[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00229.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    1::122     4e-55 100%  122 aa  RL14_LACS1 RecName: Full=50S ribosomal protein L14;
    1::122     6e-49  90%  122 aa  RL14_LACF3 RecName: Full=50S ribosomal protein L14;
    1::122     1e-48  91%  122 aa  RL14_LACRJ RecName: Full=50S ribosomal protein L14;
    1::122     1e-48  91%  122 aa  RL14_LACRD RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACHK RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACCZ RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACCR RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACCQ RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC7 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC4 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC3 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC2 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC1 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACC0 RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACAN RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACAH RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACAC RecName: Full=50S ribosomal protein L14;
    1::122     6e-47  89%  122 aa  RL14_BACAA RecName: Full=50S ribosomal protein L14;
    1::122     7e-47  87%  122 aa  RL14_LACCB RecName: Full=50S ribosomal protein L14;
    1::122     7e-47  87%  122 aa  RL14_LACC3 RecName: Full=50S ribosomal protein L14;
    1::122     1e-46  89%  122 aa  RL14_BACCN RecName: Full=50S ribosomal protein L14;
    1::122     3e-46  88%  122 aa  RL14_PEDPA RecName: Full=50S ribosomal protein L14;
    1::122     3e-46  75%  122 aa  RL14_LACPL RecName: Full=50S ribosomal protein L14;
    1::122     4e-46  88%  122 aa  RL14_ENTFA RecName: Full=50S ribosomal protein L14;
    1::122     5e-46  89%  122 aa  RL14_BACWK RecName: Full=50S ribosomal protein L14;
    1::122     8e-46  87%  122 aa  RL14_LACSS RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISW6 RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISMO RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISMH RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISMF RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISMC RecName: Full=50S ribosomal protein L14;
    1::122     4e-45  84%  122 aa  RL14_LISIN RecName: Full=50S ribosomal protein L14;
    1::122     5e-45  86%  122 aa  RL14_STRMU RecName: Full=50S ribosomal protein L14;
    1::122     5e-45  85%  122 aa  RL14_MACCJ RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  87%  122 aa  RL14_STRSY RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRS7 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  87%  122 aa  RL14_STRS2 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPZ RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPM RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPG RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPF RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPD RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPC RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRPB RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRP8 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRP6 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRP3 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRP1 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STREM RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRE4 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRA5 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRA3 RecName: Full=50S ribosomal protein L14;
    1::122     9e-45  84%  122 aa  RL14_STRA1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  86%  122 aa  RL14_STRSV RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  86%  122 aa  RL14_STRGC RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAW RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAT RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAS RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAR RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAN RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAM RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAE RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAC RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAAB RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAA9 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAA8 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAA3 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAA2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  84%  122 aa  RL14_STAA1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  85%  122 aa  RL14_LACJO RecName: Full=50S ribosomal protein L14;
    1::122     1e-44  85%  122 aa  RL14_LACGA RecName: Full=50S ribosomal protein L14;
    1::122     2e-44  84%  122 aa  RL14_OCEIH RecName: Full=50S ribosomal protein L14;
    1::122     2e-44  84%  122 aa  RL14_LACDB RecName: Full=50S ribosomal protein L14;
    1::122     2e-44  84%  122 aa  RL14_BACP2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_STRTD RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_STRT2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_STRT1 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_BACSU RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_BACHD RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  71%  122 aa  RL14_BACA2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRZT RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRZP RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRZJ RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRR6 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRPS RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRPN RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRPJ RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRPI RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRP7 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRP4 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  85%  122 aa  RL14_STRP2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-44  84%  122 aa  RL14_LACAC RecName: Full=50S ribosomal protein L14;
    1::122     4e-44  84%  122 aa  RL14_LYSSC RecName: Full=50S ribosomal protein L14;
    1::122     8e-44  83%  122 aa  RL14_STRU0 RecName: Full=50S ribosomal protein L14;
    1::122     8e-44  73%  122 aa  RL14_OENOB RecName: Full=50S ribosomal protein L14;
    1::122     8e-44  84%  122 aa  RL14_LACH4 RecName: Full=50S ribosomal protein L14;
    1::122     2e-43  83%  122 aa  RL14_LACDA RecName: Full=50S ribosomal protein L14;
    1::122     2e-43  83%  122 aa  RL14_BACSK RecName: Full=50S ribosomal protein L14;
    1::122     5e-42  82%  122 aa  RL14_STAES RecName: Full=50S ribosomal protein L14;
    1::122     5e-42  82%  122 aa  RL14_STAEQ RecName: Full=50S ribosomal protein L14;
    1::122     9e-42  81%  122 aa  RL14_STAHJ RecName: Full=50S ribosomal protein L14;
    1::122     9e-42  82%  122 aa  RL14_BACLD RecName: Full=50S ribosomal protein L14;
    1::122     2e-41  80%  122 aa  RL14_STACT RecName: Full=50S ribosomal protein L14;
    1::122     2e-41  83%  122 aa  RL14_EXISA RecName: Full=50S ribosomal protein L14;
    1::122     3e-41  80%  122 aa  RL14_STAS1 RecName: Full=50S ribosomal protein L14;
    1::122     3e-41  76%  122 aa  RL14_CLOD6 RecName: Full=50S ribosomal protein L14;
    1::122     3e-41  78%  122 aa  RL14_CLOCE RecName: Full=50S ribosomal protein L14;
    1::122     5e-41  81%  122 aa  RL14_EXIS2 RecName: Full=50S ribosomal protein L14;
    1::122     5e-41  67%  122 aa  RL14_CORDI RecName: Full=50S ribosomal protein L14;
    1::122     6e-41  67%  122 aa  RL14_CORK4 RecName: Full=50S ribosomal protein L14;
    1::122     1e-40  79%  122 aa  RL14_GEOKA RecName: Full=50S ribosomal protein L14;
    1::122     1e-40  79%  122 aa  RL14_BACST RecName: Full=50S ribosomal protein L14;
    1::122     1e-40  77%  122 aa  RL14_LACLS RecName: Full=50S ribosomal protein L14;
    1::122     1e-40  77%  122 aa  RL14_LACLM RecName: Full=50S ribosomal protein L14;
    1::122     1e-40  77%  122 aa  RL14_LACLA RecName: Full=50S ribosomal protein L14;
    1::122     2e-40  68%  122 aa  RL14_LEUMM RecName: Full=50S ribosomal protein L14;
    1::122     2e-40  68%  122 aa  RL14_LEUCK RecName: Full=50S ribosomal protein L14;
    1::122     3e-40  67%  122 aa  RL14_CORGL RecName: Full=50S ribosomal protein L14;
    1::122     3e-40  67%  122 aa  RL14_CORGB RecName: Full=50S ribosomal protein L14;
    1::122     5e-40  78%  122 aa  RL14_GEOSW RecName: Full=50S ribosomal protein L14;
    1::122     7e-40  78%  122 aa  RL14_LACBA RecName: Full=50S ribosomal protein L14;
    1::122     7e-40  66%  122 aa  RL14_CORA7 RecName: Full=50S ribosomal protein L14;
    1::122     7e-40  63%  122 aa  RL14_CLOTH RecName: Full=50S ribosomal protein L14;
    1::122     7e-40  76%  122 aa  RL14_CALS8 RecName: Full=50S ribosomal protein L14;
    1::122     9e-40  78%  122 aa  RL14_GEOTN RecName: Full=50S ribosomal protein L14;
    1::123     1e-39  66%  123 aa  RL14_CORU7 RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOBM RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOBL RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOBK RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOBJ RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOBH RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOB6 RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  78%  122 aa  RL14_CLOB1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-39  66%  122 aa  RL14_COREF RecName: Full=50S ribosomal protein L14;
    1::122     2e-39  78%  122 aa  RL14_CLOK5 RecName: Full=50S ribosomal protein L14;
    1::122     3e-39  75%  122 aa  RL14_HELMI RecName: Full=50S ribosomal protein L14;
    1::122     3e-39  63%  122 aa  RL14_CLAMS RecName: Full=50S ribosomal protein L14;
    1::122     3e-39  63%  122 aa  RL14_CLAM3 RecName: Full=50S ribosomal protein L14;
    1::122     4e-39  61%  122 aa  RL14_ROSS1 RecName: Full=50S ribosomal protein L14;
    1::122     4e-39  77%  122 aa  RL14_EUBR3 RecName: Full=50S ribosomal protein L14;
    1::122     4e-39  75%  122 aa  RL14_ANATD RecName: Full=50S ribosomal protein L14;
    1::123     6e-39  67%  123 aa  RL14_CORJK RecName: Full=50S ribosomal protein L14;
    1::122     6e-39  77%  122 aa  RL14_ANOFW RecName: Full=50S ribosomal protein L14;
    1::122     7e-39  75%  122 aa  RL14_THETN RecName: Full=50S ribosomal protein L14;
    1::122     7e-39  76%  122 aa  RL14_CLOPS RecName: Full=50S ribosomal protein L14;
    1::122     7e-39  76%  122 aa  RL14_CLOPE RecName: Full=50S ribosomal protein L14;
    1::122     7e-39  76%  122 aa  RL14_CLOP1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  78%  122 aa  RL14_ALKOO RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  75%  122 aa  RL14_MICLU RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  77%  122 aa  RL14_MICLC RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  63%  122 aa  RL14_LEIXX RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  76%  122 aa  RL14_EUBE2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  66%  122 aa  RL14_ARTS2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  66%  122 aa  RL14_ARTCA RecName: Full=50S ribosomal protein L14;
    1::122     1e-38  66%  122 aa  RL14_ARTAT RecName: Full=50S ribosomal protein L14;
    1::122     2e-38  61%  122 aa  RL14_ROSCS RecName: Full=50S ribosomal protein L14;
    1::122     2e-38  65%  122 aa  RL14_RENSM RecName: Full=50S ribosomal protein L14;
    1::122     3e-38  65%  122 aa  RL14_RHOSR RecName: Full=50S ribosomal protein L14;
    1::122     3e-38  65%  122 aa  RL14_RHOOB RecName: Full=50S ribosomal protein L14;
    1::124     5e-38  75%  124 aa  RL14_CLONN RecName: Full=50S ribosomal protein L14;
    1::122     5e-38  75%  122 aa  RL14_CLOAB RecName: Full=50S ribosomal protein L14;
    1::122     6e-38  73%  122 aa  RL14_THEPX RecName: Full=50S ribosomal protein L14;
    1::122     6e-38  73%  122 aa  RL14_THEP3 RecName: Full=50S ribosomal protein L14;
    1::122     8e-38  63%  122 aa  RL14_RHOE4 RecName: Full=50S ribosomal protein L14;
    1::122     8e-38  60%  122 aa  RL14_NATTJ RecName: Full=50S ribosomal protein L14;
    1::122     1e-37  76%  122 aa  RL14_CLOPH RecName: Full=50S ribosomal protein L14;
    1::122     1e-37  60%  122 aa  RL14_CHLAD RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  62%  122 aa  RL14_STRCO RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  62%  122 aa  RL14_STRAW RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  64%  122 aa  RL14_MYCGI RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  75%  122 aa  RL14_MYCA9 RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  75%  122 aa  RL14_CLOBB RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  75%  122 aa  RL14_CLOBA RecName: Full=50S ribosomal protein L14;
    1::122     2e-37  75%  122 aa  RL14_ACHLI RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  61%  122 aa  RL14_SPICI RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  59%  122 aa  RL14_MYCMO RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  71%  122 aa  RL14_HALOH RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  72%  122 aa  RL14_DESHY RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  72%  122 aa  RL14_DESHD RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  60%  122 aa  RL14_CHLSY RecName: Full=50S ribosomal protein L14;
    1::122     3e-37  60%  122 aa  RL14_CHLAA RecName: Full=50S ribosomal protein L14;
    1::122     4e-37  62%  122 aa  RL14_KINRD RecName: Full=50S ribosomal protein L14;
    1::122     5e-37  72%  122 aa  RL14_MYCLE RecName: Full=50S ribosomal protein L14;
    1::122     5e-37  57%  122 aa  RL14_MYCAP RecName: Full=50S ribosomal protein L14;
    1::122     5e-37  71%  122 aa  RL14_DESRM RecName: Full=50S ribosomal protein L14;
    1::122     9e-37  73%  122 aa  RL14_MYCMM RecName: Full=50S ribosomal protein L14;
    1::122     9e-37  58%  122 aa  RL14_HERA2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_NOCFA RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCTU RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCTA RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCPA RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCBT RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCBP RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCBO RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  72%  122 aa  RL14_MYCA1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  57%  122 aa  RL14_GRAFK RecName: Full=50S ribosomal protein L14;
    1::122     1e-36  76%  122 aa  RL14_CLOTE RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  61%  122 aa  RL14_STRGG RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  72%  122 aa  RL14_MYCUA RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  72%  122 aa  RL14_BREBN RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  62%  122 aa  RL14_SACEN RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  61%  122 aa  RL14_FINM2 RecName: Full=50S ribosomal protein L14;
    1::122     2e-36  74%  122 aa  RL14_CLOB8 RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  59%  122 aa  RL14_SYNWW RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  74%  122 aa  RL14_ALKMQ RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  61%  122 aa  RL14_THEFY RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  72%  122 aa  RL14_MYCSS RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  72%  122 aa  RL14_MYCSK RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  72%  122 aa  RL14_MYCSJ RecName: Full=50S ribosomal protein L14;
    1::122     3e-36  71%  122 aa  RL14_KOCRD RecName: Full=50S ribosomal protein L14;
    1::122     4e-36  74%  122 aa  RL14_SALTO RecName: Full=50S ribosomal protein L14;
    1::122     4e-36  74%  122 aa  RL14_SALAI RecName: Full=50S ribosomal protein L14;
    1::122     4e-36  61%  122 aa  RL14_PHYMT RecName: Full=50S ribosomal protein L14;
    1::122     6e-36  72%  122 aa  RL14_MYCVP RecName: Full=50S ribosomal protein L14;
    1::122     6e-36  72%  122 aa  RL14_MYCS2 RecName: Full=50S ribosomal protein L14;
