[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00286.1

[Show Plain Result]


## Summary of Sequence Search
    1::296
    1::278     6e-50  37%  283 aa  YJBO_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   39::300     6e-40  38%  303 aa  YLYB_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   58::296     3e-38  38%  302 aa  YHCT_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   41::307     5e-36  36%  316 aa  Y1758_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
   85::334     2e-35  39%  344 aa  RLUD_NITEU RecName: Full=Ribosomal large subunit pseudouridine
   81::311     8e-34  41%  317 aa  RLUD_ZYMMO RecName: Full=Ribosomal large subunit pseudouridine
   37::319     3e-33  37%  327 aa  Y723_CHLP8 RecName: Full=Uncharacterized RNA pseudouridine synthase
   42::313     5e-33  38%  325 aa  RLUD_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   51::311     3e-32  35%  316 aa  Y901_CHLAA RecName: Full=Uncharacterized RNA pseudouridine synthase
   89::319     7e-32  41%  331 aa  RLUD_XYLFT RecName: Full=Ribosomal large subunit pseudouridine
   89::319     2e-31  41%  331 aa  RLUD_XYLFA RecName: Full=Ribosomal large subunit pseudouridine
   33::297     5e-31  37%  326 aa  RLUD_BORBU RecName: Full=Ribosomal large subunit pseudouridine
   42::313     8e-31  37%  325 aa  RLUD_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   62::323     1e-30  36%  327 aa  Y1629_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
  100::350     9e-30  37%  358 aa  RLUD_RALSO RecName: Full=Ribosomal large subunit pseudouridine
   89::319     3e-29  39%  331 aa  RLUD_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   71::312     2e-28  37%  324 aa  RLUD_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   49::319     2e-27  34%  331 aa  RLUD_XANAC RecName: Full=Ribosomal large subunit pseudouridine
   61::312     2e-27  36%  312 aa  RLUD_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   67::302     7e-27  35%  309 aa  Y292_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
   82::312     7e-27  38%  324 aa  RLUD_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   42::309     1e-26  35%  326 aa  RLUD_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   42::309     1e-26  35%  326 aa  RLUD_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   77::319     1e-26  34%  321 aa  RLUD_BLOFL RecName: Full=Ribosomal large subunit pseudouridine
   53::333     2e-26  36%  374 aa  RLUD_NEIMB RecName: Full=Ribosomal large subunit pseudouridine
   64::333     3e-26  37%  374 aa  RLUD_NEIMA RecName: Full=Ribosomal large subunit pseudouridine
   42::305     2e-25  34%  325 aa  RLUD_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   81::426     2e-25  34%  430 aa  PUS2_ARATH RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   42::312     7e-25  36%  320 aa  RLUD_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   48::314     7e-25  35%  315 aa  RLUD_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   43::313     1e-24  32%  324 aa  RLUD_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   99::425     3e-24  36%  445 aa  PUS2_ORYSJ RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   45::312     4e-24  33%  315 aa  RLUC_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
    4::215     1e-23  36%  219 aa  RLUA_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    4::215     1e-23  36%  219 aa  RLUA_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   85::313     1e-23  34%  317 aa  RLUD_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   45::312     1e-23  34%  315 aa  RLUC_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   90::317     1e-23  33%  320 aa  RLUC_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
    4::215     1e-23  36%  219 aa  RLUA_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   83::313     2e-23  35%  325 aa  RLUD_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   26::313     2e-23  32%  315 aa  RLUC_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
    2::320     2e-23  32%  326 aa  RLUC_PASMU RecName: Full=Ribosomal large subunit pseudouridine
    4::214     2e-23  37%  219 aa  RLUA_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   44::309     2e-23  34%  326 aa  RLUD_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    4::214     3e-23  37%  219 aa  RLUA_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    4::215     5e-23  36%  219 aa  RLUA_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   95::317     1e-22  36%  319 aa  RLUC_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   95::317     1e-22  36%  319 aa  RLUC_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
  150::364     2e-22  33%  462 aa  YDL36_YEAST RecName: Full=Uncharacterized protein YDL036C;
   95::317     2e-22  36%  319 aa  RLUC_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   95::317     2e-22  36%  319 aa  RLUC_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   95::317     5e-22  36%  319 aa  RLUC_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   15::209     5e-22  37%  250 aa  RLUA_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   95::317     7e-22  36%  319 aa  RLUC_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    3::203     7e-22  37%  206 aa  RLUA_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   12::319     2e-21  31%  322 aa  RLUC_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   46::298     2e-21  29%  327 aa  Y745_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   14::209     3e-21  38%  219 aa  RLUA_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   44::309     1e-20  33%  326 aa  RLUD_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   44::309     1e-20  33%  326 aa  RLUD_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   44::309     1e-20  33%  326 aa  RLUD_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
  134::305     2e-20  36%  308 aa  Y1567_MYCBO RecName: Full=Uncharacterized RNA pseudouridine
  134::305     2e-20  36%  308 aa  Y1540_MYCTU RecName: Full=Uncharacterized RNA pseudouridine
   10::204     2e-20  38%  245 aa  RLUA_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   34::306     3e-20  35%  318 aa  RLUC_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   14::219     3e-20  36%  222 aa  RLUA_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
  156::348     4e-20  33%  591 aa  RIB2_YEAST RecName: Full=DRAP deaminase;
