEAVADKKVIERAMDDMIKISGQKPLITY
RL5_BURM1       ---RLQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_THELT       ----LKEKYEKEVVPKLMKEFNYRNINQVPRIEKIVINMGIGEGSRNADLLNKHLKELAAITGQKPVITK
RL5_SACD2       ---RLKEIYKKEIAPKLLKDLELKNPMEIPRITKITLNMGVGEALADKKVLENAVSDLEKIAGQKAVVTR
RL5_RICCN       ---RFKELYQQKIIENLQKKFSYKNKHEIPQIKKIVINMGVGEATADSKVINNAVNDLTLISGQKPVVTL
RL5_RICAE       ---RFKELYQQKIIENLQKKFSYKNKHEIPQIKKIVINMGVGEATADSKVINNAVNDLTLISGQKPVVTL
RL5_PSEPF       ---RLKEIYRKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKVVVTY
RL5_PSEF5       ---RLKEIYRKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKVVVTY
RL5_DICNV       ---RLQKFYKEEVIKKLQSELGLKNVMEVPRLEKITINMGVGEAVNDKKIMDNAVRDLALISGQKPVVTK
RL5_BRASB       ---RLRTEYDRKIKSALTEKFGYANVMQVPRLDKVVLNMGIGEAVNDRKKAETAAADLSLIAGQKAVVTY
RL5_RALSO       MTARLQEFYKEKVVAELIKQFGYKSVMEVPRITKITLNMGLGEAVNDKKVIEHATGDLTKIAGQKPVVTK
RL5_PSEFS       ---RLKEIYWKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAVGDKKVIEHAVADLEKITGQKVVVTY
RL5_LEPBP       MVPRLKSKYEKEIRPTLQKSLGFQSVMRVPKLEKIVINVGMGEAHTNPKAMEACLVEIGQITGQRPVKTF
RL5_LEPBA       MVPRLKSKYEKEIRPTLQKSLGFQSVMRVPKLEKIVINVGMGEAHTNPKAMEACLVEIGQITGQRPVKTF
RL5_CORU7       ---RLKAQYREEIREKLQAEFNFDNVMQIPGVTKVVVNMGVGDAARDSKMINGAIADLTAITGQKPQVRT
RL5_CHLPD       ---RLESFYREKVVPVMMERFQYSNVMMVPKLEKISINIGVGEAAAEPKLLETAMLELGQITGQKPQVRK
RL5_BRUSU       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUSI       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUO2       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUME       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUMB       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUC2       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUAB       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BRUA1       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RL5_BARBK       ---RMKVHYVGVIRKILQEKFHYKNEMQIPRVDKIVINMGIGEATSDSKKPSIAAGDLSLITGQKAVVTY
RL5_RHOPS       -VPRLRTEYDKSIRTQLTEKFGYGNVMQVPRLDKVVLNMGIGEAVNDRKKAEQAAADMALIAGQKPIITY
RL5_PSEU2       ---RLKEIYRKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKVVVTY
RL5_PSE14       ---RLKEIYRKEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIGDKKVIEHAVADLEKITGQKVVVTY
RL5_NITWN       -VPRLRAEYDKSIRSRLTEQFGYVNVMQVPRLDKVVLNMGIGEAVNDRKKAEAAAGDLSLIAGQKAVVTY
RL5_CAMHC       -MNRLKQLYENSIKPAIVKEFDIKNSMLIPKLDKIVISVGVGESSKDEKILQNMADTISLIAGQKAVITN
RL5_SHISS       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SHIF8       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SHIDS       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SHIBS       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SHIB3       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALAR       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_RUTMC       -MSRLQEQYKNEILPALQKELDMSNPMQVPKIEKITINMGLGSALGDKKVLQSALKEMSLISGQKPLICN