    1::122     8e-36  70%  122 aa  RL14_NOCSJ RecName: Full=50S ribosomal protein L14;
    1::122     8e-36  69%  122 aa  RL14_BIFLO RecName: Full=50S ribosomal protein L14;
    1::122     8e-36  69%  122 aa  RL14_BIFLI RecName: Full=50S ribosomal protein L14;
    1::122     8e-36  69%  122 aa  RL14_BIFLD RecName: Full=50S ribosomal protein L14;
    1::122     8e-36  70%  122 aa  RL14_BIFAA RecName: Full=50S ribosomal protein L14;
    1::122     1e-35  70%  122 aa  RL14_SYMTH RecName: Full=50S ribosomal protein L14;
    1::122     1e-35  70%  122 aa  RL14_BEUC1 RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  72%  122 aa  RL14_ACIC1 RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  70%  122 aa  RL14_FRASN RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  73%  122 aa  RL14_FRASC RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  73%  122 aa  RL14_FRAAA RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  60%  122 aa  RL14_DESOH RecName: Full=50S ribosomal protein L14;
    1::122     2e-35  55%  122 aa  RK14_CHLVU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-35  70%  122 aa  RL14_PELTS RecName: Full=50S ribosomal protein L14;
    1::122     5e-35  66%  122 aa  RL14_RHOBA RecName: Full=50S ribosomal protein L14;
    1::122     5e-35  59%  122 aa  RL14_CYTH3 RecName: Full=50S ribosomal protein L14;
    1::122     5e-35  68%  122 aa  RL14_BIFA0 RecName: Full=50S ribosomal protein L14;
    1::122     5e-35  59%  122 aa  RL14_ALCBS RecName: Full=50S ribosomal protein L14;
    1::122     5e-35  56%  122 aa  RK14_PSEAK RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-35  67%  122 aa  RL14_PROAC RecName: Full=50S ribosomal protein L14;
    1::122     8e-35  67%  122 aa  RL14_MOOTA RecName: Full=50S ribosomal protein L14;
    1::122     8e-35  57%  122 aa  RL14_CYAP4 RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  55%  122 aa  RK14_BIGNA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-34  56%  122 aa  RL14_THEEB RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  55%  122 aa  RL14_MYCPU RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  69%  122 aa  RL14_DESAD RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  60%  122 aa  RL14_BURVG RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  60%  122 aa  RL14_BURCM RecName: Full=50S ribosomal protein L14;
    1::122     1e-34  60%  122 aa  RL14_BURA4 RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  68%  122 aa  RL14_CARHZ RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIAD RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_TREDE RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_SYNFM RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_PSYCK RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_PSYA2 RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  58%  122 aa  RL14_LAWIP RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  60%  122 aa  RL14_BURS3 RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  59%  122 aa  RL14_BURP8 RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  60%  122 aa  RL14_BURCJ RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  60%  122 aa  RL14_BURCH RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  60%  122 aa  RL14_BURCC RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  60%  122 aa  RL14_BURCA RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIBY RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIBT RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIBC RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIB5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-34  57%  122 aa  RL14_ACIB3 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  68%  122 aa  RL14_RUBXD RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  55%  122 aa  RL14_FLAJ1 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURXL RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURTA RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURPS RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURPP RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURP6 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURP1 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURP0 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURMS RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURMA RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURM9 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURM7 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  59%  122 aa  RL14_BURM1 RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  57%  122 aa  RL14_ANASK RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  57%  122 aa  RL14_ANADE RecName: Full=50S ribosomal protein L14;
    1::122     3e-34  57%  122 aa  RL14_ANAD2 RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  58%  122 aa  RL14_MYXXD RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  57%  122 aa  RL14_DESVM RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  57%  122 aa  RL14_DESPS RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  69%  122 aa  RL14_DESAH RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  57%  122 aa  RL14_ANADF RecName: Full=50S ribosomal protein L14;
    1::122     4e-34  57%  122 aa  RL14_ACIBS RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  56%  122 aa  RL14_UREU1 RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  56%  122 aa  RL14_UREPA RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  56%  122 aa  RL14_UREP2 RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_THETH RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_THET2 RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_THEAQ RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  56%  122 aa  RL14_TERTT RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  58%  122 aa  RL14_RALSO RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  58%  122 aa  RL14_RALPJ RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  55%  122 aa  RL14_ERYLH RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  70%  122 aa  RL14_DESMR RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  57%  122 aa  RL14_DEHE1 RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_CAMJR RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_CAMJJ RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_CAMJE RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_CAMJD RecName: Full=50S ribosomal protein L14;
    1::122     5e-34  68%  122 aa  RL14_CAMJ8 RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  68%  122 aa  RL14_THET8 RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  59%  122 aa  RL14_RALEH RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  57%  122 aa  RL14_DESAA RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  59%  122 aa  RL14_CUPTR RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  68%  122 aa  RL14_CAMLR RecName: Full=50S ribosomal protein L14;
    1::122     7e-34  54%  122 aa  RK14_STIHE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     9e-34  57%  122 aa  RL14_XANCP RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_XANCB RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_XANC8 RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_XANC5 RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_XANAC RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  58%  122 aa  RL14_RALME RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  58%  122 aa  RL14_RALEJ RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_PSEU5 RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  57%  122 aa  RL14_PSEHT RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  54%  122 aa  RL14_MYCA5 RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  55%  122 aa  RL14_FUSNN RecName: Full=50S ribosomal protein L14;
    1::122     9e-34  70%  122 aa  RL14_DESAP RecName: Full=50S ribosomal protein L14;
    1::121     2e-33  57%  122 aa  RL14_KOSOT RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  57%  122 aa  RL14_AZOSB RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  55%  122 aa  RL14_ACIF5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  55%  122 aa  RL14_ACIF2 RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  56%  122 aa  RL14_PSYWF RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  57%  122 aa  RL14_POLSQ RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  55%  122 aa  RL14_MARAV RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  56%  122 aa  RL14_GLUDA RecName: Full=50S ribosomal protein L14;
    1::122     2e-33  57%  122 aa  RL14_AZOSE RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  56%  122 aa  RL14_PELPD RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_METS4 RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_HERAR RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  68%  122 aa  RL14_GEOUR RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  68%  122 aa  RL14_GEOSF RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_DESVV RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_DESVH RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  56%  122 aa  RL14_DEHSC RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  56%  122 aa  RL14_DEHSB RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_CELJU RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  57%  122 aa  RL14_CAMFF RecName: Full=50S ribosomal protein L14;
    1::122     3e-33  54%  122 aa  RK14_CHLAT RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-33  57%  122 aa  RL14_SACD2 RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_PSEAE RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_PSEAB RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_PSEA8 RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_PSEA7 RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_METFK RecName: Full=50S ribosomal protein L14;
    1::121     4e-33  55%  122 aa  RL14_FERNB RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_DESDG RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  57%  122 aa  RL14_CAMC1 RecName: Full=50S ribosomal protein L14;
    1::122     4e-33  56%  122 aa  RK14_MESVI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-33  56%  122 aa  RK14_CHLRE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     5e-33  56%  122 aa  RL14_XYLFM RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  56%  122 aa  RL14_XYLFA RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  57%  122 aa  RL14_PSEF5 RecName: Full=50S ribosomal protein L14;
    1::121     5e-33  57%  121 aa  RL14_PROMS RecName: Full=50S ribosomal protein L14;
    1::121     5e-33  57%  121 aa  RL14_PROM9 RecName: Full=50S ribosomal protein L14;
    1::121     5e-33  57%  121 aa  RL14_PROM2 RecName: Full=50S ribosomal protein L14;
    1::121     5e-33  57%  121 aa  RL14_PROM0 RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  57%  122 aa  RL14_POLNS RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  57%  122 aa  RL14_JANMA RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  55%  122 aa  RL14_GRABC RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  55%  122 aa  RL14_GLUOX RecName: Full=50S ribosomal protein L14;
    1::122     5e-33  57%  122 aa  RK14_CHAVU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-33  55%  122 aa  RL14_XYLFT RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  55%  122 aa  RL14_XYLF2 RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  55%  122 aa  RL14_WOLSU RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  57%  122 aa  RL14_RHISN RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  55%  122 aa  RL14_RHILO RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  57%  122 aa  RL14_PSYIN RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  57%  122 aa  RL14_PSEMY RecName: Full=50S ribosomal protein L14;
    1::121     6e-33  55%  121 aa  RL14_PROMP RecName: Full=50S ribosomal protein L14;
    1::121     6e-33  55%  121 aa  RL14_PROM5 RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  55%  122 aa  RL14_NOVAD RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  70%  122 aa  RL14_MESFL RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  57%  122 aa  RL14_GEOMG RecName: Full=50S ribosomal protein L14;
    1::122     6e-33  65%  122 aa  RL14_BDEBA RecName: Full=50S ribosomal protein L14;
    1::121     8e-33  55%  122 aa  RL14_THEM4 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  56%  122 aa  RL14_RHILW RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  56%  122 aa  RL14_RHIEC RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  56%  122 aa  RL14_RHIE6 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEU2 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSESM RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEPK RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEPG RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEPF RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEP1 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSEFS RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PSE14 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_PARL1 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_MYCMS RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_MYCCT RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  55%  122 aa  RL14_MAGSM RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  66%  122 aa  RL14_IDILO RecName: Full=50S ribosomal protein L14;
    1::123     8e-33  57%  123 aa  RL14_HAMD5 RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  52%  122 aa  RL14_FLAPJ RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  57%  122 aa  RL14_ALTMD RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  56%  122 aa  RL14_AGRRK RecName: Full=50S ribosomal protein L14;
    1::122     8e-33  54%  122 aa  RK14_STAPU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     8e-33  55%  122 aa  RK14_MARPO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-32  57%  122 aa  RL14_XANOR RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_XANOP RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_XANOM RecName: Full=50S ribosomal protein L14;
    1::123     1e-32  55%  123 aa  RL14_TROWT RecName: Full=50S ribosomal protein L14;
    1::123     1e-32  55%  123 aa  RL14_TROW8 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  65%  122 aa  RL14_TRIEI RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  56%  122 aa  RL14_SALRD RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_PSEPW RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_PSEE4 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_NAUPA RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  57%  122 aa  RL14_DESDA RecName: Full=50S ribosomal protein L14;
    1::121     1e-32  58%  121 aa  RK14_PAUCH RecName: Full=50S ribosomal protein L14, organellar
    1::122     1e-32  55%  122 aa  RL14_OCHA4 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_METCA RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_MESSB RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUSU RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUSI RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUO2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUME RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUMB RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUC2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUAB RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUA2 RecName: Full=50S ribosomal protein L14;
    1::122     1e-32  55%  122 aa  RL14_BRUA1 RecName: Full=50S ribosomal protein L14;