   15::209     8e-20  35%  250 aa  RLUA_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   78::298     1e-19  29%  327 aa  Y745_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
    1::239     1e-19  32%  246 aa  TRUC_VIBPA RecName: Full=tRNA pseudouridine synthase C;       
   15::291     1e-19  32%  315 aa  RLUC_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
    3::216     1e-19  37%  243 aa  TRUC_HAEDU RecName: Full=tRNA pseudouridine synthase C;       
    3::217     2e-19  36%  243 aa  TRUC_PASMU RecName: Full=tRNA pseudouridine synthase C;       
   12::226     5e-19  33%  242 aa  Y956_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
    8::213     5e-19  34%  219 aa  Y505_ZYMMO RecName: Full=Uncharacterized RNA pseudouridine synthase
   14::216     5e-19  35%  219 aa  RLUA_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   12::226     9e-19  34%  242 aa  Y956_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
  231::411     1e-18  32%  553 aa  RUSD2_MOUSE RecName: Full=RNA pseudouridylate synthase
    5::211     4e-18  34%  293 aa  RUSD1_DANRE RecName: Full=RNA pseudouridylate synthase
   45::310     5e-18  29%  314 aa  RLUC_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
  147::333     6e-18  30%  432 aa  YK27_CAEEL RecName: Full=Uncharacterized protein K07E8.7;
   37::288     6e-18  31%  305 aa  RLUC_RICFE RecName: Full=Ribosomal large subunit pseudouridine
   93::292     1e-17  35%  314 aa  RLUC_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
  218::398     1e-17  32%  545 aa  RUSD2_HUMAN RecName: Full=RNA pseudouridylate synthase
    5::213     2e-17  36%  306 aa  RUSD1_MOUSE RecName: Full=RNA pseudouridylate synthase
  116::325     3e-17  37%  376 aa  TRUC_PECCC RecName: Full=tRNA pseudouridine synthase C;       
   76::295     3e-17  29%  303 aa  RLUC_RICTY RecName: Full=Ribosomal large subunit pseudouridine
   76::295     3e-17  28%  303 aa  RLUC_RICPR RecName: Full=Ribosomal large subunit pseudouridine
   34::272     5e-17  29%  308 aa  Y209_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
   80::291     7e-17  31%  323 aa  Y370_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
   95::264     9e-17  37%  320 aa  RLUC_YERPE RecName: Full=Ribosomal large subunit pseudouridine
  120::340     9e-17  35%  404 aa  PUS6_YEAST RecName: Full=Pseudouridylate synthase 6;       
    2::235     1e-16  31%  245 aa  TRUC_VIBVU RecName: Full=tRNA pseudouridine synthase C;       
   67::279     2e-16  29%  394 aa  YA32_SCHPO RecName: Full=Uncharacterized protein C18B11.02c;
   37::287     2e-16  31%  303 aa  RLUC_RICCN RecName: Full=Ribosomal large subunit pseudouridine
   37::259     3e-16  31%  301 aa  RLUC_RICBR RecName: Full=Ribosomal large subunit pseudouridine
    2::215     6e-16  33%  257 aa  TRUC_YERPE RecName: Full=tRNA pseudouridine synthase C;       
    2::215     1e-15  35%  260 aa  TRUC_ECOL6 RecName: Full=tRNA pseudouridine synthase C;       
    2::215     2e-15  35%  260 aa  TRUC_SHIFL RecName: Full=tRNA pseudouridine synthase C;       
    2::215     2e-15  35%  260 aa  TRUC_ECOLI RecName: Full=tRNA pseudouridine synthase C;       
    2::215     2e-15  35%  260 aa  TRUC_ECO57 RecName: Full=tRNA pseudouridine synthase C;       
  114::316     2e-15  36%  397 aa  PUS5_ORYSJ RecName: Full=RNA pseudourine synthase 5;       
   58::295     2e-15  34%  369 aa  PUS5_ARATH RecName: Full=RNA pseudourine synthase 5;       
    2::231     2e-15  32%  239 aa  TRUC_HAEIN RecName: Full=tRNA pseudouridine synthase C;       
    2::231     4e-15  30%  244 aa  TRUC_VIBCH RecName: Full=tRNA pseudouridine synthase C;       
    5::213     8e-15  35%  312 aa  RUSD1_HUMAN RecName: Full=RNA pseudouridylate synthase
   63::240     7e-14  31%  293 aa  Y347_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   98::311     7e-14  34%  395 aa  PUS7_ARATH RecName: Full=RNA pseudourine synthase 7;       
   86::334     7e-14  37%  345 aa  PUS1_ORYSJ RecName: Full=RNA pseudourine synthase 1;       
   63::240     9e-14  32%  298 aa  Y347_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
    5::213     2e-13  33%  308 aa  RUSD1_BOVIN RecName: Full=RNA pseudouridylate synthase
   40::314     2e-12  27%  326 aa  Y548_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
  185::376     4e-12  33%  477 aa  PUS4_ARATH RecName: Full=RNA pseudourine synthase 4, mitochondrial;
    3::185     1e-11  28%  224 aa  Y042_HAEIN RecName: Full=Uncharacterized RNA pseudouridine synthase
  111::284     3e-11  32%  393 aa  PUS7_ORYSJ RecName: Full=RNA pseudourine synthase 7;       
    2::221     9e-11  33%  260 aa  TRUC_SALTY RecName: Full=tRNA pseudouridine synthase C;       
    2::221     9e-11  33%  260 aa  TRUC_SALTI RecName: Full=tRNA pseudouridine synthase C;       
   77::295     6e-10  31%  302 aa  Y714_MYCCT RecName: Full=Uncharacterized RNA pseudouridine synthase
  115::403     1e-09  34%  475 aa  PUS3_ORYSJ RecName: Full=RNA pseudourine synthase 3, mitochondrial;
   99::292     2e-09  32%  377 aa  RUSD4_HUMAN RecName: Full=RNA pseudouridylate synthase
  179::345     3e-09  32%  448 aa  PUS4_ORYSJ RecName: Full=RNA pseudourine synthase 4, mitochondrial;
   51::248     4e-09  30%  324 aa  RUSD4_XENTR RecName: Full=RNA pseudouridylate synthase
   99::292     7e-09  31%  377 aa  RUSD4_RAT RecName: Full=RNA pseudouridylate synthase
   24::276     9e-09  27%  291 aa  Y1592_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
   76::316     9e-09  33%  322 aa  PUS1_ARATH RecName: Full=RNA pseudourine synthase 1;       
    4::190     1e-08  31%  254 aa  PUS5_YEAST RecName: Full=Pseudouridylate synthase PUS5;       
  183::405     3e-08  30%  478 aa  PUS3_ARATH RecName: Full=RNA pseudourine synthase 3, mitochondrial;
   92::284     4e-08  28%  358 aa  RUSD4_DANRE RecName: Full=RNA pseudouridylate synthase
   99::292     7e-08  30%  377 aa  RUSD4_BOVIN RecName: Full=RNA pseudouridylate synthase
   99::292     3e-07  29%  377 aa  RUSD4_MOUSE RecName: Full=RNA pseudouridylate synthase
  208::394     8e-07  30%  477 aa  PUS6_ORYSJ RecName: Full=RNA pseudourine synthase 6, chloroplastic;
    5::221     1e-06  30%  223 aa  PUS5_CANGA RecName: Full=Pseudouridylate synthase PUS5;       
 7058::7167    2e-06  42% 10061 aa  MLRR1_PLAF7 RecName: Full=MATH and LRR domain-containing protein