RL5_ROSDO       ---RLKAVYRDTIRAALKEEFGYKNDMQIPRLDKIVLNIGCGEAVRDSKKAKSAQADLTLIAGQKAMTTT
RL5_RICPR       ---RFKELYKQKIIESLKKEFSFKNKHEIPKIKKIVINMGVGEAIADSKVINNALNDLTLISGQKPVVTL
RL5_PROM1       ----LKTRYRETIRPKLLKDLGLKNVHQVPKVQKVTLNRGLGEAATNSKALEASLKEMATISGQKALVTR
RL5_MARAV       ----MKEQYTKEVVPALQKEFGYKNVMQVPRIEKITLNMGVGEAVGDKKLIENAVADLERLAGQKVVVTK
RL5_KLEP7       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_KLEP3       ---KLHDYYKDEVVAKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ESCF3       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ENTS8       ---KLHDYYKDEVVKKLMTQFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOUT       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOSM       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOSE       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOLU       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOLI       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOLC       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOL6       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOL5       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOK1       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOHS       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECODH       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECOBW       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO8A       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO81       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO7I       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO5E       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO57       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO55       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO45       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO27       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_ECO24       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_CHLL2       ---RLEIFYKDKVVPKLMERFQYKNVMMVPKLQKIAINIGVGEAAAEPKLLETAMSELAQITGQKPQIRK
RK5_CHLVU       MVQRLDSFYQEQSIPQLIKEFHYKNKHQVPKLDKIVINRGLGDASQNAKVLESCSKEQSIITRQQGVVTR
RL5_SALTY       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALTI       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALSV       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALPK       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALPC       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALPB       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALPA       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALNS       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALHS       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALG2       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALEP       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALDC       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALCH       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SALA4       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_RICCK       ---RFKELYQQEIIENLQKEFSYKNKHAIPQIKKVVINMGVGEAIADSKVINNAVNDLTLISGQKPVVTL
RL5_PROMT       ----LKTRYRETIRPKLLKDLGLKNVHQVPKVQKVTLNRGLGEAATNSKALEASLKEMATISGQKALVTR
RL5_PHOLL       ---KLHDYYKDEVVQKLMTQFGYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_CITK8       ---KLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_BURS3       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURCH       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURCC       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURCA       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RK5_NEPOL       MAQRLKTFYLNSVVPKLRQQFHHRNIHEVPSIKKIVINRGLGDASQNAKLLDGSLQELTTIAGQRGVITR
RL5_SODGM       ---KLHDYYKDEAVSQLMKQFGYHSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_RICPU       ---RFKELYQQKIIENLQKNFSYKNKHEIPQIKKIVINMGVGEATADSKVINNAVNDLTLISGQKPVVTL
RL5_PSESM       ---RLKEIYRKEIAPKLKEELKLGNVMEVPRVTKITLNMGLGEAIGDKKVIENAVADLEKITGQKVVVTY
RL5_LAWIP       -MTRLEKFYQEKVVPALQKEFLYKSIMQVPTIEKISLNIGLGVASQSNKIMEEAISELSLIAGQKAVITR
RL5_BRUA2       ---RFKKLYQDNIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLAMIAGQKAVVTR
RK5_OSTTA       MIQRLQNLYLTKVQTTLTEQFQYKNTHEIPRLEKIVINRGVGSASQNTKLLESLADELTILAGQRPIVKR
RL5_RICAH       ---RFKELYQQKIIENLQKEFSYKNKHEIPQIKKIVINMGVGEAIADSKVINNAVNDLTCISGQKPVVTL
RL5_ERWT9       ---KLHDYYKDEVVKKLMTEFSYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_DIAST       ---RLQEIYRDKIAPELVKQFGYTSPMQVPRLTKITLNMGVSEAVADKKIMDNAVADLTKIAGQKPVVTK
RL5_ACISJ       ---RLQEIYRDKIAPELVKQFGYTSPMQVPRLTKITLNMGVSEAVADKKIMDNAVADLTKIAGQKPVVTK
RL5_ACIC1       -VPRLKQYYREHVVPALREQFGYRNVMQVPTLVKVVVNMGVGEAARDAKLIEGAVRDIAAITGQRPAIAR
RK5_SCEOB       MTQRLKKLYTEKIVPKFYKDFQYKNIHEVPSLKKIVINRGIGDASQNAKILETFLKELSIIAGQKGVITR
RK5_CHAGL       MVQRLKSIYLNNVIPKLNEEAKYKNVHQIPRLKKIVINCGIGEASQNAKTLEYTIRDLSIIAGQRPLVKR
RL5_TROWT       ---RLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVGDAARDSKIIEGAVSDITLITGQKPRINR
RL5_TROW8       ---RLLTRYREEIVPVLMSRFDINNVHQVPSITKIVVNSGVGDAARDSKIIEGAVSDITLITGQKPRINR
RL5_PELLD       ---RFETLYREKVTKALSERFGYKNVMNIPRLQKISINIGVGEAASEPKLLETAIQELAQITGQKPQIRK
RL5_CORJK       ---RLKTRYREEIREKLNGEFSYENVMQIPGVTKVVVNMGVGDAARDSKLINGAIEDLTKITGQKPQIRT
RL5_BURTA       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKVIENAVGDLTKIAGQKPVVTK