    1::121     1e-32  55%  121 aa  RK14_ODOSI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-32  54%  122 aa  RK14_LEPTE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     1e-32  56%  121 aa  RK14_GUITH RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     2e-32  54%  122 aa  RL14_THESQ RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  54%  122 aa  RL14_THEP1 RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  55%  122 aa  RL14_THENN RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  56%  121 aa  RL14_SYNR3 RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  57%  122 aa  RL14_SORC5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  56%  122 aa  RL14_METPB RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  56%  122 aa  RL14_METEP RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  64%  122 aa  RL14_GEOSL RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  56%  122 aa  RL14_DICNV RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  56%  122 aa  RL14_AZOC5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  52%  122 aa  RK14_ZYGCR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     2e-32  55%  121 aa  RK14_RHDSA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-32  56%  123 aa  RL14_VIBFM RecName: Full=50S ribosomal protein L14;
    1::123     2e-32  56%  123 aa  RL14_VIBF1 RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  54%  122 aa  RL14_THERP RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  54%  122 aa  RL14_THEMA RecName: Full=50S ribosomal protein L14;
    1::121     2e-32  53%  122 aa  RL14_THEAB RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  53%  122 aa  RL14_SYNJA RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  55%  122 aa  RL14_CAMC5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-32  55%  122 aa  RL14_BUCAP RecName: Full=50S ribosomal protein L14;
    1::119     2e-32  53%  119 aa  RK14_CYAME RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     3e-32  56%  123 aa  RL14_YERPY RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPS RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPP RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPN RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPG RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPE RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPB RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERPA RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERP3 RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  56%  123 aa  RL14_YERE8 RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  56%  122 aa  RL14_VEREI RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  54%  122 aa  RL14_TOLAT RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  56%  122 aa  RL14_THICR RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  51%  122 aa  RL14_THELT RecName: Full=50S ribosomal protein L14;
    1::121     3e-32  57%  121 aa  RL14_SYNS3 RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  55%  122 aa  RL14_METRJ RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  54%  122 aa  RL14_LARHH RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  54%  122 aa  RL14_GEOLS RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  55%  123 aa  RL14_BUCAK RecName: Full=50S ribosomal protein L14;
    1::123     3e-32  55%  123 aa  RL14_ALISL RecName: Full=50S ribosomal protein L14;
    1::122     3e-32  56%  122 aa  RK14_PHYPA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-32  56%  122 aa  RK14_CHAGL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-32  54%  122 aa  RL14_VARPS RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_SPHAL RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHESW RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHESR RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHESM RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEPC RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEON RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEB9 RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEB8 RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEB5 RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  57%  122 aa  RL14_SHEB2 RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALTY RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALTI RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALSV RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALPK RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALPB RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALPA RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALNS RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALHS RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALG2 RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALEP RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALDC RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALCH RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALAR RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_SALA4 RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_PECCP RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  66%  122 aa  RL14_HELHP RecName: Full=50S ribosomal protein L14;
    1::123     4e-32  55%  123 aa  RL14_ERWCT RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  56%  122 aa  RL14_DIAST RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_CHLTR RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_CHLTB RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_CHLTA RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_CHLT2 RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  52%  122 aa  RL14_BAUCH RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  56%  122 aa  RL14_ACISJ RecName: Full=50S ribosomal protein L14;
    1::122     4e-32  55%  122 aa  RL14_ACICJ RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  56%  122 aa  RL14_SINMW RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_SILST RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_SILPO RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  57%  122 aa  RL14_SHESA RecName: Full=50S ribosomal protein L14;
    1::123     5e-32  55%  123 aa  RL14_SERP5 RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  54%  122 aa  RL14_RHOFD RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  56%  122 aa  RL14_RHIME RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  61%  122 aa  RL14_PARUW RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIMF RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIMB RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIMA RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIM0 RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIG2 RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_NEIG1 RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  54%  122 aa  RL14_JANSC RecName: Full=50S ribosomal protein L14;
    1::123     5e-32  57%  123 aa  RL14_HAEDU RecName: Full=50S ribosomal protein L14;
    1::120     5e-32  57%  120 aa  RL14_DICT6 RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_DELAS RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  57%  122 aa  RL14_CAMHC RecName: Full=50S ribosomal protein L14;
    1::122     5e-32  55%  122 aa  RL14_AGRT5 RecName: Full=50S ribosomal protein L14;
    1::123     5e-32  57%  123 aa  RL14_ACTPJ RecName: Full=50S ribosomal protein L14;
    1::123     5e-32  57%  123 aa  RL14_ACTP7 RecName: Full=50S ribosomal protein L14;
    1::121     5e-32  54%  121 aa  RK14_SCEOB RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     7e-32  55%  123 aa  RL14_VIBHB RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_SYNJB RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_STRMK RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_STRM5 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  57%  122 aa  RL14_SHEAM RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_ROSDO RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  54%  122 aa  RL14_RHORT RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_RHOPS RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_RHOP5 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_RHOP2 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_RHIL3 RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_PASMU RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_MYCHJ RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_MYCH7 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  52%  122 aa  RL14_MYCH2 RecName: Full=50S ribosomal protein L14;
    1::130     7e-32  54%  130 aa  RL14_LEPBP RecName: Full=50S ribosomal protein L14;
    1::130     7e-32  54%  130 aa  RL14_LEPBA RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  55%  123 aa  RL14_KLEP7 RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_HAEIN RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_HAEIG RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_HAEIE RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_HAEI8 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_DINSH RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  55%  123 aa  RL14_CITK8 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  54%  122 aa  RL14_CHRVO RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_BUCBP RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  54%  122 aa  RL14_BUCAT RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  54%  122 aa  RL14_BUCAI RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  54%  122 aa  RL14_BUCA5 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_BART1 RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_BARQU RecName: Full=50S ribosomal protein L14;
    1::122     7e-32  55%  122 aa  RL14_ARCB4 RecName: Full=50S ribosomal protein L14;
    1::123     7e-32  57%  123 aa  RL14_ACTSZ RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  56%  122 aa  RL14_TREPS RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  56%  122 aa  RL14_TREPA RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  53%  122 aa  RL14_SYNAS RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHISS RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHIFL RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHIF8 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHIDS RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHIBS RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_SHIB3 RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  55%  122 aa  RL14_NITEU RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  55%  122 aa  RL14_NITEC RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  66%  122 aa  RL14_GEOSM RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  66%  122 aa  RL14_GEOBB RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ESCF3 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_EDWI9 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOUT RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOSM RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOSE RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOLU RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOLI RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOLC RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOL6 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOK1 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOHS RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECODH RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECOBW RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO8A RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO81 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO7I RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO5E RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO57 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO55 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO45 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO27 RecName: Full=50S ribosomal protein L14;
    1::123     9e-32  54%  123 aa  RL14_ECO24 RecName: Full=50S ribosomal protein L14;
    1::122     9e-32  54%  122 aa  RL14_DECAR RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  55%  123 aa  RL14_VIBVY RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  55%  123 aa  RL14_VIBVU RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  54%  123 aa  RL14_VIBCM RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  54%  123 aa  RL14_VIBCH RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  54%  123 aa  RL14_VIBC3 RecName: Full=50S ribosomal protein L14;
    1::121     1e-31  56%  121 aa  RL14_PARD8 RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  54%  122 aa  RL14_NOSP7 RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  56%  123 aa  RL14_HAES2 RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  56%  123 aa  RL14_HAES1 RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  53%  123 aa  RL14_ENTS8 RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  52%  122 aa  RL14_CYAP8 RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  52%  122 aa  RK14_OLTVI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-31  54%  122 aa  RL14_PELCD RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  53%  122 aa  RL14_METPP RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  53%  122 aa  RL14_HALHL RecName: Full=50S ribosomal protein L14;
    1::123     1e-31  54%  123 aa  RL14_ERWT9 RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  52%  122 aa  RL14_CHLAB RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  52%  122 aa  RL14_CAUSK RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  55%  122 aa  RL14_BEII9 RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  55%  122 aa  RL14_BARHE RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  55%  122 aa  RL14_BARBK RecName: Full=50S ribosomal protein L14;
    1::122     1e-31  54%  122 aa  RL14_AGRVS RecName: Full=50S ribosomal protein L14;
    1::123     2e-31  55%  123 aa  RL14_VIBPA RecName: Full=50S ribosomal protein L14;
    1::122     2e-31  52%  122 aa  RL14_VESOH RecName: Full=50S ribosomal protein L14;
    1::123     2e-31  53%  123 aa  RL14_SODGM RecName: Full=50S ribosomal protein L14;
    1::122     2e-31  53%  122 aa  RL14_PHEZH RecName: Full=50S ribosomal protein L14;
    1::123     2e-31  54%  123 aa  RL14_ENT38 RecName: Full=50S ribosomal protein L14;
    1::120     2e-31  55%  120 aa  RL14_DICTD RecName: Full=50S ribosomal protein L14;
    1::122     2e-31  54%  122 aa  RL14_ACIAC RecName: Full=50S ribosomal protein L14;
    1::123     3e-31  53%  123 aa  RL14_PROMH RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  66%  122 aa  RL14_NITSB RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  53%  122 aa  RL14_LEPCP RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  53%  122 aa  RL14_HAHCH RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_FRAP2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  64%  122 aa  RL14_CHLT3 RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_CHLPN RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_CHLMU RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_CHLFF RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_CHLCV RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  53%  122 aa  RL14_ANAVT RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  53%  122 aa  RL14_ANASP RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RK14_LEMMI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-31  53%  122 aa  RL14_THIDA RecName: Full=50S ribosomal protein L14;
    1::121     3e-31  57%  121 aa  RL14_PSEA6 RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  55%  122 aa  RL14_METSB RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  64%  122 aa  RL14_GEMAT RecName: Full=50S ribosomal protein L14;
    1::123     3e-31  53%  123 aa  RL14_ECOL5 RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  52%  122 aa  RL14_CYAP7 RecName: Full=50S ribosomal protein L14;
    1::122     3e-31  53%  122 aa  RL14_BRAJA RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  54%  122 aa  RL14_RHOSK RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  54%  122 aa  RL14_RHOS5 RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  54%  122 aa  RL14_RHOS4 RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  54%  122 aa  RL14_RHOS1 RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  55%  122 aa  RL14_NITMU RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  52%  122 aa  RL14_MYCPE RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  52%  122 aa  RL14_BRASO RecName: Full=50S ribosomal protein L14;
    1::122     4e-31  52%  122 aa  RL14_BRASB RecName: Full=50S ribosomal protein L14;
    1::121     4e-31  53%  121 aa  RK14_OEDCA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     4e-31  55%  121 aa  RK14_EUGGR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-31  52%  122 aa  RL14_RHOPB RecName: Full=50S ribosomal protein L14;