    4::148     2e-06  28%  290 aa  RLUF_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    4::148     4e-06  28%  290 aa  RLUF_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    3::148     5e-06  29%  289 aa  RLUF_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    4::148     5e-06  29%  290 aa  RLUF_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    4::148     5e-06  28%  290 aa  RLUF_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    3::148     7e-06  28%  289 aa  RLUF_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   98::202     7e-06  36%  244 aa  RLUB_BACSU RecName: Full=Ribosomal large subunit pseudouridine
    3::201     3e-05  28%  249 aa  Y1464_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
   79::191     6e-05  32%  241 aa  RLUE_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   64::171     8e-05  34%  260 aa  PUS5_ASHGO RecName: Full=Pseudouridylate synthase PUS5;       
   48::135     3e-04  34%  374 aa  QUEA_PROMP RecName: Full=S-adenosylmethionine:tRNA
  117::208     6e-04  34%  256 aa  Y1370_MYCLE RecName: Full=Uncharacterized RNA pseudouridine
    1::296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
YJBO_BACSU      ------------MTVKEYAGELGISKRLLTDIKFGGGDLQINGEHVTVKYVLKEGDLLIVFPEEQVSETL
YLYB_BACSU      -----------------------------------DGQVVVNGSAVKANYKIQPGDQVTVTVPEPEALDV
YHCT_BACSU      ---------------------------------------------------VKKGDRVFIDLQESEASSV
Y1758_AQUAE     ------------------------------------GLVYVNGEERKPSRKLREGERVILHVPEPEPLDV
RLUD_NITEU      ----------------------------------------------------GGESIRVIAGQTENDQSH
RLUD_ZYMMO      ----------------------------------------------------------------------
Y723_CHLP8      ------------------------------------GRVLVNGKPVKSNYRVKSCDLTFLRPPELAPEDI
RLUD_VIBVU      -----------------------------------DGKVTVDGKPRT---KVMGGEVITVLAELEDEVRW
Y901_CHLAA      ------------------------------------GFVLYDGRSPRASQPVRPGAVIQLTIPPPIPTEL
RLUD_XYLFT      ----------------------------------------------------------------------
RLUD_XYLFA      ----------------------------------------------------------------------
RLUD_BORBU      -----------------------IKRRNVEAFKKSNGKFL----KIKLSKPVFKDDEILIEFDEESSQIL
RLUD_YERPE      -----------------------------------DSRVTVNGKKINKPKEVLGGELVAIDAQIEEDARW
Y1629_SYNY3     -----------------------------------NGLVCQD---KNLILKTGDRLVVNI--PELIPLDV
RLUD_RALSO      --------------------------------------------------------------PQRADDEN
RLUD_XANCP      ----------------------------------------------------------------------
RLUD_PASMU      ------------------------------------------------------------------DDDT
RLUD_XANAC      -----------------------------------SGDALLDGEMARPRDTLRGGESVQVQVVLETQTHA
RLUD_BUCAI      ------------------------------------------------------GGETLTIHPFSKDLLV
Y292_MYCPN      ---------------------------------------------------------------EKVPVEV
RLUD_HAEIN      ----------------------------------------------------------------------
RLUD_SALTY      -----------------------------------NQRVLVNGQLCDKPKEKVLGGERVAIDAE-IDEEI
RLUD_SALTI      -----------------------------------NQRVLVNGQLCDKPKEKVLGGERVAIDAE-IDEEI
RLUD_BLOFL      -------------------------------------------------------------------EDI
RLUD_NEIMB      ------------------------SRSRLTSWIKEGAVIVNDKPSQPKDKMIGGEQICVTVRP--SEENL
RLUD_NEIMA      ------------------------------------GAVIVNDKPSQPKDKIGGEQIRVTVRP--SEENL
RLUD_VIBPA      -----------------------------------DGKVQVNGEVVTKPRTKVMGGEEITLQAELEDEER
PUS2_ARATH      -----------KIRLDSWISSRGVSRRVQSSIRLGNGRVVDKVSHNVKSGDEVNCTISELQPLKAEAEDI
RLUD_PSEAE      -----------------------------------DGRLTVDGAVLRPRDIVHSGA-QLVLEAEQEAQGE
RLUD_BUCAP      -----------------------------------NGKIENQPDKKIL----GGEKITIYSTDEKLPINL
RLUD_VIBCH      ------------------------------------GKIAVNGKPRT---KVMGGEVITVQAELEDEQRW
PUS2_ORYSJ      ------------------------------------GLVVVNGRPVSVSHMVKGGDIVSCTVLELQPLRA
RLUC_VIBPA      ------------------------------------GEVRVNKKRIKAEYKLKAGDLVRIPPVEKKEEDV
RLUA_SHIFL      -------------------------------------------------------------------ENY
RLUA_ECOLI      -------------------------------------------------------------------ENY
RLUD_BUCBP      ----------------------------------------------------------------------
RLUC_VIBVU      ------------------------------------GEVRVNKKRVKAEYKLAAGDVVRIPPVEKKDPST
RLUC_HAEDU      ----------------------------------------------------------------------
RLUA_ECOL6      -------------------------------------------------------------------ENY
RLUD_HAEDU      ----------------------------------------------------------------------
RLUC_VIBCH      --------------LRNQLKNKSVVYRIL---RKGEVRVNKKRVKAEYKLEAGDXXXXXXXPAPPSTKLS
RLUC_PASMU      -----NQKKDEKLTISEDEAGQRIDNYLLAKLK-GVPKSLIYRILRKGEVRVNKGRIKVRVPPVRVSEKE
RLUA_SALTI      -------------------------------------------------------------------ENY
RLUD_ECOLI      -------------------------------------RVLVNGKVCDKPKEKVLGGEQVAINAEIEEERF
RLUA_SALTY      -------------------------------------------------------------------ENY
RLUA_ECO57      -------------------------------------------------------------------ENY
RLUC_SHIFL      ----------------------------------------------------------------------
RLUC_ECOLI      ----------------------------------------------------------------------
YDL36_YEAST     -----------------------------------NGDVHINDETADLSTVIRNGDL---ITHQVHRHEP
RLUC_ECOL6      ----------------------------------------------------------------------
RLUC_ECO57      ----------------------------------------------------------------------
RLUC_SALTY      ----------------------------------------------------------------------
RLUA_VIBPA      ----------------------------------------------------------------------
RLUC_SALTI      ----------------------------------------------------------------------
RLUA_YERPE      ----------------------------------------------------------------------
RLUC_HAEIN      --------SVKMLTISEDESGQRIDNYLLAKLK-GVPKSLIYRIVRKGEVRVNKGRIVVRIPPEKNDAPI
Y745_HELPJ      -------------------------------------------KKGGLALKEGDA-ITLLTPKIVPKPLK
RLUA_PASMU      ----------------------------------------------------------------------
RLUD_SHIFL      -------------------------------------RVLVNGKVCDKPKEKVLGGEQVAINAEIEEERF
RLUD_ECOL6      -------------------------------------RVLVNGKVCDKPKEKVLGGEQVAINAEIEEERF
RLUD_ECO57      -------------------------------------RVLVNGKLCDKPKEKVLGGEQVAINAEIEEERF
Y1567_MYCBO     ----------------------------------------------------------------------
Y1540_MYCTU     ----------------------------------------------------------------------