RL5_BURPS       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURP6       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURP1       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURP0       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURMS       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURM9       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURM7       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAVADKKIIENAVGDLTKIAGQKPVVTK
RL5_BUCAK       ---KLHDYYKDEVIKQLMSQFDYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_SYNPW       ----LKQRYRETIQPKLLKDLSLSNXXXXXXXXXXXXNRGLGEAAQNAKSLEASVNELAQITGQKVVVTR
RL5_SERP5       ---KLHDYYKDEVVKQLMSQFDYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_RICTY       ---RFKELYKKKIIESLKKEFSFKNQHEIPQIKKIVINMGVGEAIADSKVINNALNDLTLISGQKPIVTL
RL5_RHOSK       ---RLKAAYANSVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGXXXXXXXXXXXXXXXLSMIAGQKAVVTH
RL5_RHOS4       ---RLKAAYANSVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGXXXXXXXXXXXXXXXLSMIAGQKAVVTH
RL5_GLUOX       ---RLHQRYEDVLKKQLREQFGYANELQVPKLEKIVLNMGVGEAAGDQKKLDAAVAEMTVISGQKPVKTL
RL5_BURVG       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKVIENAVGDLTKIAGQKPVVTK
RL5_BURCM       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURCJ       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_BURA4       ---RFQEFYKEKVVPGLIEKFGYKSVMEVPRITKITLNMGLGEAIADKKIIENAVGDLTKIAGQKPVVTK
RL5_YERE8       ---KLHDYYKDEVVKQLMSQFDYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_RHOS1       ---RLKAAYANTVRAAMKEEFGYKNDMQIPRLDKIVLNMGVGXXXXXXXXXXXXXXXLSMIAGQKAVVTH
RL5_PROMH       ---KLHDYYKDEVVQKLMSQFGYHSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPLITK
RL5_OCHA4       ---RFKKLYNENIRKALLEEFKYDNEMQIPRITKVVLNMGVGEATGDSKKPAVAAEDLGLIAGQKAVITR
RL5_XYLFM       -MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAATNKKVLENAVADMAKVSGQKPIVTK
RL5_PELPB       ---RLETFFKEKVTPNLVERFQYKNAMLVPKLKKISINIGVGAAAAEPKLLEIALQELAQITGQKPQIRK
RL5_NITEC       ---RLFDHYKNIVIKELIQQFNYKTVMQVPKITKITLNMGVGEAAVDKKIMENAVSDLEKISAQKPIITK
RL5_BIFAA       ---RLKQKYNEQIVPELEKEFHYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITK
RL5_VESOH       -MSRLQEQYKNKISLILQKELGMSNPMQTPKIEKITINMGLGNALGDKKILQSGLEEMSLISGQKPLTCN
RL5_RHOS5       ---RLKSLYASNVRAALKEQFSYKNDMQIPRLDKIVLNMGVGXXXXXXXXXXXXXXXLSMIAGQKAVITH
RK5_PSEAK       MTERLKVVFQEKIAPKLIEKNRYKNKHQVPVIEKIVINRGLGNASQNTKILESSLNELTLIAGQRGVLTR
RL5_XYLFT       -MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAATNKKVLENALADMAKISGQKPIVTK
RL5_XYLFA       -MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAATNKKVLENAVADMAKISGQRPIVTK
RL5_XYLF2       -MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAATNKKVLENALADMAKISGQKPIVTK