    1::121     6e-31  63%  121 aa  RL14_PROMT RecName: Full=50S ribosomal protein L14;
    1::121     6e-31  63%  121 aa  RL14_PROM1 RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  54%  122 aa  RL14_PARDP RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  56%  122 aa  RL14_MARMS RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATW RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATT RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATO RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATN RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATM RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATH RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRATF RecName: Full=50S ribosomal protein L14;
    1::122     6e-31  53%  122 aa  RL14_FRAT1 RecName: Full=50S ribosomal protein L14;
    1::121     6e-31  56%  121 aa  RL14_AZOPC RecName: Full=50S ribosomal protein L14;
    1::123     7e-31  53%  123 aa  RL14_SPHWW RecName: Full=50S ribosomal protein L14;
    1::121     7e-31  66%  121 aa  RL14_PROM3 RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RL14_POLSJ RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RL14_POLNA RecName: Full=50S ribosomal protein L14;
    1::123     7e-31  55%  123 aa  RL14_PHOPR RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RL14_NITWN RecName: Full=50S ribosomal protein L14;
    1::124     7e-31  56%  124 aa  RL14_MYCGA RecName: Full=50S ribosomal protein L14;
    1::130     7e-31  54%  130 aa  RL14_LEPIN RecName: Full=50S ribosomal protein L14;
    1::130     7e-31  54%  130 aa  RL14_LEPIC RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RL14_CAUCR RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RL14_CAUCN RecName: Full=50S ribosomal protein L14;
    1::122     7e-31  52%  122 aa  RK14_GRATL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     1e-30  54%  123 aa  RL14_ZYMMO RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  52%  122 aa  RL14_THISH RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  64%  122 aa  RL14_RICAH RecName: Full=50S ribosomal protein L14;
    1::121     1e-30  65%  121 aa  RL14_PROMM RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  52%  122 aa  RL14_OLICO RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  52%  122 aa  RL14_NITHX RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  50%  122 aa  RL14_MYCPN RecName: Full=50S ribosomal protein L14;
    1::130     1e-30  54%  130 aa  RL14_LEPBL RecName: Full=50S ribosomal protein L14;
    1::130     1e-30  54%  130 aa  RL14_LEPBJ RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  53%  122 aa  RK14_PIPCE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-30  53%  122 aa  RK14_CYAPA RecName: Full=50S ribosomal protein L14, cyanelle;
    1::122     1e-30  51%  122 aa  RL14_RHOPT RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  51%  122 aa  RL14_RHOPA RecName: Full=50S ribosomal protein L14;AltName:
    1::123     1e-30  52%  123 aa  RL14_PHOLL RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  52%  122 aa  RL14_MICAN RecName: Full=50S ribosomal protein L14;
    1::122     1e-30  51%  122 aa  RK14_GOSHI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-30  51%  122 aa  RK14_GOSBA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     2e-30  65%  121 aa  RL14_SYNPW RecName: Full=50S ribosomal protein L14;
    1::121     2e-30  63%  121 aa  RL14_SYNP6 RecName: Full=50S ribosomal protein L14;
    1::121     2e-30  63%  121 aa  RL14_SYNE7 RecName: Full=50S ribosomal protein L14;
    1::121     2e-30  65%  122 aa  RL14_SULNB RecName: Full=50S ribosomal protein L14;
    1::123     2e-30  54%  123 aa  RL14_CHRSD RecName: Full=50S ribosomal protein L14;
    1::123     2e-30  54%  123 aa  RL14_BLOFL RecName: Full=50S ribosomal protein L14;
    1::121     2e-30  52%  121 aa  RK14_THAPS RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RL14_RUTMC RecName: Full=50S ribosomal protein L14;
    1::134     2e-30  68%  134 aa  RL14_DEIDV RecName: Full=50S ribosomal protein L14;
    1::122     2e-30  60%  122 aa  RL14_BRAHW RecName: Full=50S ribosomal protein L14;
    1::122     2e-30  52%  122 aa  RK14_TOBAC RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_SOLTU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_SOLLC RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_SOLBU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_POPTR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_NICSY RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_EUCGG RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     2e-30  50%  121 aa  RK14_EMIHU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-30  52%  122 aa  RK14_ATRBE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-30  52%  122 aa  RL14_SYNY3 RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_RICM5 RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_RICFE RecName: Full=50S ribosomal protein L14;
    1::121     3e-30  52%  121 aa  RL14_MYCS5 RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELPY RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELPS RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELPJ RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELPH RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELPG RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  63%  122 aa  RL14_HELAH RecName: Full=50S ribosomal protein L14;
    1::134     3e-30  68%  134 aa  RL14_DEIRA RecName: Full=50S ribosomal protein L14;
    1::122     3e-30  51%  122 aa  RK14_POPAL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-30  52%  122 aa  RK14_IPOPU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-30  52%  122 aa  RK14_CUSRE RecName: Full=50S ribosomal protein L14, plastid;
    1::122     3e-30  52%  122 aa  RK14_CERDE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     4e-30  64%  121 aa  RL14_SYNSC RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  61%  122 aa  RL14_RICRS RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  61%  122 aa  RL14_RICRO RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  63%  122 aa  RL14_RICPU RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  63%  122 aa  RL14_RICCN RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  63%  122 aa  RL14_RICCK RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  63%  122 aa  RL14_RICAE RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  52%  122 aa  RL14_CYAA5 RecName: Full=50S ribosomal protein L14;
    1::122     4e-30  61%  122 aa  RK14_PORPU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-30  52%  122 aa  RK14_NICTO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-30  50%  122 aa  RK14_NANDO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-30  51%  122 aa  RK14_LIRTU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-30  52%  122 aa  RK14_FAGEA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-30  52%  122 aa  RK14_CUSEX RecName: Full=50S ribosomal protein L14, plastid;
    1::122     4e-30  52%  122 aa  RK14_COFAR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     5e-30  63%  121 aa  RL14_PROM4 RecName: Full=50S ribosomal protein L14;
    1::122     5e-30  52%  122 aa  RL14_PELUB RecName: Full=50S ribosomal protein L14;
    1::122     5e-30  52%  122 aa  RL14_MAGSA RecName: Full=50S ribosomal protein L14;
    1::122     5e-30  52%  122 aa  RK14_MANES RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     5e-30  51%  122 aa  RK14_ILLOL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     5e-30  51%  122 aa  RK14_DRIGR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     6e-30  64%  121 aa  RL14_SYNS9 RecName: Full=50S ribosomal protein L14;
    1::122     6e-30  51%  122 aa  RL14_SYNP2 RecName: Full=50S ribosomal protein L14;
    1::122     6e-30  52%  122 aa  RL14_RHOCS RecName: Full=50S ribosomal protein L14;
    1::122     6e-30  52%  122 aa  RL14_PELPB RecName: Full=50S ribosomal protein L14;
    1::123     6e-30  53%  123 aa  RL14_BLOPB RecName: Full=50S ribosomal protein L14;
    1::122     6e-30  51%  122 aa  RK14_PINTH RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_PINKO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     6e-30  60%  121 aa  RK14_PHATR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_LACSA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_HELAN RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_GUIAB RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  52%  122 aa  RK14_DAUCA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_CITSI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_CALFG RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  51%  122 aa  RK14_ANGEV RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-30  60%  122 aa  RK14_ADICA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     8e-30  62%  121 aa  RL14_PROMA RecName: Full=50S ribosomal protein L14;
    1::121     8e-30  63%  130 aa  RL14_HELP2 RecName: Full=50S ribosomal protein L14;
    1::134     8e-30  66%  134 aa  RL14_DEIGD RecName: Full=50S ribosomal protein L14;
    1::122     8e-30  51%  122 aa  RK14_PANGI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     8e-30  50%  122 aa  RK14_MORIN RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     8e-30  50%  122 aa  RK14_ANEMR RecName: Full=50S ribosomal protein L14, plastid;
    1::122     1e-29  51%  122 aa  RL14_THEYD RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  66%  122 aa  RL14_MARMM RecName: Full=50S ribosomal protein L14;
    1::121     1e-29  52%  121 aa  RL14_LEGPL RecName: Full=50S ribosomal protein L14;
    1::121     1e-29  52%  121 aa  RL14_LEGPH RecName: Full=50S ribosomal protein L14;
    1::121     1e-29  52%  121 aa  RL14_LEGPA RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  53%  122 aa  RL14_BORPE RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  53%  122 aa  RL14_BORPD RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  53%  122 aa  RL14_BORPA RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  53%  122 aa  RL14_BORBR RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  53%  122 aa  RL14_BORA1 RecName: Full=50S ribosomal protein L14;
    1::121     1e-29  62%  121 aa  RK14_NEPOL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-29  51%  122 aa  RK14_CUCSA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-29  51%  122 aa  RK14_ACOCL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     1e-29  53%  123 aa  RL14_WIGBR RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  48%  122 aa  RL14_BORT9 RecName: Full=50S ribosomal protein L14;
    1::122     1e-29  61%  122 aa  RK14_PORYE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-29  50%  122 aa  RK14_NYMAL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-29  50%  122 aa  RK14_CHLSC RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::120     2e-29  57%  120 aa  RL14_ONYPE RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  49%  122 aa  RL14_BORBZ RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  49%  122 aa  RL14_BORBU RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  49%  122 aa  RL14_BORAP RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  50%  122 aa  RK14_PLAOC RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-29  52%  122 aa  RK14_CUSGR RecName: Full=50S ribosomal protein L14, plastid;
    1::122     2e-29  51%  122 aa  RK14_CARPA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     2e-29  52%  121 aa  RL14_LEGPC RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  49%  122 aa  RL14_BORGA RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  54%  122 aa  RL14_AMOA5 RecName: Full=50S ribosomal protein L14;
    1::122     2e-29  50%  122 aa  RK14_BUXMI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  61%  122 aa  RL14_RICBR RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  61%  122 aa  RL14_RICB8 RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  60%  122 aa  RL14_CHLCH RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  48%  122 aa  RL14_BORRA RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  48%  122 aa  RL14_BORDL RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  52%  122 aa  RL14_AERS4 RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  52%  122 aa  RL14_AERHH RecName: Full=50S ribosomal protein L14;
    1::122     3e-29  50%  122 aa  RK14_OLIPU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  51%  122 aa  RK14_OENPA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  51%  122 aa  RK14_OENGL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  51%  122 aa  RK14_OENEH RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  51%  122 aa  RK14_OENBI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  51%  122 aa  RK14_OENAR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_NASOF RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_LOBMA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_LEPVR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_DRANE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_CRUWA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_BARVE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_ARATH RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_ARAHI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_AETGR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-29  50%  122 aa  RK14_AETCO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-29  61%  122 aa  RL14_SULDN RecName: Full=50S ribosomal protein L14;
    1::122     4e-29  61%  122 aa  RL14_RICTY RecName: Full=50S ribosomal protein L14;
    1::122     4e-29  61%  122 aa  RL14_RICPR RecName: Full=50S ribosomal protein L14;
    1::122     4e-29  48%  122 aa  RL14_MYCGE RecName: Full=50S ribosomal protein L14;
    1::122     4e-29  48%  122 aa  RL14_BORHD RecName: Full=50S ribosomal protein L14;
    1::122     4e-29  51%  122 aa  RK14_VITVI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-29  52%  122 aa  RK14_SOYBN RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::119     4e-29  51%  119 aa  RK14_OSTTA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-29  52%  122 aa  RK14_CUSOB RecName: Full=50S ribosomal protein L14, plastid;
    1::121     7e-29  48%  122 aa  RL14_PETMO RecName: Full=50S ribosomal protein L14;
    1::122     7e-29  55%  122 aa  RL14_COLP3 RecName: Full=50S ribosomal protein L14;
    1::122     9e-29  61%  122 aa  RL14_CHLP8 RecName: Full=50S ribosomal protein L14;
    1::122     9e-29  49%  122 aa  RK14_DIOEL RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     9e-29  49%  122 aa  RK14_CAPBU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-28  52%  122 aa  RK14_PHAVU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-28  52%  122 aa  RK14_CICAR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-28  53%  122 aa  RL14_SHEFN RecName: Full=50S ribosomal protein L14;
    1::122     2e-28  54%  122 aa  RL14_ELUMP RecName: Full=50S ribosomal protein L14;
    1::122     2e-28  49%  122 aa  RL14_COPPD RecName: Full=50S ribosomal protein L14;
    1::122     2e-28  53%  122 aa  RL14_ALHEH RecName: Full=50S ribosomal protein L14;
    1::122     2e-28  58%  122 aa  RL14_UNCTG RecName: Full=50S ribosomal protein L14;
    1::122     2e-28  53%  122 aa  RL14_SHESH RecName: Full=50S ribosomal protein L14;
    1::121     2e-28  52%  121 aa  RK14_SPIOL RecName: Full=50S ribosomal protein L14,
    1::122     3e-28  52%  122 aa  RL14_SHEPW RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  52%  122 aa  RL14_SHEPA RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  52%  122 aa  RL14_SHELP RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  52%  122 aa  RL14_SHEHH RecName: Full=50S ribosomal protein L14;
    1::133     3e-28  58%  133 aa  RL14_GLOVI RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  52%  122 aa  RK14_HUPLU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     3e-28  53%  122 aa  RL14_SHEWM RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  53%  122 aa  RL14_SHEDO RecName: Full=50S ribosomal protein L14;
    1::122     3e-28  49%  122 aa  RK14_PHAAO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     4e-28  60%  122 aa  RL14_HYPNA RecName: Full=50S ribosomal protein L14;