RLUA_VIBCH      ----------------------------------------------------------------------
RLUC_PSEAE      ---------------------------------KGAPKTLIYRILRKGEVRVNKGRIKVRVPPAERDEPA
RLUA_HAEDU      ----------------------------------------------------------------------
RIB2_YEAST      ----------------------------------------------------------------------
RLUA_VIBVU      ----------------------------------------------------------------------
Y745_HELPY      ----------------------------------------------------------------------
TRUC_VIBPA      ----------------------------------------------------------------------
RLUC_BUCBP      -------ENSEKQRIDNFLRKKRLPFNLICKIIR-TGQIRINKKRINQNYKLKLGDSVRIPPITQSDSNK
TRUC_HAEDU      ----------------------------------------------------------------------
TRUC_PASMU      ----------------------------------------------------------------------
Y956_HELPJ      ---------------------ENISHKKAKALID-SGLVSIGGQK----LMVARKEL-----PQNTRFSV
Y505_ZYMMO      ----------------------------------------------------------------------
RLUA_HAEIN      ----------------------------------------------------------------------
Y956_HELPY      ---------------------ENISHKKAKALID-SGLVSIGGKK----LMVARKEL-----PKNTHFSV
RUSD2_MOUSE     ----------------------------------------------------------------------
RUSD1_DANRE     ----------------------------------------------------------------------
RLUC_BUCAI      ------------------------------------GKIRINKKRIKPHYKLKIGDI-LKIPPIKILCDI
YK27_CAEEL      ----------------------------------------------------------------------
RLUC_RICFE      -------------------------------------QITVNSQKAEASLRVKGGDKIFILPPEKTDAEI
RLUC_BUCAP      ----------------------------------------------------------------------
RUSD2_HUMAN     ----------------------------------------------------------------------
RUSD1_MOUSE     ----------------------------------------------------------------------
TRUC_PECCC      ----------------------------------------------------------------------
RLUC_RICTY      -----------------------------------------------------------------ADAEI
RLUC_RICPR      -----------------------------------------------------------------ADAEI
Y209_MYCGE      -----------------------------------NGQIKVNEKLTKNSLIVAKDDVIKVEIHDETTSDF
Y370_MYCGE      --------------------------------------------------------------------SL
RLUC_YERPE      ----------------------------------------------------------------------
PUS6_YEAST      ----------------------------------------------------------------------
TRUC_VIBVU      ----------------------------------------------------------------------
YA32_SCHPO      -----------------------------------NGQVKVNNQIGNVDTLIENG---YIVSHHAHRHEP
RLUC_RICCN      -------------------------------------QITVNAQKAEASLRVKGGDKIFILPPEKTDAEI
RLUC_RICBR      -------------------------------------QIIVNSKKAEASLRVVEGKFNLIAQPTKTDAEI
TRUC_YERPE      ----------------------------------------------------------------------
TRUC_ECOL6      ----------------------------------------------------------------------
TRUC_SHIFL      ----------------------------------------------------------------------
TRUC_ECOLI      ----------------------------------------------------------------------
TRUC_ECO57      ----------------------------------------------------------------------
PUS5_ORYSJ      ----------------------------------------------------------------------
PUS5_ARATH      -----------------------------------NGQIQIDG-------EVVKDPNTLLRSGSKLVYSR
TRUC_HAEIN      ----------------------------------------------------------------------
TRUC_VIBCH      ----------------------------------------------------------------------
RUSD1_HUMAN     ----------------------------------------------------------------------
Y347_HELPJ      ----------------------------------------------------------------------
PUS7_ARATH      -----------------------------------SGRIKVDGEIVPVSYIVKSSKITHFLPPVMIDDVV
PUS1_ORYSJ      ----------------------------------------------------------------------
Y347_HELPY      ----------------------------------------------------------------------
RUSD1_BOVIN     ----------------------------------------------------------------------
Y548_MYCPN      ------------------------------------GKVLLNNTKAKLGQRVSSGDTIVFLHNHSEVVDL
PUS4_ARATH      ----------------------------------------------------------------------
Y042_HAEIN      ----------------------------------------------------------------------
PUS7_ORYSJ      ----------------------------------------------------------------------
TRUC_SALTY      ----------------------------------------------------------------------
TRUC_SALTI      ----------------------------------------------------------------------
Y714_MYCCT      ----------------------------------------------------------------------
PUS3_ORYSJ      -----------------------VSVETIKSLKKKHNDVMEPGMRIHLPVSVAEGEITATLHPNK-DEIE
RUSD4_HUMAN     ----------------------------------------------------------------------
PUS4_ORYSJ      ----------------------------------------------------------------------
RUSD4_XENTR     ----------------------------------------------------------------------
RUSD4_RAT       ----------------------------------------------------------------------
Y1592_SYNY3     ------------------------------------GQIEVDGKTVDPTYPLQAGQTLTYWRSPWVEPEV
PUS1_ARATH      ----------------------------------------------------------------------
PUS5_YEAST      ----------------------------------------------------------------------
PUS3_ARATH      ----------------------------------------------------------------------
RUSD4_DANRE     ----------------------------------------------------------------------
RUSD4_BOVIN     ----------------------------------------------------------------------
RUSD4_MOUSE     ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
PUS5_CANGA      ----------------------------------------------------------------------
MLRR1_PLAF7     ----------------------------------------------------------------------
RLUF_ECOLI      ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQL
RLUF_SHIFL      ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDIV------KVNGQL
RLUF_SALTY      --------TDTSTRLNKYISESGICSRREADRFIEQGNVFINGKRAAIGDQVVAGDIVKVIEPREADDLV
RLUF_ECOL6      ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVIEPRES----
RLUF_ECO57      ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQL
RLUF_SALTI      --------TDTSTRLNKYISESGICSRREADRFIEQGNVFINGKRAAIGDQVVAGDVVKVIEPREADDLV
RLUB_BACSU      ----------------------------------------------------------------------
Y1464_AQUAE     -----------EVRINKFLSEAGVASRRKAEKLILEGRVKVNGEVRSLGVKVNP-EVDIV---EVDGKPV
RLUE_PASMU      ----------------------------------------------------------------------
PUS5_ASHGO      ----------------------------------------------------------------------
QUEA_PROMP      ---------EEDFTTNKYTKN------LLDELRKGDLVVVNDTKKARLKVELENGKLVELLVLEKADQ--
Y1370_MYCLE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
YJBO_BACSU      LAEPVPLDILYEDEHVLVINKQPYVSSIPSREHPSGSIANGIIDH-YQTTGVRATVHLVTRLDRDTSGIM
YLYB_BACSU      LAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLVNGLMAHCTDLSGINGVPGIVHRIDKDTSGLL
YHCT_BACSU      IPEYGELDILFEDNHMLIINKPAGIATHPNEDGQTGTLANLIAYHYQINGETCKVRHV-HRLDQDTSGAI
Y1758_AQUAE     KPENIPINIIYEDEDIAVVEKPCGLVVHPSPGYTSGTLVNALLYHIKDLSSIGGVPGIVHRLDKETAGVM
RLUD_NITEU      QAEAIPLKILFEDDHLIIIDKPAGLVVHPGNGNWHGTLLNALLNHAPQLSQ---VPRIVHRLDKDTTGLL
RLUD_ZYMMO      -----PLEIVFEDEHLLVVNKPAGMVVHPAAGNYDNTLVNALLYHCAGKLSGIARPGIVHRIDKDTSGLL
Y723_CHLP8      -----PITILYEDDDLMVIDKEAGMVVHPAFGNWTGTLANAILHHLGKDADEEMRPGIVHRLDKDTSGLI
RLUD_VIBVU      EAQDIPLDIVYEDDDILVINKPRDFVVHPGAGTPDGTVLNALLFHCPEVAE---VPRIVHRLDKDTTGLM
Y901_CHLAA      VAEPIPLDVVYEDADIAVINKPAGMVVHPAPGHPRGTLVNALLARYPDLAGGELRPGIVHRLDRDTSGLL
RLUD_XYLFT      -----PLDILYEDEHVFVINKPAGLVVHPGAGNPDGTLVNAL---LHRDPALAAVPRVVHRLDKDTSGVM
RLUD_XYLFA      -----PLDILYEDEHVFVLNKPAGLVVHPGAGNPDGTLVNAL---LHRDPALAAVPRVVHRLDKDTSGVM
RLUD_BORBU      RPSNIPIAIIYEDSNVIVLNKPQGILSHPGISHWDDTVVNFLLYHIKSLKEEKIRPGIVHRLDKDTSGVL
RLUD_YERPE      APQEIPLDIVYEDNDILVINKPRGLVVHPGAGNPDGTVLNAL-LHYYPEIMDVPRAGIVHRLDKDTTGLM
Y1629_SYNY3     VAQNIPLDILYEDEQLIIINKPAGLVVHPGPGHPDGTVVNALLAHCPDLAGIGGVPGIVHRLDKDTTGAM
RLUD_RALSO      AFVAEPLDVVYEDDTLLVINKPAGLVVHPAAGNWSGTVLNGL-LHRYPQAAGLPRAGIVHRLDKETSGLM
RLUD_XANCP      -----PLNVLYEDDHVLVIDKPAGLVVHPGAGNPDGTLVNAL---LFRDPNLAAVPRVVHRLDKDTSGVM
RLUD_PASMU      RFEPEPLNIVYEDDDILVINKPKDFVVHPGAGNASGTVLNALLYHY---PAIAEVPRIVHRLDKDTTGLM
RLUD_XANAC      APQDIPLSVLYEDEQVLVIDKPAGLVVHPGAGNPDRTLVNAL---LFRDPALASVPRVVHRLDKDTSGVM
RLUD_BUCAI      DIPENILDIVYEDSDILIINKPAGLVVHPGSGNKSGTILNALLYH--YKNSKDLPAGIVHRLDKDTSGLM
Y292_MYCPN      QPYDFPLDILYEDEQIMVVNKPNGLISHPTSFNESESLLGAALFHCNHQPV-----FLVHRLDRDTSGVI
RLUD_HAEIN      -----PLNIVYEDDDIIVINKPKDLVVHPGAGNPNGTVLNALLYHYPPIVE---VPRIVHRLDKDTTGLM
RLUD_SALTY      RFEAQPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
RLUD_SALTI      RFEAQPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
RLUD_BLOFL      VPQNIPLNIIYEDNDILVINKASNMVVHPGIGHYQGTVLNALLYRYPSILKISKQAGIVQRLDKDTTGLM
RLUD_NEIMB      AFVPEPLDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXXXXXXAHCPELSQ---VPRIVHRLDKETSGLM
RLUD_NEIMA      AFVPEPLDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXXXXXXAHC-PELSQIPRAGIVHRLDKETSGLM
RLUD_VIBPA      WEAQDPLXXXXXXXXXXXXNKPRDFVVHPGAGTPDGTVLNALLHH-YPDIAEVPRAGIVHRLDKDTTGLM
PUS2_ARATH      -----PLDIVYEDKHVLVVNKPAHMVVHPAPGNPTGTLVNGILHHCSSSYAASVRPGIVHRLDKGTTGLL
RLUD_PSEAE      WLAQDELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLLNALLYHVPDIAN---VPRIVHRLDKDTTGLM
RLUD_BUCAP      PQNIA-LNTIYEDSNILIINKPPGLVVHPGAGNQDGTILNAL---LYRYTNISSIPRIIHRLDKDTSGLM
RLUD_VIBCH      EAQDLPLNIVYEDDDIIVINKPRDFVVHPGAGQADKTVLNALLFH-YSPIAEVPRAGIVHRLDKDTTGLM
PUS2_ORYSJ      EPEDIPLDIVYEDDHLLVVNKPAHMVVHPAPGNANGTLVNAILHHVSSEVREALVPGIVHRLDKGTSGLL
RLUC_VIBPA      KVAELEHMIIYEDDHMLILNKPSG-TAVHGGSGLKFGAIEALRALRPQARFLELVH----RIDRDTSGIL
RLUA_SHIFL      NPPQEPLVILYQDDHIMVVNKPSGLLSVPGREEHKDSVMTRIQRDYPQAES-------VHRLDMATSGVI
RLUA_ECOLI      NPPQEPLVILYQDDHIMVVNKPSGLLSVPGREEHKDSVMTRIQRDYPQAES-------VHRLDMATSGVI
RLUD_BUCBP      ------LNVIYEDDDILVINKQDNFVVHPGAGNTSGTLLNAL---LHRDSTFFNIPRIVHRLDKDTTGLM
RLUC_VIBVU      KLNKELQDIIYEDDHLLVLNKPSG-TAVHGGSGLKFGAIEALRALRPEARFLELVH----RIDRDTSGIL
RLUC_HAEDU      KVAELEQHILYEDDVMLVLNKPSGIG-VHGGSGLSFGVIEALRALRPQARFLELVH----RIDRDTSGIL
RLUA_ECOL6      NPPQEPLVVLYQDDHIMVVNKPSGLLSVPGREEHKDSVMTRIQRDYPQAES-------VHRLDMATSGVI
RLUD_HAEDU      -----PLNIVHEXXXXXXXNKPKNLVVHPGAGNPDGTVLNALLYY-YPPIAEVPRAGIIHRLDKDTTGLM
RLUC_VIBCH      KVAELEHCIVYEDDHLLILNKPSG-TAVHGGSGLHFGAIEALRALRPQARFLELVH----RIDRDTSGIL
RLUC_PASMU      KVSQLEKQILFEDECLLVLNKPSGIA-VHGGSGLSFGVIEALRTLRPDARFLELVH----RLDRDTSGIL
RLUA_SALTI      NPPQEPLVILYQDEHIMVVNKPSGLLSVPGRLEHKDSIMTRIQRDYPQAES-------VHRLDMATSGVI
RLUD_ECOLI      EPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
RLUA_SALTY      NPPQEPLVILYQDEHIMVVNKPSGLLSVPGRLEHKDSIMTRIQRDYPQAES-------VHRLDMATSGVI
RLUA_ECO57      NPPQEPLVILYQDDHIMVVNKPSGLLSVPGREEHKDSVMTRIQRDYPQAES-------VHRLDMATSGVI
RLUC_SHIFL      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
RLUC_ECOLI      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
YDL36_YEAST     PVTSRPIKVIFEDDNIMVIDKPSGIPVHPTGRYRFNTITKML------QNNLGFVVNPCNRLDRLTSGLM
RLUC_ECOL6      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
RLUC_ECO57      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
RLUC_SALTY      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
RLUA_VIBPA      -------DIVFEDDHILAVNKPSGLLSVPGRAEHHDSMWSRL-----QEEYPDI--QVVHRLDMSTSGLM
RLUC_SALTI      --------ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
RLUA_YERPE      --------VLYQDKHIMVVNKPSGLLSVPGPENK-DSVMTRVQNDFPTAES-------VHRLDMATSGVI
RLUC_HAEIN      KVAALENQILFEDDCLIILNKPSGIA-VHGGSGLNFGVIEALRALRPEARFLELVH----RLDRDTSGIL
Y745_HELPJ      KELDLEIEVIFEDEDXXXXXXXXXXXXHKAPSVKEPTLVDWLKSQNYELSNLGLKERIVHRLDKDTSGGI
RLUA_PASMU      ------LDIVHYDDHFVVINKPSGLLSVPGNQPQYDSAMSRVK-----EKYGFCEP--AHRLDMSTSGLI
RLUD_SHIFL      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
RLUD_ECOL6      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
RLUD_ECO57      EPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLM
Y1567_MYCBO     ---------------------------------------------------------IVHRLDVGTSGVM
Y1540_MYCTU     ---------------------------------------------------------IVHRLDVGTSGVM
RLUA_VIBCH      ---KDPIDVIYEDEHIIAANKPSGLLSVPGPVEHYDSMWARLVDYCPDVK-------VVHRLDMSTSGLI
RLUC_PSEAE      PLAQGLLEIVYEDKALIVVNKPXXXXXXXXXXXXXXXXE---VFRQLRPDAKDI--ELVHRLDRDTSGLL
RLUA_HAEDU      ------LEEVYRDNHIVVINKPSGLLSVPG--NRPDSVMTRV-----QQRYGFAEP--AHRLDMATSGII
RIB2_YEAST      -VTSKPIDIVFEDEDILVIDKPSSIPVHPTGRYRFNTITKMLERQLGYSV------HPCNRLDKPTSGLM
RLUA_VIBVU      -------EIIFEDDHILAVNKPSGLLSVPGRPEHHDSMWSRL-----QEQYPEI--QVVHRLDMSTSGLM
Y745_HELPY      ------IEVIFEDEDXXXXXXXXXXXXHKALSVKEPTLVDWLEFKNYELSNLGLKERIVHRLDKDTSGGI