RL5_WIGBR       ---QLYDFYKKNVLIKLKNKFNYKSIMQVPKIEKITLNMGVGKASFDKKLLEHAVNDLTLISGQKPYITK
RL5_MYCGA       ----LKTKYKTKIVPLLQKEFGFSSVMQVPKIEKIVINMGVGDATKDXXXXXXXXXXXXXISGQKPVITK
RL5_MYCPN       -MNNLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLESALNELHLISGQKPVATK
RL5_LEPIN       MAARLRTKYKKEIVPELNKKFKFSSIMQVPRLEKIVLNVGMGEAHTNPKXXXXXXXXXXXITGQRPVKTK
RL5_LEPIC       MAARLRTKYKKEIVPELNKKFKFSSIMQVPRLEKIVLNVGMGEAHTNPKXXXXXXXXXXXITGQRPVKTK
RL5_YERPY       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPS       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPP       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPN       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPG       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPE       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPB       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERPA       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_YERP3       ---KLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXXSGQKPFITK
RL5_SILPO       ---RLKAQYAETIRAALKEEFGYKNDMMIPKLEKIVLNIGCGEAVKDSKKAKSAQEDLSKIAGQKAITTT
RL5_POLSQ       MSTRFQEHYQEKVVADLITKFGYKSVMEVPRITKVTLNMGLGDAVNDKKIIENAVGDLTKVAGQKPVVTK
RL5_DESAD       -MTRLEKIYTDKVAPALNKEFGYKSSMEIPGIKAISLNIGLGEASQNAKLIDGAVEELTAIAGQRAVVTR
RK5_ZYGCR       MTQRLKTFYLNTVVPKLRKQLEYQNIHQVPQVTKIVINCGLGEASQNAKSLESTLRDLSFITGQKPIVTR
RK5_STIHE       MTQRLSKLYFEQISPKLIEKFSYKNMHQVPRVEKIVINRGVGEAAQSNKVLESSLKELNLISGQKGIITR
RL5_BIFLO       ---RLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITK
RL5_BIFLI       ---RLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITK
RL5_BIFLD       ---RLKVKYNEQIIPELEKEFKYSNPMQVARVQKVVVSMGVGAAARDSKLIEGAVKDLTLITGQKPKITK
RL5_RHOPB       -VPRLREQFDREIRGKLTEQFGYANVMQVPRLDKVVLNMGIGEAVNDRKKXXXXXXXXXXXXGQKPIVTY
RL5_BORPD       -MSRLQDFYKSKVAPDLQAKFGYKSTMEVPRITKVTLNMGVSEAVADKKVIEHAVSDLTKIAGQKPVVTK
RK5_ORYSJ       -VHRLKAVYDQKVVPLITEEFGYTNVHQVPKVEKIVVNCGLGAEAGNSKGLESAMKDLAMITGQWPVKTK
RK5_CHAVU       MIQRLKKFYLDNVVPDLYQKFEYTNIHQLPYLKKIVINCGFGEASQNSKFLEGTIKDLSIIASQKPIVTR
RL5_NITOC       ---RLQKHYRDTVINQLRERLGCQSVMAVPRIEKITLNIGAGEAVGDKKILERVMGDMARISGQKPVLTR
RL5_MYCLE       ---RLKQRYRSEIREALNKQFSYGNVMQIPTXXXXXXNMGVGDAARDAKLINGAVSDLALITGQKPEVRK
RL5_MYCLB       ---RLKQRYRSEIREALNKQFSYGNVMQIPTXXXXXXNMGVGDAARDAKLINGAVSDLALITGQKPEVRK
RL5_HELHP       ----LREKYKNEIISQLKSELNMSNPMLLPKLEKIVISVGAGDYAKDSKIMQNIADTISLIAGQKAVITL
RL5_AYWBP       ----------SKITATLMKTFNYKSVMQVPKVDKVVINMGVGDAIFNXXXXXXXXXXXXXXSGQSPVITK
RL5_BLOFL       ---KLRDYYKSHVVYDLMREFKYKSVMQVPKINKITISMGVGKSIINKKFLERAIEDLEMISGQKPVITK
RK5_ARATH       ---RLKTAYLERIIPALKEEFKYVNIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTR
RL5_NITHX       -VPRLRVEYDKSIRTKLTEQFGYVNVMEVPRLDKVVLNMGIGEAVNDRKKAETAAGDLSLIAGQKALVTY