    1::122     4e-28  49%  122 aa  RK14_LOTJA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-28  50%  122 aa  RL14_ORITI RecName: Full=50S ribosomal protein L14;
    1::122     6e-28  47%  122 aa  RK14_WELMI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     6e-28  49%  122 aa  RK14_ANTFO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     6e-28  50%  122 aa  RK14_AMBTC RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-27  51%  122 aa  RL14_NITOC RecName: Full=50S ribosomal protein L14;
    1::121     4e-27  52%  121 aa  RL14_OPITP RecName: Full=50S ribosomal protein L14;
    1::121     4e-27  60%  121 aa  RK14_CYACA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     5e-27  62%  121 aa  RL14_AKKM8 RecName: Full=50S ribosomal protein L14;
    1::122     6e-27  48%  122 aa  RL14_ORITB RecName: Full=50S ribosomal protein L14;
    1::123     8e-27  63%  123 aa  RL14_BUCCC RecName: Full=50S ribosomal protein L14;
    1::123     8e-27  48%  123 aa  RK14_SORBI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::120     1e-26  58%  120 aa  RL14_AYWBP RecName: Full=50S ribosomal protein L14;
    1::122     1e-26  50%  122 aa  RL14_ACAM1 RecName: Full=50S ribosomal protein L14;
    1::122     1e-26  48%  122 aa  RK14_CYCTA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::121     1e-26  48%  121 aa  RL14_AQUAE RecName: Full=50S ribosomal protein L14;
    1::120     1e-26  49%  122 aa  RK14_PSINU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::120     2e-26  53%  120 aa  RL14_SULMW RecName: Full=50S ribosomal protein L14;
    1::123     2e-26  48%  123 aa  RK14_SACOF RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-26  48%  123 aa  RK14_SACHY RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-26  49%  123 aa  RK14_ORYSJ RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-26  49%  123 aa  RK14_ORYSI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-26  49%  123 aa  RK14_ORYSA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-26  49%  123 aa  RK14_ORYNI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-26  57%  122 aa  RL14_SULSY RecName: Full=50S ribosomal protein L14;
    1::122     3e-26  48%  122 aa  RL14_COXBU RecName: Full=50S ribosomal protein L14;
    1::122     3e-26  48%  122 aa  RL14_COXBR RecName: Full=50S ribosomal protein L14;
    1::122     3e-26  48%  122 aa  RL14_COXBN RecName: Full=50S ribosomal protein L14;
    1::122     3e-26  48%  122 aa  RL14_COXB2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-26  48%  122 aa  RL14_COXB1 RecName: Full=50S ribosomal protein L14;
    1::122     4e-26  59%  122 aa  RL14_CHLPD RecName: Full=50S ribosomal protein L14;
    1::123     4e-26  48%  123 aa  RK14_MAIZE RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     5e-26  60%  122 aa  RL14_CHLPB RecName: Full=50S ribosomal protein L14;
    1::123     5e-26  48%  123 aa  RK14_LOLPR RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     5e-26  48%  123 aa  RK14_HORVU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     5e-26  48%  123 aa  RK14_AGRST RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     7e-26  44%  122 aa  RK14_JASNU RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     9e-26  56%  122 aa  RM14_RECAM RecName: Full=60S ribosomal protein L14, mitochondrial;
    1::122     1e-25  58%  122 aa  RL14_PROVI RecName: Full=50S ribosomal protein L14;
    1::122     1e-25  58%  122 aa  RL14_PELLD RecName: Full=50S ribosomal protein L14;
    1::121     1e-25  47%  121 aa  RL14_AQUPY RecName: Full=50S ribosomal protein L14;
    1::123     1e-25  48%  123 aa  RK14_WHEAT RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::123     2e-25  48%  123 aa  RK14_BRADI RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     2e-25  58%  122 aa  RL14_CHLL2 RecName: Full=50S ribosomal protein L14;
    1::121     3e-25  56%  121 aa  RL14_PORGI RecName: Full=50S ribosomal protein L14;
    1::121     3e-25  56%  121 aa  RL14_PORG3 RecName: Full=50S ribosomal protein L14;
    1::122     6e-25  59%  122 aa  RL14_CHLTE RecName: Full=50S ribosomal protein L14;
    1::121     1e-24  47%  121 aa  RK14_PELHO RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::122     1e-24  59%  122 aa  RL14_PROA2 RecName: Full=50S ribosomal protein L14;
    1::122     3e-24  46%  122 aa  RL14_SOLUE RecName: Full=50S ribosomal protein L14;
    1::119     9e-24  47%  119 aa  RL14_WOLWR RecName: Full=50S ribosomal protein L14;
    1::119     9e-24  47%  119 aa  RL14_WOLPM RecName: Full=50S ribosomal protein L14;
    1::121     1e-23  58%  121 aa  RL14_SYNPX RecName: Full=50S ribosomal protein L14;
    3::123     1e-23  45%  123 aa  RL14_ACIBL RecName: Full=50S ribosomal protein L14;
    1::122     3e-23  47%  122 aa  RK14_HELSJ RecName: Full=50S ribosomal protein L14, plastid;
    1::121     4e-23  52%  121 aa  RL14_BACTN RecName: Full=50S ribosomal protein L14;
    1::121     4e-23  52%  121 aa  RL14_BACFR RecName: Full=50S ribosomal protein L14;
    1::121     4e-23  52%  121 aa  RL14_BACFN RecName: Full=50S ribosomal protein L14;
    1::119     6e-23  47%  119 aa  RL14_WOLTR RecName: Full=50S ribosomal protein L14;
    1::121     7e-23  52%  121 aa  RL14_BACV8 RecName: Full=50S ribosomal protein L14;
    1::126     1e-22  57%  126 aa  RL14_PERMH RecName: Full=50S ribosomal protein L14;
    1::122     1e-22  43%  122 aa  RK14_GNEPA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::120     3e-22  57%  120 aa  RL14_PHYAS RecName: Full=50S ribosomal protein L14;
    1::119     4e-22  46%  119 aa  RL14_ANAPZ RecName: Full=50S ribosomal protein L14;
    1::119     1e-21  46%  119 aa  RL14_ANAMM RecName: Full=50S ribosomal protein L14;
    1::119     1e-21  46%  119 aa  RL14_ANAMF RecName: Full=50S ribosomal protein L14;
    1::119     2e-21  53%  119 aa  RL14_WOLPP RecName: Full=50S ribosomal protein L14;
    1::122     3e-21  39%  122 aa  RL14_CARRP RecName: Full=50S ribosomal protein L14;
    1::122     1e-20  41%  122 aa  RK14_CRYJA RecName: Full=50S ribosomal protein L14, chloroplastic;
    1::119     4e-20  50%  119 aa  RL14_EHRCR RecName: Full=50S ribosomal protein L14;
    1::119     1e-19  50%  119 aa  RL14_EHRCJ RecName: Full=50S ribosomal protein L14;
    1::119     1e-19  50%  119 aa  RL14_EHRRW RecName: Full=50S ribosomal protein L14;
    1::119     1e-19  50%  119 aa  RL14_EHRRG RecName: Full=50S ribosomal protein L14;
    1::122     2e-19  43%  122 aa  RK14_ASTLO RecName: Full=50S ribosomal protein L14, plastid;
    1::92      1e-18  47%  144 aa  RL14_XANP2 RecName: Full=50S ribosomal protein L14;
   18::138     9e-18  41%  138 aa  RL14_SULSO RecName: Full=50S ribosomal protein L14P;
   18::138     9e-18  41%  138 aa  RL14_SULAC RecName: Full=50S ribosomal protein L14P;
   18::138     1e-17  50%  138 aa  RL14_HYPBU RecName: Full=50S ribosomal protein L14P;
   18::134     2e-17  40%  138 aa  RL14_METS5 RecName: Full=50S ribosomal protein L14P;
   21::141     3e-17  38%  141 aa  RL14_SULTO RecName: Full=50S ribosomal protein L14P;
    1::121     3e-17  51%  121 aa  RL14_HYDS0 RecName: Full=50S ribosomal protein L14;
   12::132     4e-17  40%  132 aa  RL14_HALWD RecName: Full=50S ribosomal protein L14P;
    1::126     6e-17  41%  126 aa  RM38_SCHPO RecName: Full=54S ribosomal protein L38, mitochondrial;
   17::136     6e-17  42%  137 aa  RL14_IGNH4 RecName: Full=50S ribosomal protein L14P;
   17::117     3e-16  43%  133 aa  RL14_METKA RecName: Full=50S ribosomal protein L14P;
   16::132     3e-16  42%  132 aa  RL14_ARCFU RecName: Full=50S ribosomal protein L14P;
    1::74      3e-16  65%   74 aa  RK14_OENAM RecName: Full=50S ribosomal protein L14,
   12::128     5e-16  41%  132 aa  RL14_UNCMA RecName: Full=50S ribosomal protein L14P;
   12::132     9e-16  38%  132 aa  RL14_HALMA RecName: Full=50S ribosomal protein L14P;AltName:
   12::128     1e-15  40%  132 aa  RL14_NATPD RecName: Full=50S ribosomal protein L14P;
   20::127     1e-15  38%  140 aa  RL14_STAMF RecName: Full=50S ribosomal protein L14P;
   18::128     6e-15  44%  132 aa  RL14_METTP RecName: Full=50S ribosomal protein L14P;
   12::132     6e-15  36%  132 aa  RL14_METLZ RecName: Full=50S ribosomal protein L14P;
   16::116     6e-15  41%  132 aa  RL14_META3 RecName: Full=50S ribosomal protein L14P;
   12::132     6e-15  39%  132 aa  RL14_HALLT RecName: Full=50S ribosomal protein L14P;
   16::116     1e-14  40%  132 aa  RL14_METJA RecName: Full=50S ribosomal protein L14P;
   16::128     1e-14  39%  132 aa  RL14_METB6 RecName: Full=50S ribosomal protein L14P;
   16::119     2e-14  42%  132 aa  RL14_METST RecName: Full=50S ribosomal protein L14P;
   27::137     3e-14  43%  141 aa  RL14_PYRAB RecName: Full=50S ribosomal protein L14P;
   27::137     4e-14  42%  141 aa  RL14_PYRHO RecName: Full=50S ribosomal protein L14P;
   16::119     4e-14  40%  132 aa  RL14_METTH RecName: Full=50S ribosomal protein L14P;
   27::137     5e-14  41%  141 aa  RL14_PYRFU RecName: Full=50S ribosomal protein L14P;
   16::128     5e-14  42%  132 aa  RL14_METMA RecName: Full=50S ribosomal protein L14P;
   12::119     5e-14  37%  132 aa  RL14_HALSA RecName: Full=50S ribosomal protein L14P;AltName:
   12::119     5e-14  37%  132 aa  RL14_HALS3 RecName: Full=50S ribosomal protein L14P;
   16::128     1e-13  41%  132 aa  RL14_METAC RecName: Full=50S ribosomal protein L14P;
   20::124     2e-13  48%  140 aa  RL14_AERPE RecName: Full=50S ribosomal protein L14P;
   21::116     2e-13  40%  132 aa  RL14_THEVO RecName: Full=50S ribosomal protein L14P;
   16::116     3e-13  38%  132 aa  RL14_THEAC RecName: Full=50S ribosomal protein L14P;
   16::116     3e-13  40%  132 aa  RL14_METVS RecName: Full=50S ribosomal protein L14P;
   16::116     3e-13  40%  132 aa  RL14_METVA RecName: Full=50S ribosomal protein L14P;
   24::125     5e-13  41%  141 aa  RL14_THEPD RecName: Full=50S ribosomal protein L14P;
   18::119     7e-13  41%  132 aa  RL14_METS3 RecName: Full=50S ribosomal protein L14P;
   16::132     7e-13  39%  132 aa  RL14_METBU RecName: Full=50S ribosomal protein L14P;
   16::119     9e-13  40%  132 aa  RL14_METBF RecName: Full=50S ribosomal protein L14P;
    1::117     1e-12  39%  119 aa  RL14_NEOSM RecName: Full=50S ribosomal protein L14;
   25::125     1e-12  34%  141 aa  RL14_KORCO RecName: Full=50S ribosomal protein L14P;
   25::126     2e-12  36%  139 aa  RL23_SCHPO RecName: Full=60S ribosomal protein L23;
   16::117     3e-12  38%  132 aa  RL14_METHJ RecName: Full=50S ribosomal protein L14P;
   16::116     5e-12  37%  132 aa  RL14_METM6 RecName: Full=50S ribosomal protein L14P;
   26::127     6e-12  35%  140 aa  RL23_DANRE RecName: Full=60S ribosomal protein L23;
   16::116     6e-12  37%  132 aa  RL14_METMP RecName: Full=50S ribosomal protein L14P;
   16::116     6e-12  36%  132 aa  RL14_METM7 RecName: Full=50S ribosomal protein L14P;
   26::127     8e-12  35%  140 aa  RL23_RAT RecName: Full=60S ribosomal protein L23;
   26::127     8e-12  35%  140 aa  RL23_PONAB RecName: Full=60S ribosomal protein L23;
   26::127     8e-12  35%  140 aa  RL23_PIG RecName: Full=60S ribosomal protein L23;AltName:
   26::127     8e-12  35%  140 aa  RL23_MOUSE RecName: Full=60S ribosomal protein L23;
   26::127     8e-12  35%  140 aa  RL23_ICTPU RecName: Full=60S ribosomal protein L23;
   26::127     8e-12  35%  140 aa  RL23_HUMAN RecName: Full=60S ribosomal protein L23;AltName:
   26::127     8e-12  35%  140 aa  RL23_BOVIN RecName: Full=60S ribosomal protein L23;
   16::116     8e-12  37%  132 aa  RL14_METM5 RecName: Full=50S ribosomal protein L14P;
   26::127     1e-11  36%  140 aa  RL23_CAEEL RecName: Full=60S ribosomal protein L23;
   22::128     1e-11  37%  144 aa  RL14_PYRAR RecName: Full=50S ribosomal protein L14P;
   26::127     1e-11  38%  140 aa  RL23_DROME RecName: Full=60S ribosomal protein L23;AltName:
   26::128     1e-11  37%  144 aa  RL14_PYRIL RecName: Full=50S ribosomal protein L14P;
   16::132     1e-11  35%  132 aa  RL14_METMJ RecName: Full=50S ribosomal protein L14P;
   23::124     2e-11  36%  137 aa  RL23_YEAST RecName: Full=60S ribosomal protein L23;AltName:
   26::133     2e-11  40%  146 aa  RL23_ENCCU RecName: Full=60S ribosomal protein L23;
   26::127     2e-11  37%  140 aa  RL23_AEDAE RecName: Full=60S ribosomal protein L23;AltName:
   22::128     2e-11  36%  144 aa  RL14_PYRCJ RecName: Full=50S ribosomal protein L14P;
   22::128     2e-11  36%  144 aa  RL14_PYRAE RecName: Full=50S ribosomal protein L14P;
   26::127     3e-11  35%  140 aa  RL23_CANFA RecName: Full=60S ribosomal protein L23;
   22::116     3e-11  37%  132 aa  RL14_PICTO RecName: Full=50S ribosomal protein L14P;
   26::127     5e-11  37%  140 aa  RL23_BRUMA RecName: Full=60S ribosomal protein L23;
    1::46      5e-11  61%   47 aa  RK14_VIGUN RecName: Full=50S ribosomal protein L14,
   26::127     1e-10  33%  140 aa  RL23_TOBAC RecName: Full=60S ribosomal protein L23;
   27::116     1e-10  55%  141 aa  RL14_PYRKO RecName: Full=50S ribosomal protein L14P;
   26::123     2e-10  39%  136 aa  RL23_DICDI RecName: Full=60S ribosomal protein L23;
   29::127     2e-10  34%  140 aa  RL23_ARATH RecName: Full=60S ribosomal protein L23;AltName:
    1::112     4e-10  29%  119 aa  RM14_TETPY RecName: Full=60S ribosomal protein L14, mitochondrial;
   28::141     4e-10  34%  141 aa  RL23_TRYCR RecName: Full=60S ribosomal protein L23;AltName:
   18::120     4e-10  36%  133 aa  RL14_NANEQ RecName: Full=50S ribosomal protein L14P;
    1::112     7e-10  27%  119 aa  RM14_PARTE RecName: Full=60S ribosomal protein L14, mitochondrial;
    1::138     4e-09  37%  138 aa  RM38_YEAST RecName: Full=54S ribosomal protein L38,
   29::140     5e-09  35%  140 aa  RL14_NITMS RecName: Full=50S ribosomal protein L14P;
   28::144     1e-08  33%  144 aa  RL14_CENSY RecName: Full=50S ribosomal protein L14P;
   29::126     4e-08  33%  139 aa  RL23_TORRU RecName: Full=60S ribosomal protein L23;AltName:
    1::101     4e-08  29%  121 aa  RK14_EIMTE RecName: Full=50S ribosomal protein L14, apicoplast;
    1::129     7e-08  37%  129 aa  RM14_DICDI RecName: Full=60S ribosomal protein L14, mitochondrial;
    1::129     9e-08  41%  129 aa  RM14_ACACA RecName: Full=60S ribosomal protein L14, mitochondrial;
   94::144     3e-07  39%  144 aa  RL14_CALMQ RecName: Full=50S ribosomal protein L14P;
    1::99      3e-05  28%  121 aa  RK14_TOXGO RecName: Full=50S ribosomal protein L14, apicoplast;
   89::141     7e-05  43%  145 aa  RM14_RAT RecName: Full=39S ribosomal protein L14, mitochondrial;   
   89::141     7e-05  43%  145 aa  RM14_MOUSE RecName: Full=39S ribosomal protein L14, mitochondrial; 
   89::141     2e-04  41%  145 aa  RM14_BOVIN RecName: Full=39S ribosomal protein L14, mitochondrial; 
   99::141     5e-04  39%  145 aa  RM14_HUMAN RecName: Full=39S ribosomal protein L14, mitochondrial; 
   95::137     5e-04  39%  141 aa  RM14_DANRE RecName: Full=39S ribosomal protein L14, mitochondrial; 
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
RL14_LACS1      MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
RL14_LACF3      MIQQESRLKVADNSGAREILVIKILGGSRVKTGNIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKHGLH
RL14_LACRJ      MIQQESRLKVADNSGAREILVIKILGGSRVKTGNIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKHGIH
RL14_LACRD      MIQQESRLKVADNSGAREILVIKILGGSRVKTGNIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKHGIH
RL14_BACHK      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACCZ      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACCR      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACCQ      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC7      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC4      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC3      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC2      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC1      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACC0      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACAN      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACAH      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACAC      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACAA      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LACCB      MIQQESRLKVADNSGAREILVIKVLGGSYRKTGNIGDVVVATVKQATPGGXXXXXXXXXXXXXRTKSGAR