TRUC_VIBPA      -MAPVELEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQF--VMQTLRDQIGQHVFP--LHRLDRPTSGVL
RLUC_BUCBP      KIKLNTRMILYEDNYFLILNKPSGMSVHSG-SGINYGMIENLRILRPYNRYLDLVH----RLDRDTSGVL
TRUC_HAEDU      ------LDILYRDDELIAINKPAGMLVHRSWLDKAETLFAMQT--LRDQINQHVFP--IHRLDRPTSGVL
TRUC_PASMU      ------LEILYQDPYLIAVNKPAGMLVHRSWLDRHETQF--VMQTLRDQIGQHVYP--IHRLDRPTSGVL
Y956_HELPJ      QKVEKP-SVIFEDENILALFKPPFIESYDLVSF----------FKGWA---------LLHRLDKETSGVI
Y505_ZYMMO      --------VLFIDAEAMIIDKPPVTSVRDGSLSLENYLASLCGFKRW--------PSIVHRLDRDTSGCL
RLUA_HAEIN      ------LDIIYQDNHLCVVNKPSGLLSVPGNQPQYDSAMSRVK-----EKFGFCEP--AHRLDMATSGII
Y956_HELPY      QKVEKP-SVIFEDENILALFKPPFIESYDLASF----------FKGWA---------LLHRLDKETSGVV
RUSD2_MOUSE     -VTAEPIHLLAENNDVVVIDKPSSIPVHPCGRFRHNTVI----FILGKEHQKEL--HPLHRLDRLTSGVL
RUSD1_DANRE     --SLENLSVLYQSTNYIVVNKHWDIRIDSKMWYEKQTVQSQLKHHFPELADPGTYYRFCHQLDFSTSGAL
RLUC_BUCAI      KNTFFPLNILYEDSHLLIINKPSGIA-VHGGSGLNFGVIEY--FRKLRPLNKFL--ELVHRIDRDTSGVL
YK27_CAEEL      -----PIRVISETDDLFVVEKPPSLPVHTCGQYAIHTVLGQLRVNEGRTGLR-----VLHRLDRATSGVL
RLUC_RICFE      KLAKKITTLIYEDDNLIAINKPAGLAT-QGGSKINLSIDSALKY--LNYKGADF--KLVHRLDKETSGLL
RLUC_BUCAP      -------NILYEDNYLLIINKPSGIA-VHGGSGINLGVIEYFRKIRPLEKFLELVH----RIDRDTSGVL
RUSD2_HUMAN     -VTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVI----FILGKEHQKEL--HPLHRLDRLTSGVL
RUSD1_MOUSE     --SMENLSIVYQSSDFLVVNKHWDLRIDSKTWRETLTLQKQLRHHFPELADPDTCYRFCHQLDFSTSGAL
TRUC_PECCC      ------LEIIYQDEHLVAVNKPS------GWLVHRSWLDRKEKVVVMQTVRDQIGQHVYTRLDRPTSGVL
RLUC_RICTY      KLAKKILTLIYEDDHLIAINKPASLAT-QGGSKINLSIDSALKYLNYQGADFKLVH----RLDKETSGLL
RLUC_RICPR      KLAKKILTLIYEDDHLIAINKPASLAT-QGGSKINLSIDSALKYLNYQGADFKLVH----RLDKETSGLL
Y209_MYCGE      ITSVEPLEVLFEDKDLMVINKPSGLLTHPTTFNEKASLLAACIFH----NNKNPV-YLVHRLDRDTSGAI
Y370_MYCGE      DLVKDKLKIIFEDENIIVVDKPTGIVCQPDKKNLSNMLLKHCGYRQFDSNKLNFYPQFAHRIDRNTSGIV
RLUC_YERPE      --------ILFEDDYLLVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSGVL
PUS6_YEAST      -------NIVFEDESILVIDKPSGIPVHPTGQFYQNTITELLKLH-----GVDALP--CYRLDKITSGLL
TRUC_VIBVU      ------LEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQF--VMQTLRDQIGQHVFP--LHRLDRPTSGVL
YA32_SCHPO      PVSDQPVGIVHEDESYVVIDKPAGV-----PVHPTGRYNHNTVLHILMKENKCSLLYPCNRLDRLTSGLM
RLUC_RICCN      KLAKKITTLIYADDNLIAINKPAGLATQGG--TKINLSIDSALKYL-NYKGADF--KLVHRLDKKTSGLL
RLUC_RICBR      TLAKKITTLIYEDDNIIAINKPAGLATQGG--SKINLSVDSALKYLNSQGADFKLVH---RLDKETSGLL
TRUC_YERPE      ------LEIIYQDEHIVAVNKPALVHRSWLDRNETVFVMQTVRDQIGQHV------YTVHRLDRPTSGVL
TRUC_ECOL6      ------LEILYQDEWLVAVNKPS------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
TRUC_SHIFL      ------LEILYQDEWLVAVNKPS------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
TRUC_ECOLI      ------LEILYQDEWLVAVNKPS------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
TRUC_ECO57      ------LEILYQDEWLVAVNKPS------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
PUS5_ORYSJ      ------LDVLYEDDDMIALNKPSGLQVLPKGLFQQRTVLAQLQLKDWKMKRKDAQSHPVPRLGRGTSGXX
PUS5_ARATH      LPWKEPLEVLYEDDDLIALNKPSGLQVLPGGLFQQRTVLTQLQWYIGSRESPHPVP--VHRLGRGTSGIX
TRUC_HAEIN      ------LEILYQDGFLVAVNKPA------GMLVHRSWLDPHETQFVMQTLRDQIGQHVIHRLDRPTSGVL
TRUC_VIBCH      ------LEIVYQDEYLVAVNKPALVHRSWLDKHETEFVMQTLRDQIGQ--------HVLHRLDRPTSGVL
RUSD1_HUMAN     --SVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPELADPDTCYRFCHQLDFSTSGAL
Y347_HELPJ      KPNEKQEKLVFEAKDFGVFDKPAQIYTHPKGYFYHESLLDCIQSHFGKNA------HPAHRLDYETSGLV
PUS7_ARATH      ILHQEP-DVV-------TVCKPASVPVHPCGQYRKNTIVGILDA---EHDLGTLFP--IHRLDRLVSGLL
PUS1_ORYSJ      --------VVFEDEWLAVVDKPALLSALPCSAATLGDEATKPNLHL------------ANRLDRDTSGLM
Y347_HELPY      KPNEKTQALVFETKDFGVFDKPHQVYTHPKGYFYHESLLDCIQSHFGKNA------HPAHRLDYETSGLV
RUSD1_BOVIN     --SVENLCVVYRSHDFLVVNKHWDVRIDSKAWRETLTLQKQLRHRFPELADPDTYYRFCHQLDFSTSGAL
Y548_MYCPN      TQVQDDLQVIFEDEQLIVVDKPAGVVCQPDAKNLANSLLKHCGYNQYFKNSLSFIPRFAHRIDRNTCGLV
PUS4_ARATH      --------VLYKDPAIIVLNKPHGLAVQGGSGIKTELAASCLKF------DKSESPRLVHRLDRDCSGLL
Y042_HAEIN      ------IEVVYQHSDFIIINK----------SEGISVHKDQEEQGLTELVAKQLVPKVVHRLDKVTSGLL
PUS7_ORYSJ      ------ITILQNEADVVTVCKPASVPVHPCGQYRKNTVVGIL------QAEHGLVPFPVHRLDRLVSGLL
TRUC_SALTY      ------LEILYQDPWLVAVNKPA------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
TRUC_SALTI      ------LEILYQDPWLVAVNKPA------GWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTRLDRPTSGVL
Y714_MYCCT      -ISNVNLDIVYEDNNILIVNKP---NNLEMHSIYNLCLDDMVKSYLVDKKEYDIISHV-HRLDKLTSGLV
PUS3_ORYSJ      YLRRL---VIHKDSAILVLNKPPMKGNLP-VHNSMDVLAAAALSY-----GNEEGPKLVHRLDRESSGLL
RUSD4_HUMAN     --------ILHQDKNLVVINKPYGLPVHGGPGVQTDVLPILAKM-LHGHKAEPL--HLCHRLDKETTGVM
PUS4_ORYSJ      ---------IYKDEAIIVVNKPPGMQGGVGIKNSIDVLAS-----MFEENSSE-APRLVHRLDRDCSGIL
RUSD4_XENTR     --------VVREDPELVLVNKPHGLPVHGGPTRSVASLLPALAKHHFGWKAEPL--KLCHRLDRDTTGAL
RUSD4_RAT       --------ILHQDKDLVVINKPYGLPVHGGPGVQSDVLPILAKM-LHGHKAEPL--HLCHRLDKETTGVM
Y1592_SYNY3     PLQ---LSVLHRDEDLWAIDKPSGLPVLPGGDFVYHTVLEQLKI---QYPQESLFP--LHXXXXXXXXXX
PUS1_ARATH      -------DILYEDEYLMAVNKPKVLRSAP---------------QIVLDSSSEY--HLANRLDRDTSGVM
PUS5_YEAST      ---KKQIPIIFENTHYFIVNKPPGIPSQP-PDCRTTPLLERFKAIYYSHREVELC-RTVHRLDHCVTGGM
PUS3_ARATH      ----------FKDSAIIVLNKPPKLGNVPIHNSMDALAAAALSF------GNDEGPRLVHRLDRETSGLL
RUSD4_DANRE     ---------LYEDQNIIAINKPVPLHNINGIRNSAECLPLLAKITDNMRPGSQL--HLCHKLEKETTGVL
RUSD4_BOVIN     --------IVHQDKELVVINKPYGLPVHGGPGVKSDVLPVLAKI-LHGPKAKPL--HLCHRLDKETTGVM
RUSD4_MOUSE     --------ILHQDNDLVVINKPYGLPVHGGPGVQSDVLPILAKM-LHGHKAEPL--HLCHRLDKETTGVM
PUS6_ORYSJ      --------VIAVTDNYVVLDKPAATSVGGATDNIEESCV------VFTSRALGLETPLMTQIDNCSEGCV
PUS5_CANGA      ------LKVVYDGMHYMIVYKSAGVLSQPGASDSRPVLMSELRGLL----SETLDLYSVQRLDACVTGGT
MLRR1_PLAF7     -------------------------------------------FHLFMMKS---FPHLETRIDLETSGSL
RLUF_ECOLI      IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
RLUF_SHIFL      IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
RLUF_SALTY      LIA---------------LNKPVGIVSTTEDGER-DNIVDFVNH------SKRIFP--IGRLDKDSQGLI
RLUF_ECOL6      -----------EDLVLIALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
RLUF_ECO57      IEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--IGRLDKDSQGLI
RLUF_SALTI      LIA---------------LNKPVGIVSTTEDGER-DNIVDFVNH------SKRIFP--IGRLDKDSQGLI
RLUB_BACSU      ----------------------------------------------------------IGRLDYDTSGLL
Y1464_AQUAE     KPQRK---------RYIILNKPCCYLTQLGRSPDGRKTI--------EELIKDIPERVVGRLDYNTEGLL
RLUE_PASMU      ------------------------------------------------------IPHVYPRLDRDSEGLV