RL5_LEPBJ       MAARLRTKYKKEIVPELNKKFKFESIMQVPRLEKIVLNVGMGEAHTNPKXXXXXXXXXXXITGQRPVKTK
RL5_DEHSC       ---KVEERYTNA-VPELQKFFNYGNIMQVPKLVKVVINTGVGEAVSNSKAMETAEADIVAIAGQHPVVTR
RL5_DEHSB       ---KVEERYTNA-VPELQKFFNYGNIMQVPKLVKVVINTGVGEAVSNSKAMETAEADIVAIAGQHPVVTR
RL5_SYNPX       ----LKKRYRETIQPKLQKDLSLTNIHEVPKVVKVTVNRGLGEAAANAKSLEASVNELAQITGQKVVVTR
RL5_DEHE1       ---KVEERYTNA-VPELQKAFKYENIMQVPKLVKVVINTGVGEAVSNSKALETAEADIVAIAGQHPVITR
RL5_BORPE       -MSRLQEFYKSKVVADLQAKFGYKCVMEVPRITKITLNMGVSEAVADKKVIEHAVSDLTKISGQKPVVTK
RL5_BORPA       -MSRLQEFYKSKVVADLQAKFGYKCVMEVPRITKITLNMGVSEAVADKKVIEHAVSDLTKISGQKPVVTK
RL5_BORBR       -MSRLQEFYKSKVVADLQAKFGYKCVMEVPRITKITLNMGVSEAVADKKVIEHAVSDLTKISGQKPVVTK
RL5_ONYPE       ----------SKITATLMETFNYKSVMQVPKVEKVVINMGVGDAIFNXXXXXXXXXXXXXXSGQSPVITK
RL5_SPHAL       ---RMKKLYDDKIVKAMTDKFGYKNAMEVPKIEKITLNMGVGEATQDXXXXXXXXXXXXLIAGQKPVVTK
RL5_FRASN       -VPRLKQRYREEIAPALREEFSYGNVMQIPXXXXXXXXXXXXDAARDAKLIDGATRDLAAITGQKPAVRR
RL5_SILST       ---RLKTLYKDTIRGALKEEFGYKNEMQIPKLDKIVLNIGCGRXXXXXXXXXXXXQELTKIAGQKALTTV
RL5_POLNS       MSTRFQEHYQSKVVADLIAKFGYKSVMEVPRITKVTLNMGLGDAVNDKKIIENAVGDLTKVAGQKPVVTK
RL5_HELPS       ----LKQFYQNEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITK
RL5_CAMJD       ---RLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_HELAH       ----LKQFYQNEVKVKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITK
RL5_CAMJR       ---RLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_CAMJJ       ---RLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_CAMJE       ---RLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_CAMJ8       ---RLKEKYNQSIKPALVKEFDIKNPMLIPVIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_CAMC1       -MSRLKDKFNETIKPALVKEFDIKNPMLIPALEKIVISVGAGDSAKDQKVLQNMADTISLIAGQKAVITD
RL5_BDEBA       -MNRLHTRYNKEIAPALKNQLGVKNVMQVPRLEKITLSVCLSEAVQNPKILNTVVDEITAITGQKAVITK
RL5_ACIBY       ---RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_ACIBT       ---RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_ACIBS       ---RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_ACIB5       ---RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_ACIB3       ---RLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_WOLTR       -----KELYRDSIVKSLKDKFNYGNIMQVPKLVKVCINMGVGGAATDNKAINEPFDDLYLIAGQKPVSTF
RL5_HELPJ       ----LKQFYQNEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLVAGQKAVITK
RL5_CAMC5       -MGRLKDKFNESIKPALVKEFDIKNPMLVPALEKIVISVGAGDFAKDQKVLQNMADTISLIAGQKAVITN
RL5_SULNB       -MSRMKQKY-NDIVPALREECGVQNTMQTPKLEKIVISVGAGEEGRDSKLIANMADTISLIAGQKAVIVN
RL5_HELPH       ----LKQFYQNEVRIKLAQELDIKNPMLLPKLEKIVISVGAGAYAKDMKIMQNIAQTISLIAGQKAVITK
RL5_ACIAD       ---RLKTRYNEELKAKLQQELGIKNVMEIPRITKITLNMGVGAAATDKKLLDGAVADMQLIAGQKPVVTL