RL14_LACC3      MIQQESRLKVADNSGAREILVIKVLGGSYRKTGNIGDVVVATVKQATPGGXXXXXXXXXXXXXRTKSGAR
RL14_BACCN      MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_PEDPA      MIQQESRLKVADNSGARELLVIKVLGGSRVKFGYIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKQGAH
RL14_LACPL      MIQQESRLKVADNSGAREILTIKVLGGSGRKTANIGDVIVATVKQATPGGVVKAHDVVKAVIVRTKSGVH
RL14_ENTFA      MIQQESRLRVADNSGAREILTIKVLGGSGRKTANIGDVIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACWK      MIQQESRLKVADNSGARELLTIKVLGGSGRKYAYIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LACSS      MIQSESRLKVADNSGAREILTIKVLGGSGRKTANIGDVIVATIKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISW6      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISMO      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISMH      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISMF      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISMC      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LISIN      MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRMU      MIQSESRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_MACCJ      MIQQESRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STRSY      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRS7      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRS2      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPZ      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPM      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPG      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPF      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPD      MIQQETRLKVADNSGAREILTIKVLGGSGHKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPC      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRPB      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRP8      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRP6      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRP3      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRP1      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STREM      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRE4      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRA5      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRA3      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRA1      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRSV      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRGC      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STAAW      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAT      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAS      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAR      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAN      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAM      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAE      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAC      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAAB      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAA9      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAA8      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAA3      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAA2      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STAA1      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXRTKSGVR
RL14_LACJO      MIQHESRLKVADNSGARELLVIKILGGSKRKTGNIGDIVVAAVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LACGA      MIQHESRLKVADNSGARELLVIKILGGSKRKTGNIGDIVVAAVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_OCEIH      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPXXXXXXXXXXXXXXXRSKSGAR
RL14_LACDB      MIQTETRLKVADNSGARELLVIRVMGGSKRKTGNIGDIVVAAVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACP2      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRTD      MIQQESRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVATVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRT2      MIQQESRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVATVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_STRT1      MIQQESRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVATVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_BACSU      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACHD      MIQQESRLKVADNSGARELLCIKVLGGSGRKTANIGDVIVCSVKQATPXXXXXXXXXXXXXXXRSKSGVR
RL14_BACA2      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGGVVKKGEVVRAVIVRTKSGAR
RL14_STRZT      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRZP      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRZJ      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRR6      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRPS      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRPN      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRPJ      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRPI      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRP7      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRP4      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_STRP2      MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LACAC      MIQNESRLKVADNSGARELLVIRVLGGSKRKTGNIGDIVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LYSSC      MILQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDIVVCTVKKATPXXXXXXXXXXXXXXXRTKSGVR
RL14_STRU0      MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPXXXXXXXXXXXXXXXRTKTGAR
RL14_OENOB      MIQQESRLKVADNSGAREILTIKVLGGSGRKFANIGDMIVATVKQAIPGGTVKKGDVVKAVIVRTVSGVH
RL14_LACH4      MIQNESRLKVADNSGARELLVIRVLGGSKRKTGNIGDIVVCTVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_LACDA      MIQTETRLKVADNSGARELLVIRVMGGSKRKTGNIGDIVVAAVKQATPXXXXXXXXXXXXXXXRTKSGAR
RL14_BACSK      MIQQESRLKVADNSGAREVLCIKVLGGSGRKIANIGDVIVCSVKEATPXXXXXXXXXXXXXXXRSKSGVR
RL14_STAES      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDIIVCTVKNATPXXXXXXXXXXXXXXXXXXXXXR
RL14_STAEQ      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDIIVCTVKNATPXXXXXXXXXXXXXXXXXXXXXR
RL14_STAHJ      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXXXXXXXR
RL14_BACLD      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPXXXXXXXXXXXXXXXXXXXXXX
RL14_STACT      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPXXXXXXXXXXXXXXXXXXXXXR
RL14_EXISA      MIQQESRLKVADNSGARELLTIKVLGGSGRKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXXXXXXXX
RL14_STAS1      MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVVSVKNATPXXXXXXXXXXXXXXXXXXXXXR
RL14_CLOD6      MIQQESRLRVADNSGAKELLCIRVLGGSKRRYGNIGDVIVATVKSATPXXXXXXXXXXXAVIVRSKQGVR
RL14_CLOCE      MIQVQSRMKVADNTGAKELMCIKVLGGSWRKYANIGDVVVASVKNATPXXXXXXXXXXXXXXXRSKKGVR
RL14_EXIS2      MIQQESRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPXXXXXXXXXXXXXXXXXXXXXX
RL14_CORDI      MIQQESRLRVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEATPGGNVKAGEVVKAVIVRAKKETR
RL14_CORK4      MIQQESRLRVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEATPGGNVKAGDIVKAVIVRAKKETR
RL14_GEOKA      MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_BACST      MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_LACLS      MIQTESRLKVADNSGAKELLTIRVLGGSSRKFAGIGDIVVATVKSXXXXXXXXXXXXXXXXIVRTKSGAK
RL14_LACLM      MIQTESRLKVADNSGAKELLTIRVLGGSSRKFAGIGDIVVATVKSXXXXXXXXXXXXXXXXIVRTKSGAK
RL14_LACLA      MIQTESRLKVADNSGAKELLTIRVLGGSSRKFAGIGDIVVATVKSXXXXXXXXXXXXXXXXIVRTKSGAK
RL14_LEUMM      MIQQESRLKVADNSGAREILTIKVLGGSGRKFAGVGDMIVATVKQAIPGGNVKKGDVIKAVIVRTVSDVR
RL14_LEUCK      MIQQESRLKVADNSGAREILTIKVLGGSGRKFAGVGDMIVATVKQAIPGGNVKKGDVVKAVIVRTVSDVR
RL14_CORGL      MIQQESRLKVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEATPGGNVKSGEIVKAVIVRTKKETR
RL14_CORGB      MIQQESRLKVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEATPGGNVKSGEIVKAVIVRTKKETR
RL14_GEOSW      MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKEATPXXXXXXXXXXXXXXXXXXXXXX
RL14_LACBA      MIQQESRLKVADNSGAREILTIKVLGGSKRRYAGIGDIIVATVKQATPGGXXXXXXXXXXXXXXXXXXXX
RL14_CORA7      MIQQESRLRVADNSGARELLVIRVLGGSVRRFAGIGDIVVATVKEAIPGGNVKEGDIVKAVIVRAKKETR
RL14_CLOTH      MIQVQTMLKVADNTGAKKVMCIKVLGGSKRKYANIGDVIVASVKDATPGGVVKKGDVVRCVIVRSKRGIR
RL14_CALS8      MIQPQSRLKVADNTGAKEVMCIRVLGGSNRKFANIGDIIVCSVKDATPXXXXXXXXXXXXXXXRTRKGIR
RL14_GEOTN      MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_CORU7      MLQQESRVRVADNSGAREILVIRVLGGSVKRSAGIGDVVVATVKEAAPGGTVKENEIVRAVIVRTKKPTR
RL14_CLOBM      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOBL      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOBK      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOBJ      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOBH      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOB6      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_CLOB1      MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVKGLR
RL14_COREF      MIQQESRLKIADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKEAAPGGNVKSGEIVKAVIVRTKKETR
RL14_CLOK5      MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKWGNIGDIIVASVKSATPXXXXXXXXXXXXXXXRSARGLR
RL14_HELMI      MIQQETRLRVGDNTGAKELLCIRVLGGSYRRYASVGDIIVASVKEATPXXXXXXXXXXXXXXXRTRKPIK
RL14_CLAMS      MIQQESRLKIADNTGAKEILTIRVLGGSGRRYAGLGDVIVATVKDAIPGGNVKKGEVVKAVIVRTKKETR
RL14_CLAM3      MIQQESRLKIADNTGAKEILTIRVLGGSGRRYAGLGDVIVATVKDAIPGGNVKKGEVVKAVIVRTKKETR
RL14_ROSS1      MVQQETRLRVADNTGAKEILCIRVLGGSRVRYGRVGDVIVASVKEATPGGAVKKGEVVRAVIVRTAKEYG
RL14_EUBR3      MVQQESRLKVADNTGAKELLVIRVMGGSTRRYANIGDVIVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_ANATD      MIQPQSRLKVADNTGAKEVMCIRVLGGSNRKFANIGDVIVCSVKDATPXXXXXXXXXXXXXXXRTRKGVR
RL14_CORJK      MIQQESRLRVADNTGAREILVIRPLGGSVRRSAGIGDVVVATVKEAAPGGTVKAGDIVKAVIVRAKKETR
RL14_ANOFW      MIQQETRMKVADNSGAREVLVIKVLGGSGRRYANIGDIVVATVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_THETN      MIRPQTRLKVADNTGAKEIMCIRLLGGSNRKYSNVGDIIVASVKSATPXXXXXXXXXXXXXXXRTKKGIA
RL14_CLOPS      MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKFGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVRGLR
RL14_CLOPE      MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKFGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVRGLR
RL14_CLOP1      MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKFGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRSVRGLR
RL14_ALKOO      MIQQESRLKVADNSGAKELLCIRVLGGTRRKYAHIGDVIVCSVKSATPXXXXXXXXXXXXXXXXXXXXXX
RL14_MICLU      MIQQESRLKVADNTGAKEILTIRVLGGSGRRYAGIGDTIVATVKDAIPGGNXXXXXXXXXXXXRTRKQSR
RL14_MICLC      MIQQESRLKVADNTGAKEILTIRVLGGSGRRYAGIGDTIVATVKDAIPXXXXXXXXXXXXXXXRTRKQSR
RL14_LEIXX      MIQQESRLKVADNTGAKELLTIRVLGGSGRRYAGLGDVIVATVKDAIPGGNVKKGDVVKAVIVRTRKNTR
RL14_EUBE2      MVQQETRLKVADNTGAKEILCIRVMGGSTRRYANIGDVIVATVKEATPXXXXXXXXXXXXXXXXXXXXXX
RL14_ARTS2      MIQQESRLKVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTKKERR
RL14_ARTCA      MIQQESRLKVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTKKERR
RL14_ARTAT      MIQQESRLKVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTKKERR
RL14_ROSCS      MVQQETRLRVADNTGAKEILCIRVLGGSHVRYGRVGDVIVASVKEATPGGAVKKGEVVRAVIVRTAKEYG
RL14_RENSM      MIQQESRLKVADNTGAKEILAIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTKKERR
RL14_RHOSR      MIQQESRLRVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGGNIKKGEVVKAVIVRTTKERR
RL14_RHOOB      MIQQESRLRVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGGNIKKGEVVKAVIVRTTKERR
RL14_CLONN      MIQPQTRLKVADNTGAKEIMCIRVLGGSKRKFGNIGDVIVASVKSATPXXXXXXXXXXXXXXXRTKRGVR
RL14_CLOAB      MIQAQTMLKVADNSGAKEIMCVRVLGGSKRKWGNIGDIIVASVKSATPXXXXXXXXXXXXXXXRSAKGLR
RL14_THEPX      MIQPQTRLKVADNTGAKEIMCIRLEGGSNRKFSNVGDVIVASVKSATPXXXXXXXXXXXXXXXRTKKGIA
RL14_THEP3      MIQPQTRLKVADNTGAKEIMCIRLEGGSNRKFSNVGDVIVASVKSATPXXXXXXXXXXXXXXXRTKKGIA
RL14_RHOE4      MIQQESRVRVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNIKKGEVVKAVIVRTTKERR
RL14_NATTJ      MIQTESTLRVADNTGAREIQCIKVIGAGQKQYANVGDVIVGTIKEATPGGVVKRGQVVRAVIVRTKRGIK
RL14_CLOPH      MIQSESRLKVADNSGAKELLCIRVMGGSTRRYANIGDIIVASVKDATPXXXXXXXXXXXXXXXXXXXXXX
RL14_CHLAD      MIQPQTRLKVADNTGAKEIMCIRVLGGSRVRYGRVGDIIVASVKEATPGGQVKKGDVVKAVIIRTAKEYG
RL14_STRCO      MIQQESRLRVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTVKERR
RL14_STRAW      MIQQESRLRVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTVKERR
RL14_MYCGI      MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVIVRTVKERR
RL14_MYCA9      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGGTXXXXXXXXXXXXXXXXXXX
RL14_CLOBB      MIQPQTLLKVADNSGAKEIMCIRVLGGSKRKFGNISDVIVASVKSATPXXXXXXXXXXXXXXXRSAKGLR
RL14_CLOBA      MIQPQTLLKVADNSGAKEIMCIRVLGGSKRKFGNISDVIVASVKSATPXXXXXXXXXXXXXXXRSAKGLR
RL14_ACHLI      MLQQESRLLVADNSGAREVLVIRVLGGTRRRYANIGDIVTVTVKKASPXXXXXXXXXXXXXXXXXXXXIR
RL14_SPICI      MIQQESRLKVADNSGAKEVLVIKNLGGSWRKFTNIGDIVVCTIKKVTPGGIVKKGQVVKAIIVRTKRGLK
RL14_MYCMO      MIQEESRVKVADNSGAKEVGIIRNLGGSVKKTSNIGDIVVCSIKKALPTGLVKEGQVVRAVVVRTKYGIK
RL14_HALOH      MIQAESRLRVADNTGARELLCIRVLGGSRKRYAGVGDIIVATVKEAIPDGMXXXXXXXXXXXXXXXXXXX
RL14_DESHY      MIQVQTRLRVGDNSGAKELMCIKVLGGSMRRYASIGDIIVASVKEATPXXXXXXXXXXXXXXXRTKKEIK
RL14_DESHD      MIQVQTRLRVGDNSGAKELMCIKVLGGSMRRYASIGDIIVASVKEATPXXXXXXXXXXXXXXXRTKKEIK
RL14_CHLSY      MIQPQTRLKVADNTGAKEIMCIRVLGGSRVRYGRVGDIIVASVKVATPGGQVKKGDVVKAVIIRTAKEYG
RL14_CHLAA      MIQPQTRLKVADNTGAKEIMCIRVLGGSRVRYGRVGDIIVASVKVATPGGQVKKGDVVKAVIIRTAKEYG
RL14_KINRD      MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTKKERR
RL14_MYCLE      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNXXXXXXXXXXXXXXXXECR
RL14_MYCAP      MVLELSKLNVADNSGAKEVGVIRVLGGSRKKTANIGDVIICSVKKAIPTGIVKEGQVVKAVIVRSVYGIH
RL14_DESRM      MIQVQTILKAADNTGARKLMCIRVMGGSLRRYASVGDIIVASVKEATPXXXXXXXXXXXXXXXRTSKEVR
RL14_MYCMM      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_HERA2      MIQQESRMRVADNTGAKELLCIRVLGGTKRRYASVGDTIIATVKQANPGGSAKKGEVVRAVIVRVKKGYT
RL14_NOCFA      MIQQESRLRVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCTU      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCTA      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCPA      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCBT      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCBP      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCBO      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCA1      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_GRAFK      MVQQESRLKVADNTGAKEVLAIRVLGGTKKRYASVGDKIVVSVKEATPNGSIKKGAVSTAVVVRTRKEVR
RL14_CLOTE      MIQQQTTLKVADNSGARGIMCIKVLGGSNRRYANIGDIIVASVKSATPXXXXXXXXXXXXXXXXXXXXXX
RL14_STRGG      MIQQESRLRVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNVKKGDVVKAVIVRTVKERR
RL14_MYCUA      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_BREBN      MIQTQTRLAVADNSGAKELMCIKVLGGSGRKTANIGDVIVCSVKSATPXXXXXXXXXXXXXXXXXXXXXX
RL14_SACEN      MIQQESRLRVADNSGAKEILTIRVLGGSGRRYAGIGDIIVATVKDAIPGANVKKGEVVKAVIVRQKKEKR
RL14_FINM2      MIQQESRLRVADNSGAKELLVIRVLGGTKRKYAAIGDIVVCSVKSAQPGGMVKKGDVVKAVIVRTTKPLG
RL14_CLOB8      MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKFGNIGDVIVASVKSATPXXXXXXXXXXXXXXXXXXXXXX
RL14_SYNWW      MIQQETMLQVGDNTGAKKVLCVKVLGGSTRRYASVGDIIVASVKEASPGGVVKKGDLVKAVVVRTKKEIR
RL14_ALKMQ      MIQQESRLKVADNSGAKELLCIRVLGGTRRRYANVGDVIVCSVKSATPXXXXXXXXXXXXXXXXXXXXXX
RL14_THEFY      MIQQESRLKVADNTGAKELLTIRVLGGSGRRYASIGDTIVATVKDALPGAGVKKGDIVKAVVVRTTKERR
RL14_MYCSS      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKEAIPGANXXXXXXXXXXXXXXXXXXX
RL14_MYCSK      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKEAIPGANXXXXXXXXXXXXXXXXXXX
RL14_MYCSJ      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKEAIPGANXXXXXXXXXXXXXXXXXXX
RL14_KOCRD      MIQQESRLRVADNTGAKEILTIRVLGGSGRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_SALTO      MIQQESRLRVADNTGAREILCIRVLGGSGRRYASIGDVIVATVKDAIPXXXXXXXXXXXXXXXXXXXXXX
RL14_SALAI      MIQQESRLRVADNTGAREILCIRVLGGSGRRYASIGDVIVATVKDAIPXXXXXXXXXXXXXXXXXXXXXX
RL14_PHYMT      MIQRESRLVVADNSGAKEVLVINILGGSTGFYANIGDIVIVTVKKAISSGAIKAGDVLKAVIVRTKYGLR
RL14_MYCVP      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_MYCS2      MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_NOCSJ      MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_BIFLO      MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKDAIPGGSXXXXXXXXXXXXXXXXESR
RL14_BIFLI      MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKDAIPGGSXXXXXXXXXXXXXXXXESR