PUS5_ASHGO      ----------------------------------------------------------VHRLDEPVTGGV
QUEA_PROMP      -------------STWLCLARPAKKLKINSQLNLKSSLAKDIKLHI------------------------
Y1370_MYCLE     ----------------------------------------------------------VGRLDADTEGLI


                         +         .         .         .         .         *         .:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
YJBO_BACSU      LVAKHRFAHSILSSAQKNGLVKRRYAAVVHGRMAQMEGTVDAPIGRHPDSIERTVTPDGQKAVTHFYV-T
YLYB_BACSU      MVAKNDMAHESLVNQLVNKTVTRKYTAVVHGLISHDDGTIDAPIGDKKDRQSMTVTRDGKNAVTHFHVLE
YHCT_BACSU      VFAKHRLAHAILDQQLEKKTLKRTYTAIAEGKLRTKKGTINSPIGDRSHPTRRRVSPGGQTAVTHFKVAS
Y1758_AQUAE     VIAKNNTAHRNLVRQFQERKTEKFYKVLVKGLVKKDYGAIDTPIARHPVDRKRFVRKEGKEALTEYWVKR
RLUD_NITEU      VVAKTIEAQFDLARQLQQRTVKRHYLALVLGKL-EKDGVVDAPIGRHPIHRTRMVVQNGKPARTHYRVLE
RLUD_ZYMMO      VVAKTDPAHAGLAAQFADHSINRRYRAIVDGH-PSLQGHVDAPLARSSVNRQKMVSDRGKRAVTHYRMIT
Y723_CHLP8      IIAKNPTALHKLARQFANRQVEKVYKAIVWGVPKAESGTIKTNIGRSHKNRKVMANAEGKHAITDYQVVE
RLUD_VIBVU      VVAKTVPAQTRLVRALQKRNITREYEAIAIGRMTAG-GKVDKPIGRHATKRTLMVSPMGKPAVTHFRVAE
Y901_CHLAA      VIARHDQAMRSLVDQQQARRMRKIYQALVIGRPPET-GTIDAPIGPRDR-LRMAVVPDGRPARTHYRLLD
RLUD_XYLFT      VVARTLQAQTALVEQLSSRQVHRQYLAVVVSALVSG-GTVNAAIEPRDR-LRMEVSDTGKEAVTHYRLRE
RLUD_XYLFA      VVARTLQAQTALVEQLSSRQVHRQYLAVVVSALVSG-GTVNAAIEPRDR-LRMAVSDTGKEAVTHYRLRE
RLUD_BORBU      ICAKNISTLRFLAQQFKDKRTNKVYIAIVKGNFNSFFGSIESFIDRDKHNRKKVSKDRGKKALTEYRLLL
RLUD_YERPE      VVAKTVPAQTRLVEALQAREITREYEAVAIGNMTAG-GRVDEPISRHSTKRTHMVHPMGKPATTHYRIME
Y1629_SYNY3     VVAKTELALHNLQVQLKEKTARRLYWGIVYGSPKEIQGTVNLPVGRHPGDRQKMVEKGGREAVTHWRLLE
RLUD_RALSO      VVARTLPAQTDLVRQLQARTVKRTYLALVWGE-TPEAGTIDAPIGPRDRTRMAIITASGKPARTHFKTLD
RLUD_XANCP      VVARTLQAQTALVEQLSARDVHRQYXXXXXXXXXXXX-TADAPIDPRDR-LKMAVRDDGRDAVTHYRLRE
RLUD_PASMU      VIAKTIPAQTKLVRDLQKRKITREYEAIACGIMT-KGGMVDQPMARHPTKRTHMVHPMGKPAVTHYRIME
RLUD_XANAC      VVARTVQAQTALVEQLSAREVHRQYXXXXXXXXXXXNAPIDRH--PRDR-LKMAVRDDGRDAVTHYRLRE
RLUD_BUCAI      VIAKNIFSYNHXXXXXKEKKIIREYEGIVHGKMI-AGGTINKPIMRHYNRTCMMVHHLGKPSVTHYKVLS
Y292_MYCPN      MLAKNXXXXXXXXXXXXXRVMKRYYLALVHFPLDSLSGTISAPLERVGNNVGNS-SNKAKNAFTKFTVLN
RLUD_HAEIN      VVAKTIPAQTKLVRDLQKRKITREYEAVASGIMT-KGGTVDQPMARHATKRTLMVHPMGKPAVTHYRIMX
RLUD_SALTY      VVAKTVPAQTRLVESLQLREITREYEAVAIGHMTAG-GTVNEPISRHPTKRTHMVHPMGKPAVTHYRIME
RLUD_SALTI      VVAKTVPAQTRLVESLQLREITREYEAVAIGHMTAG-GTVNEPISRHPTKRTHMVHPMGKPAVTHYRIME
RLUD_BLOFL      IIAKTVSAYDNLLRSFKLRKVVKEYDAIVYGKFTSNAGVVNQPMRRHAKRTFMSVHYTGKSAVTYYSVVE
RLUD_NEIMB      VVAKTLPAQNSLVRQLQERTVKRIYRAVANGIVPFD-GKIETQIGPHNRLKMAVVKFGGKPAVTHVKVLE
RLUD_NEIMA      VVAKTLPAQNSLVWQLQERTVKRIYRAVANGIVPFD-GKIETQIGPHNRLKMAVVKFGGKPAVTHVKVLE
RLUD_VIBPA      VVAKTVPAQTRLVRALQKRNITREYEAIAIGRMTAG-GKVDQPIGRHSTKRTLMVAPLGKPAVTHYRVAE
PUS2_ARATH      VVAKDEHSHAHLAEQFKLHTIERVYVSLTTGVPSPPQGRIEIPIGRDSSNRIRMAAXXXXXXXXXYKVIE
RLUD_PSEAE      VVAKTLEAHTKLVAQLQARSVSRIYEAXXXXXXXXXXXX-DAPIG--RHGVQRQVVDAGKVAVSHYRVLE
RLUD_BUCAP      VIAKTIFSYNKLVTLLKKRKIIRKYQGIIKGNMI-SGGIVNYPIMRHPFKRICMTTDSGKKSITHYKIIN
RLUD_VIBCH      VVAKTVPAQTRLVRALQKRDVTREYEAIVIGTMT-AGGMIDKPIGRHSTKRTLMVSPMGKHAVTHYRV-A
PUS2_ORYSJ      VVAKDEHSHAQLAEQFKLHTIRRVYISLTCGAPNPNSGRIEVPIARDPNNRIRMIATPGRHAASRYKVRE
RLUC_VIBPA      LVAKKRSALRHLQAQFREKTVKKFYFALVMGQWKSSCKVVNAPLLKNEVNSIVRVNPNGKPSETRFKILE
RLUA_SHIFL      VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
RLUA_ECOLI      VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
RLUD_BUCBP      VIAKNNLSYMALIDQIKCKKVIREYQAIVYGKVISGGTIVKSIIRNPIKRTTMIVNKCGKRAITHYRILK
RLUC_VIBVU      LVAKKRSALRHLQAQFREKTVQKYYFALVMGEWKNSCKVVNAPLLKNEVNSIVRVNPNGKPSETRFKVIE
RLUC_HAEDU      LVAKKRSALRALHEQLREKVVQKDYLALVRGQWQAHINVIKAPLLKNELQSGEKVSEQGKPSETRFSIEE
RLUA_ECOL6      VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
RLUD_HAEDU      VVAKNIPAQTHLVTALQKRRITREYEAIASGIMTQG-GKVDEPMARHPTKRTAMVHPMGKPAITHYRIME
RLUC_VIBCH      LVAKKRSALRHLQAQFREKTVQKYYYALVMGHWDAECKVVNAPLLKNEVNSIVRVNPNGKPSETRFRILE
RLUC_PASMU      LVAKKRSALRSLHEQLREKTVQKDYLALVRGQWQSHCKVVKAPLLKNELSSGERVSEQGKPSETRFSIEE
RLUA_SALTI      VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYNVVE
RLUD_ECOLI      VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
RLUA_SALTY      VVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYNVVE
RLUA_ECO57      VVALTKAAERELKRQFRERVPKKQYVTRVWGHPSPAEGLVDLPLRPKQ----KVCYETGKPAQTEYEVVE
RLUC_SHIFL      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
RLUC_ECOLI      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
YDL36_YEAST     FLAKTPKGADNIGDQLKAREVTKEYVAKVVGEFPETEVIVEKPLKLIENAVCQMDEKGAKHAKTVFNRIS
RLUC_ECOL6      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSYVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
RLUC_ECO57      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERVSQEGKPSETRFKVEE
RLUC_SALTY      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKTVQAPLLKNILQSGERVSQEGKPSETRFKVEE
RLUA_VIBPA      VLAKNKRAESALKKQFQFRLTHKIYYARVWGHVEQEEGEIDLPLDWPNRPLQKVCFEDGKPSKTLFQVEQ
RLUC_SALTI      LVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKTVQAPLLKNILQSGERVSQEGKPSETRFKVEE
RLUA_YERPE      VVALTKAAERELKRQFREREPKKTYIARVWGHLAQDEGLIDLPLRPKQ----KVCYETGKSAQTEYQVIS
RLUC_HAEIN      LIAKKRSALRNLHEQLRVKTVQKDYLALVRGQWQSHIKVIQASLLKNELSSGERVSEQGKPSETRFSIEE
Y745_HELPJ      VIAKNNFTHVCLSEQLKTKMMGRYYIALLSTPLKEEKMSVECYLTRNPNNRLKMIAKAAKKEKSRYSKSE
RLUA_PASMU      LFALSKVADRELKRQFREREPKKHYQALVWGHLEEDQGEVNLPLRPRQ----KICFERGKPALTLYEVLA
RLUD_SHIFL      VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
RLUD_ECOL6      VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
RLUD_ECO57      VVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMVHPMGKPAVTHYRIME
Y1567_MYCBO     VVAISERAYTVLKRAFKYRTVDKRYHALVQGHPDPSSGTIDAPIGRHRGHEWKFITKNGRHSLTHYDTLE
Y1540_MYCTU     VVAISERAYTVLKRAFKYRTVDKRYHALVQGHPDPSSGTIDAPIGRHRGHEWKFITKNGRHSLTHYDTLE
RLUA_VIBCH      LFAKGKHMESALKKQFQYRLTHKIYYARVWGVMEQNEGEVNLPLRPKQ----KVCFEEGRDSLTRYQVRE
RLUC_PSEAE      MIAKKRSMLRHLHEALREKIVDKRYHALVRGHWPAGKKNVRAPLLKNNLRSGERMVEVGKDALTEFRVLR
RLUA_HAEDU      LLALSKVAEKELKRQFRDREPKKHYIALLWGKLGDRVGICDWENRPRQ----KICYERGKKATTHYEVLE
RIB2_YEAST      FLAKTPLGADRMGDQMKAREVTKEYVARVKGEFPIGIVEVDKPVNPKVNAVCEMSDENAKHAKTVFQRVS
RLUA_VIBVU      VFAKNKRAEAALKKQFQYRLTHKVYYARVWGHVEADSGMIDLPLDWPNRPMQKVCHEHGKPSQTAFQVAK
Y745_HELPY      VIAKNNFTHVHLSEQLKTKMMGRYYIALLSTPLKEEKMSVECYLTRNPNNRLKMIAKAVKKEKSRYSKSE
TRUC_VIBPA      VFALSSEVASQVMPMFAEHKMEKTYHAIVRGWI-EEEGVLDYALASQEKEAQEAVTAYKPLAKVEYSTGK