RL5_VARPS       ---RLQQHYREKIAKDLTEKFGYKSPMQVPRLTKITLNMGVGEAVADKKVLDNAVADLTKIAGQKPVVTK
RL5_SYNS3       ----LKQRYRETIQPKLLKDLSLSNIHEVPKVLKVTVNRGLGEAATNAKSLEASVNELAQITGQKVVITR
RL5_MYCA9       ---RLKTRYREEIKTALNDEFKYANVMQIPXXXXXXXXXXXXDAARDAKLINGAVTDLALITGQKPEIRK
RK5_BIGNA       MKQRLKVKYLNTVIPELKEKFVYNNLNQIPSIKKITINRGLGQSHQNSKSFDYFLDELSVITGQRGIVTY
RL5_KINRD       ---RLKQRYRDEIKGQLHEQFSYGNVMQIPGLTKVVVNMGVGEAARDSKLIDGAVRDLTAITGQKPQITK
RL5_COREF       ---RLKSRYQDEIRPNLQTQFEFSNVMQIPGVTKVVVNMGVGDAARDSKMINGALEDLTAITGQKPQLRR
RL5_SHIFL       ---KLHDYYKDEVVKKLMTEFNYNSVMQVPRVEKITLNMGVGEXXXXXXXXXXXXXXXXXFSRQKPLSTK
RL5_JANSC       ---RLKAAFSETIKAAMKEEFGYKNDMQIPRLEKIVLNIGSGESVRDTKKAKSAQEDLTAIAGQHAVVTK
RL5_HELPG       ----LKQFYQDEVRAKLAQELDIKNPMLLPKLEKIVISVGAGAHAKDMKIMQNIAQTISLIAGQKAVITK
RL5_HELP2       ----LKQFYQNEVRTKLAQELDIKNPMLLPKLEKIVISVGAGAYAKDMKIMQNIAQTISLIAGQKAVITK
RL5_BAUCH       ---KLSDIYQEQVIDKLINQFSYKSRMQVPNIEKIILNMGVGQTVTDKKLLDNAVANLTAISGQKPIITK
RL5_NOCFA       ---RLKVRYREEIKDALAKEFNYANVMQIPXXXXXXXXXXXXDAARDAKLINGAVEDLALITGQKPQIRK
RL5_CAMLR       ---RLKEKYTQNIKPALVKEFDIKNPMLIPFIEKVVISVGAGELAKDQKVLQNVADTISLIAGQKAVITK
RL5_BACV8       ----LKKEYAERIAPALKNQFQYSSTMQIPVLKKIVINQGLGMAVADKKIIEVAINELTAITGQKAVATV
RL5_XANP2       ---KLRTFYDEVVRPKMIEQFGYKNPMEVPTIDKIVINMGVGEXXXXXXXXXXXXXXXXQIAGQKPVITR
RL5_WOLSU       ---QLKKLYNEELKAKLSEELGIKNPMLLPKLEKIVISVGAGDHAKDTKVMQNIADTISLIAGQKAVITI
RL5_STRMK       MSSRLEKFYKDEVVPALMKQFGYTNPMEVPKLVKVTLNMGVGEAATNKKILENAVGDMTKISGQKPVVTK
RL5_STRM5       MTSRLEKFYKEEVVPALMKQFGYTNPMEVPKLVKVTLNMGVGEAATNKKILENAVGDMTKISGQKPVVTK
RL5_MYCS2       ---RLKQRYREEIREALQQEFNYANVMQIPXXXXXXXXXXXXDAARDAKLINGAINDLALITGQKPEVRR
RL5_XANOR       MNTRLEKFYKENVVPALMKEFGYTNPMEVPKLVKVTLNMGVGEAASNKKILENAVADMSKISGQKPVVTK
RL5_XANOP       MNTRLEKFYKENVVPALMKEFGYTNPMEVPKLVKVTLNMGVGEAASNKKILENAVADMSKISGQKPVVTK
RL5_XANOM       MNTRLEKFYKENVVPALMKEFGYTNPMEVPKLVKVTLNMGVGEAASNKKILENAVADMSKISGQKPVVTK
RL5_PROAC       ---RLKKQYREQIRAAMQEEFGYRNPMLIPGLEKIVVNMGVGDAAHDSKVMDGAIRDITAITGQKPQVTK
RL5_PORGI       ----LKKDYQERIVPALMKQFGYTSVMQVPVLKKIVINQGLGMATGDKKIIDVAVSELTAITGQKAVPTV
RL5_PORG3       ----LKKDYQERIVPALMKQFGYTSVMQVPVLKKIVINQGLGMATGDKKIIDVAVSELTAITGQKAVPTV
RL5_ALCBS       ----LKKIYQDEIAPKLKEELGLGNIMEVPKITKITLNMGVGEASADRKAMEGALSDMTAISGQKPLVTN
RK5_OEDCA       MKQRLKQLYMETIVPKLMEKFKYKNIHQVPRIKKIVINRGIGEASQSNKILESSFKELNLIAGQKGVITR
RL5_AZOC5       ---RLRTHYDSVVRPKLIEEFGYKNPMQVPVIEKIVINMGVGEXXXXXXXXXXXXXXXXRIAGQKPVLTR
RL5_MYCSS       ---RLKQRYREEIRESLQQQFGYANVMQIPXXXXXXXXXXXXDAARDAKLINGAVNDLALITGQKPEIRR
RL5_MYCSK       ---RLKQRYREEIRESLQQQFGYANVMQIPXXXXXXXXXXXXDAARDAKLINGAVNDLALITGQKPEIRR
RL5_MYCSJ       ---RLKQRYREEIRESLQQQFGYANVMQIPXXXXXXXXXXXXDAARDAKLINGAVNDLALITGQKPEIRR
RL5_SALTO       ---RLKERYRNEIVGQLREQYQYGNPMQVPGLVKIVVNMGVGEAARDAKLIDGAVRDLATITGQKPQVR