RL14_BIFLD      MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKDAIPGGSXXXXXXXXXXXXXXXXESR
RL14_BIFAA      MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKDAIPGGSXXXXXXXXXXXXXXXXEHR
RL14_SYMTH      MIQVQTRLQVADNTGAKELMCIKVLGGSWRRYANIGDVIVCSVKEASPXXXXXXXXXXXXXXXXXXXXLR
RL14_BEUC1      MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGGNXXXXXXXXXXXXXXXXXXX
RL14_ACIC1      MIQQESRLKVADNTGAREILCIRVLGGSGRRYAGIGDVIIATVKDALPXXXXXXXXXXXXXXXXXXXXXX
RL14_FRASN      MIQQESRLRVADNTGAREILCIRVLGGSGRRYAGIGDIIVGTVKDALPGAGXXXXXXXXXXXXXXXXXXX
RL14_FRASC      MIQQESRLRVADNTGAREILCIRVLGGSGRRYAGIGDIIVGTVKDALPXXXXXXXXXXXXXXXXXXXXXX
RL14_FRAAA      MIQQESRLRVADNTGAREILCIRVLGGSGRRYAGIGDIIVGTVKDALPXXXXXXXXXXXXXXXXXXXXXX
RL14_DESOH      MIQTETRLKVADNSGAKIVYCIKVLGGSRRRYATVGDVIVVSVKEAIPNSKVKKGDVLKAVIVRTKKEIK
RK14_CHLVU      MIQPQTYLRVADNTGARELMCIRVLGGGKQRAATVGDIIIAVVKDATPNMPVKRSDIVRAVIVRTRKNVR
RL14_PELTS      MIQVQSILNVADNTGARRLMCIRVLGGALRRYASVGDIIVCSVKEATPGGXXXXXXXXXXXXXXXXXXXX
RL14_RHOBA      MIQQESRLDVADNTGAREVMCIKVLGGSRRRFATVGDVIVCSVKSVIPGSEXXXXXXXXXXXXXXXQPTR
RL14_CYTH3      MIQQESRLSVADNSGAKEVLVIRVLGGTGKRYASIGDKVVVTVKSAISSSNMKKGTVSKAVVVRTKKEVK
RL14_BIFA0      MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKDAIPGGSXXXXXXXXXXXXXXXXXXX
RL14_ALCBS      MIQTESMLEVADNSGARRVQCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGRVKKGDVMTAVVVRTRKGVR
RK14_PSEAK      MIRPQTILNVADNSGAKKLMCIRVLGGSYKQSANIGDIIIAVVKQATPNMPLKKSDKVRAVVVRTAQGVQ
RL14_PROAC      MIQQETRLKVADNTGAKELLCIRVLGGSKRRYAYLGDTIVCTVKDAIPGGNXXXXXXXXXXXXXXXXSHR
RL14_MOOTA      MIQQQTLLKVGDNTGARKLMCIRVLGGSKRRYASVGDVIIASVKEATPXXXXXXXXXXXXXXXXXXXXXX
RL14_CYAP4      MIQQESYLNVADNSGAKKLLCIRVLGGGNRRYGSVGDVIIATVKDATPNMPVKKSDVVRAVIVRTRKAIR
RK14_BIGNA      MVQPQSRVKVVDNSGAKEIVCIRVLGKGRNQLSNIGDIIIGVVKEAIPNTPLKKSDIVRAVVVRTRKGLK
RL14_THEEB      MIQQETYLNVADNSGAKKLLCIRVLGGSNRRYGSVGDVIIATVKDATPNMAVKKSDVVRAVIVRTRKSIR
RL14_MYCPU      MLQELSVAKVADNSGAKEVGIIRNLGGSVKKSSNIGDVVICSVKKAIPNGIVKKGQVVKAVIVRTKYGIK
RL14_DESAD      MIQVESKLDVADNSGAKKVSCIKVLGGSKRRYASVGDIIVVSVKEAMPHSXXXXXXXXXXXXXRTKKEIG
RL14_BURVG      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYAGIGDIIKVTVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURCM      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYAGIGDIIKVTVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURA4      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYAGIGDIIKVTVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_CARHZ      MIQVQTILNSADNTGAKKLMCIRVLGGSNRRYASLGDIIVCSVKEATPDXXXXXXXXXXXXXXXXXXXXX
RL14_ACIAD      MIQTESMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRGRVKKGDVMNAVVVRTKFGIR
RL14_TREDE      MIQVETRLNVADNSGAKLVECIKVIGGSKRRYAGIGDIIVVAVKEALPTSVIKKGTVEKAVIVRVSKEYR
RL14_SYNFM      MIQAETQLNAADNSGAKRLYCIKVLGGTRKRYASVGDIIVVSVKEAIPNAKVKKGDVLKAVVVRTQKEVR
RL14_PSYCK      MIQVESMLEVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRGRVKKGDVMNAVVVRTKKGVR
RL14_PSYA2      MIQVESMLEVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRGRVKKGDVMNAVVVRTKKGVR
RL14_LAWIP      MIQVESTLQVADNSGAKKVACIKVLGGSKRRYATVGDIIVVSVKEAIPHSKVKKGEVLQAVIVRTKKEVR
RL14_BURS3      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURP8      MIQTETRLEVADNTGAREVMCIKVLGGSKRRYANIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURCJ      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURCH      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURCC      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURCA      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYAGIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_ACIBY      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_ACIBT      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_ACIBC      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_ACIB5      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_ACIB3      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_RUBXD      MIQQETRLKVADNSGARSLLCIRVLGGSKRRSAGIGDVIVASVKEATPGXXXXXXXXXXXXXXXXXXXXX
RL14_FLAJ1      MVQQESRLKVADNTGAKEVLTIRVLGGTKRRYASVGDKIVVSIKDATPNGNVKKGAVSTAVVVRTKKEVR
RL14_BURXL      MIQTETRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVTVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURTA      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURPS      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURPP      MIQTETRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVTVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURP6      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURP1      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURP0      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURMS      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURMA      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURM9      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURM7      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_BURM1      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASIGDIIKVSVKEATPRGRVKKGEIYNAVVVRTAKGVR
RL14_ANASK      MIQQQTMLDVADNSGAKRVMCIKVLGGTRRKYASIGDVIVVSIKEAIPQAKVKKGEVARAVIVRTAREVK
RL14_ANADE      MIQQQTMLDVADNSGAKRVMCIKVLGGTRRKYASIGDVIVVSIKEAIPQAKVKKGEVARAVIVRTAREVK
RL14_ANAD2      MIQQQTMLDVADNSGAKRVMCIKVLGGTRRKYASIGDVIVVSIKEAIPQAKVKKGEVARAVIVRTAREVK
RL14_MYXXD      MIQMTSVLDVADNSGAKKVFCIKVLGGSKRKYASIGDVIVVSVREALPNSKVKKGDVAKAVIVRTKREVG
RL14_DESVM      MIQVESTLQVADNSGAKKVACIKVLGGSKRRYATVGDIVVVSVKEALPHCKVKKGDVMQAVIVRTRKEVR
RL14_DESPS      MIQTETVLNVADNSGAKKVLCIRVLGGSRKRYASIGDVIVVTVKEAIPHAKVKKGDVMKAVVVRTAKENR
RL14_DESAH      MIQTETRLTVADNSGAKELYCIKVLGGSKRRYAGIGDVIVVSVKEAIPNAXXXXXXXXXXXXXRTKKEVS
RL14_ANADF      MIQQQTMLDVADNSGAKKVQCIKVLGGSRRRYASIGDVIVVSVKEAIPQAKVKKGEVARAVIVRTSREVK
RL14_ACIBS      MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIR
RL14_UREU1      MIQHMTRLKVADNTGAKEVGVIKVLGGSKKRYASVGDIVVVSVKKATPAGLIAKGQMAKAVIVRTKKSIR
RL14_UREPA      MIQHMTRLKVADNTGAKEVGVIKVLGGSKKRYASVGDIVVVSVKKATPAGLIAKGQMAKAVIVRTKKSIR
RL14_UREP2      MIQHMTRLKVADNTGAKEVGVIKVLGGSKKRYASVGDIVVVSVKKATPAGLIAKGQMAKAVIVRTKKSIR
RL14_THETH      MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEVK
RL14_THET2      MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEVK
RL14_THEAQ      MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEVK
RL14_TERTT      MIQTETYLDVADNSGARRVMCIKVLGGSHRRYAGVGDVIKVTVKEAIPRGKVKKGQVMKAVVVRTKKGVR
RL14_RALSO      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASVGDIIKVSVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_RALPJ      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASVGDIIKVSVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_ERYLH      MIQMQSNLDVADNSGAKRVQCIKVLGGSKRRTASVGDVIVVSVKEAQPRAKVKKGDVHRAVIVRTKKDVR
RL14_DESMR      MIQVESNLDVADNSGAKRVCCIKVLGGSRRRYATVGDIIVVSVKDALPNSXXXXXXXXXXXXXRTKKEVG
RL14_DEHE1      MVQQYTRLNVADNTGAKKIMCINVLGGSRKLQAKVGDVIVAAVKKSSPDAQAKSGTVVKAVVVRITKPYA
RL14_CAMJR      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RL14_CAMJJ      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RL14_CAMJE      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RL14_CAMJD      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RL14_CAMJ8      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RL14_THET8      MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRXXXXXXXXXXXXXXRTKKEIK
RL14_RALEH      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYASVGDIIKVTVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_DESAA      MIQAETRLTVADNSGAKVLGCIKVLGGSKRRYASVGDIIVVSVKEAIPNSKVKKGDVMKAVIVRTKKEIR
RL14_CUPTR      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYASVGDIIKVTVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_CAMLR      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATVGDVIVASVKKALPNGXXXXXXXXXXXXXRTKKEIH
RK14_STIHE      MIRPQSYLNVADNTGARKVMCIRVLGGIQGQTANIGDVIIAVVKDALPNTGVKKSDIVRAVVVRTRKGIR
RL14_XANCP      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANCB      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANC8      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANC5      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANAC      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_RALME      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYASVGDIIKVTVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_RALEJ      MIQTESRLEVADNTGAREVLCIKVLGGSKRRYASVGDIIKVTVKDAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_PSEU5      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEHT      MIQMQTQLEVADNSGARKVQCIKVLGGSHRRYAAIGDIIKVSVKEAIPRGKVKKGDVKNAVVVRTKKGVR
RL14_MYCA5      MLREFSRCNVADNSGAKEVMIIKNLGGSIVRSTNIGDVVVVTVKKAIPHGFVKEGQVLKAVIVRTKRGLM
RL14_FUSNN      MVQQQTILNVADNSGAKKLMVIRVLGGSRKRFGKIGDIVVASVKEAIPGGNVKKGDIVKAVIVRTRKETR
RL14_DESAP      MIQVQTVLNVADNTGAKKLMCIRILGSSFRRYASIGDIIVCSCKEXXXXXXXXXXXXXXXXXXRTKKEIG
RL14_KOSOT      MIQLESYLRVADNSGAKVIKVIQVSGGSKRKTGSIGDIVVASVREAVPNTDIKKGDIVRAVVVRTKKEIR
RL14_AZOSB      MIQMQSKLDVADNTGARSVMCIKVLGGSKRRYASIGDIIKVTVKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_ACIF5      MIQTQTRLNVADNSGAREVMCIKVLGGSHRRYADIGDVIKVSIKDAVPRGKVKKGDVYNALVVRTRKGVR
RL14_ACIF2      MIQTQTRLNVADNSGAREVMCIKVLGGSHRRYADIGDVIKVSIKDAVPRGKVKKGDVYNALVVRTRKGVR
RL14_PSYWF      MIQTETILEVADNSGARRVQCIKVLGGSHRRYASVGDIIKVSVKEAIPRGRVKKGDVMNAVVVRTKKGVR
RL14_POLSQ      MIQTESRLQVADNTGASEVLCIKVLGGSKRRYASIGDVIKVSVKSAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_MARAV      MIQTQTMLEVADNSGARQVMCIKVLGGSHRRYATVGDIIKVTVKEAIPRGKVKKGQVLKAVVVRTRKGVR
RL14_GLUDA      MIHPETNLDVADNSGARQVQCIKVLGGSKRKTASVGDVIVVSVKEAIPRGKVKKGDVHQAVIVRTSYPVR
RL14_AZOSE      MIQMQSRLDVADNTGARSVMCIKVLGGSKRRYAGIGDIIKVTVKDAAPRGRVKKGDIYSAVVVRTAKGVR
RL14_PELPD      MIQMQTILDVADNSGAKKLFCIKVLGGSKRKYAGVGDIIVASVREALPNSKVKKGDVVKAVIVRTAKELG
RL14_METS4      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAGVGDIIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDVR
RL14_HERAR      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYAGIGDVIKVTVKVAAPRGRVKKGEIYNAVVVRTAKGVR
RL14_GEOUR      MIQMQTILDVADNSGAKKLFCIKVLGGSKRKYAGIGDIIVASVKEAIPNSXXXXXXXXXXXXXRTAKEIG
RL14_GEOSF      MIQMQTILDVADNSGAKKLFCIKVLGGSKRKYAGIGDIIVASVKEAIPNSXXXXXXXXXXXXXRTAKEIG
RL14_DESVV      MIQVESTLQVADNSGAKKVACIKVLGGSHRRYATVGDIIMVSVKEAMPHCKVKKGDVMQAVIVRTAKEVR
RL14_DESVH      MIQVESTLQVADNSGAKKVACIKVLGGSHRRYATVGDIIMVSVKEAMPHCKVKKGDVMQAVIVRTAKEVR
RL14_DEHSC      MVQQYTRLNVADNTGAKKIMCINVLGGSHKIQAKVGDVIVAAVKKSSPDAQAKSGTVVKAVVVRITKPYA
RL14_DEHSB      MVQQYTRLNVADNTGAKKIMCINVLGGSHKIQAKVGDVIVAAVKKSSPDAQAKSGTVVKAVVVRITKPYA
RL14_CELJU      MIQTESYLDVADNSGARRVMCIKVLGGSHRRYAAVGDIIKVTVKEAIPRGKVKKGQVLKAVVVRTKKGVR
RL14_CAMFF      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYASLGDIIVCSVKKALPNGKIKKGQVVKAVVVRTKKEVQ
RK14_CHLAT      MIQSQTYLNVADNSGARKIMCIRVLGGSQRQYATIGDVIIAVVKDSVPNMALKRSEVVRAVVVRTRKGLR
RL14_SACD2      MIQTQSYLDVADNSGARRVMCIKVLGGSHRRYAGVGDIIKVTVKEAIPRGKVKKGQVMNAVVVRTKKGVR
RL14_PSEAE      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTKHGVR
RL14_PSEAB      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTKHGVR
RL14_PSEA8      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTKHGVR
RL14_PSEA7      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTKHGVR
RL14_METFK      MIQMQSRLDVADNTGARSVMCIKVLGGSKRRYAGIGDIIKVSVKDAAPRGRVKKGEVYSAVVVRTAKGVR
RL14_FERNB      MIQNESYLVAADNSGAKVLRVIRVLGGSHKQFGTIGDIVVCSVREAVPNTDIKKGDVVKAVVVRTKKEIR
RL14_DESDG      MIQVESALQVADNSGAKKVACIKVLGGSKRRYASVGDVIVVSVKEALPHSKVKKGDVMKAVVVRTAKEIR
RL14_CAMC1      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATLGDIIVCSVKKALPNGKIKKGQVVKAVVVRTKREVQ
RK14_MESVI      MIQAQSYLNVADNSGAKKIMCIRVLGGSQRKYAAIGDVIIGVVKDSVPNMSLKKSEVVRAVVVRTCKGIR
RK14_CHLRE      MIKPLSYLNVADNSGARELMCIRALGGSYRESANIGDVIIAVVKDALPNMPVKRSDIVRAVIVRTRKGIR
RL14_XYLFM      MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDIIKVTVKEAIPRGKVKKGEVYDAVVVRTRSGVR
RL14_XYLFA      MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDIIKVTVKEAIPRGKVKKGEVYDAVVVRTRSGVR
RL14_PSEF5      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PROMS      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVIVATVKDALPNMGVKKSEVVKAVIVRTKATLR
RL14_PROM9      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVIVATVKDALPNMGVKKSEVVKAVIVRTKATLR
RL14_PROM2      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVIVATVKDALPNMGVKKSEVVKAVIVRTKATLR
RL14_PROM0      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVIVATVKDALPNMGVKKSEVVKAVIVRTKATLR
RL14_POLNS      MIQTESRLQVADNTGASEVLCIKVLGGSERRYASIGDVIKVSVKSAAPRGRVKKGDIYNAVVVRTAKGVR
RL14_JANMA      MIQTESRLEVADNTGAREVMCIKVLGGSKRRYAGIGDVIKVTVKVAAPRGRVKKGEIYNAVVVRTAKGVR
RL14_GRABC      MIHPETNLEVADNSGARRVQCIKVLGGSKRKTASVGDVIVVSVKEAIPRGKVKKGDVHQAVIVRTSFPVR
RL14_GLUOX      MIHPETNLDVADNSGARRVQCIKVLGGSKRKTASVGDVIVVSVKEAIPRGKVKKGDVHQAVIVRTSYPVR
RK14_CHAVU      MIQTQSFLNVADNSGARKLMCIRILNSSNCKYANIGDTIIAVVKEAIPNMSIKKSEIVKAVVVRTRKGIK
RL14_XYLFT      MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDVIKVTVKEAIPRGKVKKGEVYDAVVVRTRSGVR
RL14_XYLF2      MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDVIKVTVKEAIPRGKVKKGEVYDAVVVRTRSGVR
RL14_WOLSU      MIQSFTRLTVADNSGAKEVMCIKVLGGSKRRYATVGDVIIASVKKALPNGKIKKGQVVKAVVVRTKKEVQ
RL14_RHISN      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_RHILO      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_PSYIN      MIQMQSVLDVADNSGARRVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVHSAVVVRTRKGVR
RL14_PSEMY      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PROMP      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVVVASVKDALPNMGVKKSDVVKAVIVRTRHTLR
RL14_PROM5      MIQQETYLTVADNSGAKRLQCIRVLGSNR-RYAHVGDVVVASVKDALPNMGVKKSDVVKAVIVRTRHTLR
RL14_NOVAD      MIQMQSNLDVADNSGAKRVQCIKVLGGSKRRFAGVGDIIVVSVKEAQPRARVKKGDVHRAVIVRTKKDVR
RL14_MESFL      MIQTLSKLKVADNSGAKEVRVIRNLGGSVRKFTGIGDIIVCSVQSATPXXXXXXXXXXXXXXXRTTRELK
RL14_GEOMG      MIQMQTILDVADNSGARKLFCIKVLGGSKRKYAGIGDIIVASVREAIPNSKVKKGDVVKAVIVRTAKEVG
RL14_BDEBA      MIQMQTRLNVADNSGAKEVMCVKVLGGSKRRVASIGDVIVVSIKEALPNXXXXXXXXXXXXXXXXXXXXX
RL14_THEM4      MIINESYLNVADNSGAKLLRVIRVMGGSRRKWGTVGDIVVCSVRDAVPNGDLKKGDVVKAVIVRTKKEIR
RL14_RHILW      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDVIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_RHIEC      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDVIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_RHIE6      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDVIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_PSEU2      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSESM      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEPK      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEPG      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEPF      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEP1      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEFS      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSE14      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PARL1      MIQQETNLEVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSIKEAIPRGKVKKGDVMKAVVVRTAKDIR
RL14_MYCMS      MIQTLSKLKVADNSGAKEVRVIRNLGGSVRKFSGIGDIIICSVISATPGAVIKKGQVVKAVIVRTTRELR
RL14_MYCCT      MIQTLSKLKVADNSGAKEVRVIRNLGGSVRKFSGIGDIIICSVISATPGAVIKKGQVVKAVIVRTTRELR
RL14_MAGSM      MIQVESRLEVADNSGAKKVQCIKVIGGSKRRYARVGDVIIVAVKAALPRGKVKKGEVARAVVVRTKKEIS
RL14_IDILO      MIQMQTTLDVADNSGARSVQCIKVLGGSHRRYANIGDIIKVTVKEAIPRGXXXXXXXXXXXXXRTRKGVR
RL14_HAMD5      MIQQESMLNVADNSGARSVKCIKVLGGSRRRYACVGDIIVISIKEAIPRGKVKKGEVLKAVVVRTSKGVR
RL14_FLAPJ      MVQQESRLRVADNTGAKEVLTIRVLGGTKRRYASVGDKIVVSIKDTAPNGSVKKGSVSTAVVVRTKKEVR
RL14_ALTMD      MIQMQTNLDVADNSGARRVQCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGDVLNAVVVRTRKGVR
RL14_AGRRK      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDVIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RK14_STAPU      MIQPQSYLNVADNSGARRLMCIRVLGSSNRKYANIGDMIIAVVKEAVPNMPLKKSEVVRAVIVRTCKGIK
RK14_MARPO      MIQPQTYLNVADNSGARKLMCIRVIGTSNRKYANIGDIIIAVVKEAVPNMPIKKSEIVRAVIVRTCKEFK
RL14_XANOR      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYARIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANOP      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYARIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_XANOM      MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYARIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_TROWT      MIQQESRLKVADNTGAKSLSVIRVLGGSNRRFGSLGDVVVASVKDAVPGSSAVKKGDVVKAVIRSTKEVR
RL14_TROW8      MIQQESRLKVADNTGAKSLSVIRVLGGSNRRFGSLGDVVVASVKDAVPGSSAVKKGDVVKAVIRSTKEVR
RL14_TRIEI      MIQQQSLLNVADNSGARKLMCIRVVGGGNRRYAHIGDVIIAVVKDASPNMXXXXXXXXXXXXXXXXXGLR
RL14_SALRD      MIQQETRLNVADNSGAKEAQCIRVLGSSGRRYAGIGDQIVVSVKSAIPSGEINKGDVSRAVVVRTAKETR
RL14_PSEPW      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_PSEE4      MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTAVVVRTRHGVR
RL14_NAUPA      MIQPFTRLKVADNSGAKEIMCIKVLGGSKRRYASVGDIIVASVKKALPNGKIKKGQVVKAVIVRTKKEVQ
RL14_DESDA      MIQVESTLQVADNSGAKKVACIKVLGGSHRRYASVGDIVVVSVKEAIPHSKVKKGDVMKAVIVRTAKEVR
RK14_PAUCH      MIQQETFLNVADNSGAKRIQCIRVLGSNR-RYAHVGDIIVAAVKDAMPNMSVKKSDVVKAVIVRTKATLR
RL14_OCHA4      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_METCA      MIQMQTCLDVADNSGARQVMCIKVLGGSKRRYANVGDIIKVSVKDAIPRGRVKKGEVYNAVVVRTRKGVR
RL14_MESSB      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUSU      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUSI      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUO2      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUME      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUMB      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUC2      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BRUAB      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGEVMKAVVVRTAKDIR
RL14_BRUA2      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGEVMKAVVVRTAKDIR
RL14_BRUA1      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYASVGDIIVVSIKEAIPRGRVKKGEVMKAVVVRTAKDIR
RK14_ODOSI      MIYPQTMLTVADNTGARKIMCIRVLGGNR-KYAKIGDTIIGVVKEAIPNMPIKRSDIVRAIVVRTSKTIR
RK14_LEPTE      MIQPQTYLNVADNSGARKLMCIRILGGRQKQYGKIGDVIIAVVKDALPNMPLKKSEIVRAVIVRTRKGVN
RK14_GUITH      MIQTQTYLTVADNSGAKKIMCIRILGGNR-KYASIGDVIIGVVKDATPNMPVKRSDVVRAVIMRTKNTIR
RL14_THESQ      MIQQETYLNVADNSGAKKLRVIRVIGGFHKKYGTVGDIVVCSVREAIPNSDVKKGDVVRAVIVRTKKEIR
RL14_THEP1      MIQQETYLNVADNSGAKKLRVIRVIGGFHKKYGTVGDIVVCSVREAIPNSDVKKGDVVRAVIVRTKKEIR
RL14_THENN      MIQQETYLNVADNSGAKKLRVIRVLGGFHKKYGTVGDIVVCSVRDAIPNSDVKKGDVVRAVIVRTKKEIR
RL14_SYNR3      MIQQETFLNVADNSGAKRIQCIRVLGTNR-RYAHVGDVIVATVKDAMPNMGVKKSDIVKAVVVRTKHTMR
RL14_SORC5      MIQVSTHLEVADNSGARIVKCIKVLGGSRRKYAALGDVIVVSIKEALPGTKVKKGETARAVVVRTAREYQ
RL14_METPB      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAGVGDIIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDVK
RL14_METEP      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAGVGDIIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDVK
RL14_GEOSL      MIQMQTVLDVADNSGAKKLFCIKVLGGSKRKYAGVGDIVVCSVREAVPNAXXXXXXXXXXXXXRTAKEIG
RL14_DICNV      MIQMQSRLSVADNSGARELQCIKVLGGSHRRYAGIGDVIKVSVKDAMPRGRVKKGDVYNALIVRTKKGVR
RL14_AZOC5      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAHVGDIIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDIR
RK14_ZYGCR      MIQPQSYLNVADNSGARKLMCIRVLGSSNRKYAHIGDMVIAVVKETVPNMPLKKSEIVRAVIVRTRKGLK
RK14_RHDSA      MIQTQTYLNVADNSGAKKIMCIRILGGNK-KYASIGDVIIGVVKDATPNMPVKRADVVRAVVMRTKKTVR
RL14_VIBFM      MIQMQSTLDAADNSGARKVMCIKVLGGSHRRYAHIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_VIBF1      MIQMQSTLDAADNSGARKVMCIKVLGGSHRRYAHIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_THERP      MIQPLSKLVVADNTGAKEIMCIRVLGGSKHRYGTVGDLIVASVKKAEPNAAVKKGDVVYAVIVRTKKEYR
RL14_THEMA      MIQQETYLNVADNSGAKKLRVIRVIGGFHKKYGTVGDIVVCSVREAIPNSDVKKGDVVRAVIVRTKKEIR
RL14_THEAB      MIINESYLNVADNSGAKLLRVIRVMGGSRRKWGTVGDVVVCSVRDAVPNGDLKKGDVVKAVIVRTKKEIR
RL14_SYNJA      MIQQQTMLTVADNTGARKLMCIRVLGSSGRRYASLGDVIVGVVKDALPNMPVKKSDVVKAVVIRTVDTVR
RL14_CAMC5      MIQSFTRLAVADNSGAKELMCIKVLGGSKRRYATLGDVIICSVKKALPNGKIKKGQVVKAVVVRTKKEVQ
RL14_BUCAP      MIQEQTILNVADNSGARSAMCIKVLGGSRRRYARIGDIIKITIKEAIPRGKVKKGEVLKAVVVRTKKGVR
RK14_CYAME      MIQVQTRLKVADNTGAKEVMCIRVLKAS---TATLGDVIIVVVKEALPNMMVKKSQIFRAVVVRTKQAVR
RL14_YERPY      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPP      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPN      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPG      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPE      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPB      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERPA      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERP3      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_YERE8      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_VEREI      MIQTESRLEVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSVKEAAPRGRVKKGEIYSAVVVRTAKGIR
RL14_TOLAT      MIQMQSMLDVADNSGARSVMCIKVLGGSHRRYAGVGDIIKVSIKEAIPRGKVKKGDVYNAVVVRTRKGVR
RL14_THICR      MIQMQTVLDVADNSGARKVQCIKVLGGSKRRYASVGDVIKVAVKEAAPRGKVKKGDVFDAVVVRTAQGVR
RL14_THELT      MIQNESYLNVADNSGAKKLRVIRVMGGFHKKYGTVGDIVVCSVRDVVPNTGIKKGEVVKAVIVRTKKPVR
RL14_SYNS3      MIQQETFLTVADNSGAKRIQCIRVLGTNR-RYAHVGDVIVATVKDAMPNMGVKKSDIVKAVVVRTKATMR
RL14_METRJ      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYAGVGDVIVVSVKEAIPRGRVKKGDVMKAVVVRTAKDVK
RL14_LARHH      MIQMQTQLEVADNTGARRVMCIKVLGGSKRRYATVGDIIKVSIKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_GEOLS      MIQMQTILDVADNSGAKKLFCIKVLGGSKRKYAGVGDIVVCSVREALPNSKVKKGDVVKAVIVRTAKELG
RL14_BUCAK      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ALISL      MIQMQSTLDAADNSGARKVMCIKVLGGSHRRYAHIGDVIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RK14_PHYPA      MIQPQTYLNVADNSGARKLMCIQILGASNRKYAHIGDIIIAVVKEAIPNMPLKKSEVVRAVVVRTCKELK
RK14_CHAGL      MIQPQSYLNVADNSGARKIMCIRILGGSNKKYGHIGDTIIGVVKEAIPNMTLKKSEVVRAVIVRTCKELK
RL14_VARPS      MIQTESRLEVADNTGAKSVLCIKVLGGSKRRYASVGDVIKVSIKEAAPRGRVKKGEIYSAVVVRTAKGIR
RL14_SPHAL      MIQMQSQLEVADNSGAKRVQCIKVLGGSKRRTAGVGDVIVVSIKEAQPRGKVKKGDVHRAVIVRTAKDVR
RL14_SHESW      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHESR      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHESM      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEPC      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEON      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEB9      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEB8      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEB5      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SHEB2      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SALTY      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALTI      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALSV      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALPK      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALPB      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALPA      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALNS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALHS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALG2      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALEP      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALDC      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALCH      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALAR      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SALA4      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_PECCP      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HELHP      MIQSFTRLSVADNSGAKEIMCIKILGGSHRRYARVGDVIVASVKKAIPNGXXXXXXXXXXXXXXXXXEIH
RL14_ERWCT      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_DIAST      MIQTESRLDVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSVKEAAPRGRVKKGEVYSAVVVRTAKGIR
RL14_CHLTR      MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRDVEPDSSVKKGDVVKAVIVRTRNDIH
RL14_CHLTB      MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRDIEPDSSVKKGDVVKAVIVRTRNDIH
RL14_CHLTA      MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRDVEPDSSVKKGDVVKAVIVRTRNDIH
RL14_CHLT2      MIQQESQLKVADNTGAKKVKCFKVLGGSRRRYATVGDVIVCSVRDIEPDSSVKKGDVVKAVIVRTRNDIH
RL14_BAUCH      MIQEQTMLTVADNSGARRVMCIKVLGGSCRRYASIGDVIKITIKEAIPRGKVKKGDVLKAVIVRTKKGVR
RL14_ACISJ      MIQTESRLDVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSVKEAAPRGRVKKGEVYSAVVVRTAKGIR
RL14_ACICJ      MIIVESNLDVADNSGARRVQCIKVLGGSKRRTASVGDVIVVSIKDAIPRGKVKKGDVHQAVVVRTAYPVR
RL14_SINMW      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_SILST      MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKEAIPRGRVKKGDVRKAVVVRTAKEVR
RL14_SILPO      MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKEAIPRGRVKKGDVRKAVVVRTAKEVR
RL14_SHESA      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_SERP5      MIQEQTMLTVADNSGARRVMCIKVLGGSHRRYAGIGDVIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_RHOFD      MIQVESRLEVADNTGAKSVLCIKVLGGSKRRYASVGDVIKVSIKEAAPRGRVKKGEIYSAVVVRTAKGIR
RL14_RHIME      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_PARUW      MIQQESELEVADNSGAKRVKCFKVLGGSKRRYAHVGDIVVASVQDAHPEGSXXXXXXXXXXIIRTKSYIK
RL14_NEIMF      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_NEIMB      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_NEIMA      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_NEIM0      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_NEIG2      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAVPRGRVKKGDVYNAVVVRTAKGVR
RL14_NEIG1      MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKDAVPRGRVKKGDVYNAVVVRTAKGVR
RL14_JANSC      MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDVIVVSVKEAIPRGRVKKGDVRKAVVVRTAKEVR
RL14_HAEDU      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_DICT6      MIMPQTRLVVADNTGAKEIMCFRILGKKRV--AQVGDIIVASVKEAVPRSNIKKGDVVYAVVIRTKRTIK
RL14_DELAS      MIQTESRLEVADNTGAKSVQCIKVLGGSHRRYASVGDIIKVTIKEAAPRGRVKKGEVYSAVVVRTAKGIR
RL14_CAMHC      MIQSFTRLAVADNSGAKELMCIKILGGSKRRYATVGDIIVCSVKKALPNGKIKRGQVVKAVVVRTKKELH
RL14_AGRT5      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_ACTPJ      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ACTP7      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RK14_SCEOB      MIQPQSYLNVADNSGARKLMCIRVLGGGR-QTATIGDVIIAVVKDALPNMPLKKSDVVRAVIVRTSKGVR
RL14_VIBHB      MIQMQSMLDAADNSGARSVMCIKVLGGSHRRYAHIGDVIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_SYNJB      MIQQQTMLTVADNTGARKMMCIRVLGSSGRRYASLGDVIIGVVKDALPNMPVKKSDVVKAVVIRTVDTVR
RL14_STRMK      MIQMQSYLDVADNSGAKQVMCFKVLGGSKRRYAGIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_STRM5      MIQMQSYLDVADNSGAKQVMCFKVLGGSKRRYAGIGDIIKVTVKDAIPRGKVKKGEVYDAVVVRTRKGVR
RL14_SHEAM      MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKEAIPRAKAKKGDVYNAVVVRTKKGVR
RL14_ROSDO      MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKEAIPRGRVKKGDVRKAVVVRTAKEVR
RL14_RHORT      MIQMQTRLDVADNSGARQVQCIKVLGGSKRMIAGVGDIIVVSVKEAIPRGRVKKGDVHRAVIVRTAKEIR
RL14_RHOPS      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYATVGDVIVVSIKEAIPRGKVKKGDVMKAVVVRVRKDIR
RL14_RHOP5      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYATVGDVIVVSIKEAIPRGKVKKGDVMKAVVVRVRKDIR
RL14_RHOP2      MIQMQTNLDVADNSGARRVMCIKVLGGSKRRYATVGDVIVVSIKEAIPRGKVKKGDVMKAVVVRVRKDIR
RL14_RHIL3      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASIGDVIVVSIKEAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_PASMU      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_MYCHJ      MLQELSRLNVADNTGAKIVGVIRNLGGSVKKTSNIGDIVVVSVKKAIPNGMLKEGQVVKALIVRSTYGLR
RL14_MYCH7      MLQELSRLNVADNTGAKIVGVIRNLGGSVKKTSNIGDIVVVSVKKAIPNGMLKEGQVVKALIVRSTYGLR
RL14_MYCH2      MLQELSRLNVADNTGAKIVGVIRNLGGSVKKTSNIGDIVVVSVKKAIPNGMLKEGQVVKALIVRSTYGLR
RL14_LEPBP      MIQQETILQVADNSGVKKVMCVKVLGGSKKRYATLGDEIIVAVKEAQPAYGLRDGQGKKVHNKRTKKEVR
RL14_LEPBA      MIQQETILQVADNSGVKKVMCVKVLGGSKKRYATLGDEIIVAVKEAQPAYGLRDGQGKKVHNKRTKKEVR
RL14_KLEP7      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HAEIN      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HAEIG      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HAEIE      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HAEI8      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_DINSH      MIQMQTNLDVADNSGARRVQCIKVLGGSKRKYASVGDIIVVSVKEAIPRGRVKKGDVRKAVVVRTAKEVR
RL14_CITK8      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_CHRVO      MIQMQTMLEVADNTGARHVQCIKVLGGSKRRYASVGDIIKVSIKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_BUCBP      MIQEQSILNVADNSGARLAMCIKVLGGSRRRYAGIGDIIKISIKEAIPRGKVKKGEVFKAVIIRTKKGVK
RL14_BUCAT      MIQEQTILHVADNSGARSAMCIKVLGGSRRRYAAIGDVIKITIKEAIPRGKVKKGEVLKAVVVRTKKGVR
RL14_BUCAI      MIQEQTILHVADNSGARSAMCIKVLGGSRRRYAAIGDVIKITIKEAIPRGKVKKGEVLKAVVVRTKKGVR
RL14_BUCA5      MIQEQTILHVADNSGARSAMCIKVLGGSRRRYAAIGDVIKITIKEAIPRGKVKKGEVLKAVVVRTKKGVR
RL14_BART1      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSVKDAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_BARQU      MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSVKDAIPRGRVKKGDVMKAVVVRTAKDIR
RL14_ARCB4      MIQSFTRLNVADNTGAKEIMCIKVLGGSKRRYATVGDVIVASVKKALPTGKIKKGQVVKAVVVRTHKEVQ
RL14_ACTSZ      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_TREPS      MIQVQSRLNVADNSGARLVQCIKVVGGSRRRYASVGDIIVVAVKDALPTSVIKKGSVEKAVIVRVSKEYR
RL14_TREPA      MIQVQSRLNVADNSGARLVQCIKVVGGSRRRYASVGDIIVVAVKDALPTSVIKKGSVEKAVIVRVSKEYR
RL14_SYNAS      MIQMQTVLNVADNSGAKKVACIKVLGGSKRRYAGVGDVIVVAVKEAMPNSKVKKGDVMKAVIVRTAKEVR
RL14_SHISS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SHIFL      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SHIF8      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SHIDS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SHIBS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_SHIB3      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_NITEU      MIQMQSLLKVADNTGARTVMCIKVLGGSKRRFAGIGDVIKVAVKDAAPRGRIKRGEVYNAVIVRTAKGIR
RL14_NITEC      MIQMQSLLKVADNTGARTVMCIKVLGGSKRRFAGIGDVIKVAVKDAAPRGRIKKGEVYNAVIVRTAKGIR
RL14_GEOSM      MIQMQTLLDVADNSGAKKLFCIKVLGGSKRRYAGIGDIIVASVKEALPNSXXXXXXXXXXXXXXXXXXXG
RL14_GEOBB      MIQMQTLLDVADNSGAKKLFCIKVLGGSKRRYAGIGDIIVASVKEALPNSXXXXXXXXXXXXXXXXXXXG
RL14_ESCF3      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_EDWI9      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOUT      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOSM      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOSE      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOLU      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOLI      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOLC      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOL6      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOK1      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOHS      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECODH      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECOBW      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO8A      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO81      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO7I      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO5E      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO57      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO55      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO45      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO27      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ECO24      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_DECAR      MIQMQTTLDVADNTGARSVMCIKVLGGSRRRYAGIGDIIKVSIKDAAPRGRVKKGDVYNAVVVRTAKGVR
RL14_VIBVY      MIQMQSMLDAADNSGARSVMCIKVLGGSHRRYAHIGDVIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_VIBVU      MIQMQSMLDAADNSGARSVMCIKVLGGSHRRYAHIGDVIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_VIBCM      MIQMQTMLDAADNSGARSVMCIKVLGGSHRRYAHVGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_VIBCH      MIQMQTMLDAADNSGARSVMCIKVLGGSHRRYAHVGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_VIBC3      MIQMQTMLDAADNSGARSVMCIKVLGGSHRRYAHVGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTRKGVR
RL14_PARD8      MIQQESRLVVADNSGAKEALCIRVLGGTRKRYATVGDVIVVAIKSVIPASDVKKGAVSKAIIVRTKKEIR
RL14_NOSP7      MIQPQTYLNVADNSGARKLMCIRVLGGGNRRYGFIGDKIIAVVKDATPNMAVKKSDVVEAVIVRTRKAVS
RL14_HAES2      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_HAES1      MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_ENTS8      MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVR
RL14_CYAP8      MIQQQTYLNVADNSGA