RLUC_BUCBP      IIAKKRSILRNLHEQLREKKIKKKYVALVHGVWPDILKSISKPLSSRKNKNIVKIDPKGKESITHFNIKK
TRUC_HAEDU      LFALNSEMARLMSEQFEQHKVEKEYLAIVRGYIAEK-GEIDYPLKSQPKAAQQAVTFYQNLAKVEYSTGK
TRUC_PASMU      LFALSSEVANLLCLQFENKQVQKSYLAIVRGYLVGE-GRIDYPLKVQLDKIAEAVTDYLGLAKVEYCVKK
Y956_HELPJ      LLVKENSEFHLAKKAFKDRAVKKEYLAIVQGIIEEEREINAPILTIKTTKAFSKISKKGQEAVTIITPLK
Y505_ZYMMO      LLARNPKMHRRLSEAFSQGQVKKCYWAILEGVPEKNEGIIDLPLSSPKSGWRIVADDKGKRAVT-HWEIL
RLUA_HAEIN      VFALSKAADRELKRQFREREPKKHYQAIVWGHLENDYGEVNLPMRPRQ----RLDFVLGKRAVTKFEVLA
Y956_HELPY      LLVKENSEFHLAKKAFKDRAVKKEYLALTQGIIEEEREINAPILTFKTTKAFSKISKKGQEAVTIITPLK
RUSD2_MOUSE     MFAKTAAVSEKIHEQVRDRQLEKEYVCRVAGEFPDKEVICKEPILVVSYKVGVCRVDRGKPCETVFQRLS
RUSD1_DANRE     CVALNKAAAGQAYRCFKDRRVTKAYLALVRGTVTEENLSLDFAIGKNTTGKTHMMCTEGKPCQTEVTVLE
RLUC_BUCAI      ILAKKRTSLVSLHEQLREKKIKKEYIALVHGLWPDHIKKISEPLLKIQFKNKQLIDKKGKPSETYFQIKK
YK27_CAEEL      LFAKNYETDLEFKTTLKQGEWSKEYICKVDGVFPDEEQVCEQPIGPLVISMGQCVRPDGKDAKSRF--RK
RLUC_RICFE      LIAKNYLSNVKLHDAFKEKLVVKTYFAVTYGKVGEVRSNIEKSKGSTPK-ITDIYSENGKLAITYYKLLK
RLUC_BUCAP      MLAKKRRSLLSLHKQIREKKVQKKYIALVHGLWPLSLRKVSEPLLKTHLKNKQLINKEGKPAETYFKIKQ
RUSD2_HUMAN     MFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPGKPCETVFQRLS
RUSD1_MOUSE     CVALNKAAAGSAYKCFKERRVTKAYLALVRGHVQESQVTINYAIG-RNSTEGRTHTENPKPSLTELLVLE
TRUC_PECCC      LLALSSEVARALSQQFESHQMQKTYHAVVRGYVLDD-GVIDYALTEELDKIADKFTNPDKAAVTHYRIGR
RLUC_RICTY      LIAKNYLSSVKLHDAFKEKLVIKKYFAITYGRPVKNVGIVKSNIGKRMFKITDIDSDNGKLAITYYXXXX
RLUC_RICPR      LIAKNYLSSVKLHNAFKEKLVIKKYFAITYGRPVKNVGTVKSNIGKRLSKIANIDSDDGKLAITYYXXXX
Y209_MYCGE      VVCKXXXXXXXXXXXXXXRTLKRYYVALVHFPFNALTGSINAPLARVNNNKVMXXXXXXXXXXXXXXXXX
Y370_MYCGE      IGAKTNKALKELNKVFKNNHLTKRYKGLVFGQF--NHLGLQTAYWKKDNNNGIVTVPEAKKISTFFENSS
RLUC_YERPE      LVAKKRSALRSLHEQLRLKSMQKDYLALVRGQWQSHCKAIQAPLLKNIMQSGEKVSSEGKPSETRFKIEE
PUS6_YEAST      ILAKNSQSAGEIQKSIRSRDMIKIYLARVKGRFPHSELILD-----NENAAETTFEDTSKVAITKFYIRY
TRUC_VIBVU      VFALSSEVASQVMPMFAGQEMSKTYHAIVRGWI-EEEGELDYALASQEKEAQDAITLYKPLAKVEYSTSK
YA32_SCHPO      FFSKSPKAAEEMRVHMISKSLKKEYVARVIGEFPNSGEVIDAPLLTVAPTLGNRIHPDGKEASTVF-KRI
RLUC_RICCN      LIAKNYLSSVKLHNAFKEKLVVKTYFAVTYGKVGEVRSNIEKSKGSTPK-ITDIDSENGKLAITYYKVLK
RLUC_RICBR      LIAKNYVSSVKLHDAFKEKLVEKTYLAVTYGKPIKDQGEVKTNIEKSKGSIPKITDNNGKLAITYYKLLK
TRUC_YERPE      LMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLE-GGTVDYAMAEELDKIADKFAKSDKLAQVELAIGR
TRUC_ECOL6      LMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEE-AVLDYPLAEEDKGPQPAVTHYRGLATVEMPVAR
TRUC_SHIFL      LMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEE-AVLDYPLAREDKGPQPAVTHYRGLATVEMPVAR
TRUC_ECOLI      LMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEE-AVLDYPLAREDKGPQPAVTHYRGLATVEMPVAR
TRUC_ECO57      LMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEE-AVLDYPLAREDKGPQPAVTHYRGLATVEMPVAR
PUS5_ORYSJ      XXXXXXFAEGATNKSRDERKISKFYRALVTGILENDEVMITQPIGVRYPGVAEAACSSGKPAMSKVRVLE
PUS5_ARATH      XXXXXXFAEGLDQECGTGRKLSKIYRALADGIVEEDEVVIKQPIGVRYPGVAQVASPEGKPAFSKVFVLE
TRUC_HAEIN      LFALSSEIANLMCEQFEQKYVQKSYLAVVRGYLQGKER-IDYPLKIQLDKIAEAITDYEKIVEMPYPAGR
TRUC_VIBCH      VFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEAN-VLDYPLKEELDKIADKVTAYRPLAKVELPIAK
RUSD1_HUMAN     CVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIG-RNSTEGRAHTENPKPSLTDLVVLE
Y347_HELPJ      LAGKTLQSTKDLKALFMQKKVKKTYLALAHGLV-DKSIIINKPILTPQNRIRSQISPLGKPSITLVEPLS
PUS7_ARATH      IIARTAAKADFFRQQIEGGMVKKRYIAKVIGVFPEDEMIVDRSTAEDANSSGDDKKVKGKPACTKF-TRI
PUS1_ORYSJ      VITKCNKVAGKLVKAFTEHKVKKTYLAICSGHGRSKHGAVVRDMSTRFNGKGQFREPSNEVDETEITVQE
Y347_HELPY      LAGKTLQSVKDLKALFMQKKVKKTYLALAHGLV-EKSMKIDKPILTPQNHIRSKISPLGKQSITLVEPLS
RUSD1_BOVIN     CVALNKAAAGSAYRCFKDRRVTKAYLALVRGHVQESRMTISYAIGKNSTEEGTQGCENPKPSLTELVVLE
Y548_MYCPN      IGAKTNQALQELEAVFRHNLLMKQYQGLVFGPFNFKG---TQKAYWAKDAYQALVTPNAKPITTIFENSK
PUS4_ARATH      VLARTQTAATVLHSIFREKSLKRKYMALVIGCPPRQRGQISAPLRKVDDGKSERITDNGELVSTQHAITE
Y042_HAEIN      ILALNAESAAEFSRLFSEHKIHKTYLALSNQKPKKKQGLIIGDMKKAREGAWKLCQTKDNPAITRF-ESV
PUS7_ORYSJ      IFAKNADKAESFRQQIEASLLQKEYVAKVVGVFPDGEQTVNANVNAREGRSTAEVCDIGKQACTKFQ-RI
TRUC_SALTY      LMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGLVEERDKIADKPAVTQYRGLAEMAVPTGRYPTTRY----
TRUC_SALTI      LMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGLVEERDKIADKPAVTQYRGLAEMAVPTGRYPTTRY----
Y714_MYCCT      IYAKNKISSIILNAFKTKDQINKYYYALTSNDFLQVNGYINYNSNTQKADFSLVEKNNYKYCQT-----E
PUS3_ORYSJ      LFTKESFTRAKTNSQVWNAACEQRYWALVIGTPKEREGIISAPLSKLDDGKAERVIDGAQEAVTAYRVMG
RUSD4_HUMAN     VLAWDKDMAHQVQELFRTRQVVKKYWAITVHVPMPSAGVVDIPIVEKEMDDGKMVSRNAQVAVTQYQVLS
PUS4_ORYSJ      VLGRNQLSTSMLHAIFREHVLQRKYVALVIGTPRHPKGLLSAPLAKLQDGKSERLTASVQDALTEYRVIE
RUSD4_XENTR     ILARTTEAAERVQQALREREVHRVYWALCLGTPSPREGILDIPIMEKETSGPQRVSEEGAVERVRVAVTR
RUSD4_RAT       VLAWEKDMAHQVQELFRTRQVEKKYWAITVRVPLPSAGVVDIPIMEKEVAGQQQRMDNGKMVKTQYQVLS
Y1592_SYNY3     XXXXXXXXXXXXXXQFREHICRKIYRTVIGPCLPEKHQAIGKIPYP-QLGYIYAASSHGKPAQSYGRILA
PUS1_ARATH      IITKHKVAAKLV-KAFTEHKIRKSYIALCIGSSPNRRVTVSSGHGRSKHGAWRVALDVGRVLPGGSFVRD
PUS5_YEAST      LIAKTKFSRFLQKGGNNGYKLQRKYVAIV-----ESSGRFNKPYGPKYNFL---------ISHGGREITK
PUS3_ARATH      VMGRTKESIDYLHSVFSDYAMYQQYWALVIGSPKEKEGLISAPLSKLDDGKTDRVVEASQDAITEYKVLG
RUSD4_DANRE     ILAKTEEAAEHVQTLIQSHKVEMKYLAITVGVPVPSEGVIDIPVGPQEDGDGXXXXXXXXXXXXXXXXYQ
RUSD4_BOVIN     VLAWEKEVAHQVQELFRTRQVTKKYWAITVRVPVPEAGVVDIPIVEKEMDDGKMVSRNAQLAVTQYQV-X
RUSD4_MOUSE     VLAWEKDMAHQVQELFRTRQVEKKYWAITVRVPLPSAGVVDIPIGPQQHDNGKMVSRDAHVAVTQY-QXX
PUS6_ORYSJ      VLSKTKEFCSVFHGMIREKQVNKRYLAVSTGIITHYMRPINRPRLVSEDHIKQMILDCKKVPWPSSLIRK
PUS5_CANGA      VVAKNKRAAMMFSRYLKQYGLTRRYLARINA---------------------QPVCDEGTI-ESPGMXXX
MLRR1_PLAF7     IIAKTKEAREFLFDQFRKRNVYKEYILLCHGRIKKKKGFINKSIQTHESHFSLVVKTGGTDAYTEY----
RLUF_ECOLI      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE----------------------------------
RLUF_SHIFL      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITDE----------------------------------
RLUF_SALTY      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITDE----------------------------------
RLUF_ECOL6      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITDE----------------------------------
RLUF_ECO57      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITDE----------------------------------
RLUF_SALTI      FLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITDE----------------------------------
RLUB_BACSU      LLTNDEFANKLMHPKYE---IDKTYVAKVKGIPPKEL------LRKLERGIR---LEEGKTXXXXXXXXX
Y1464_AQUAE     ILTNDELANRILHPR---YKLPKVYLALVEGKVDQKTLKRMKQGIELEDGFAK--PDNIRIVRYE-----
RLUE_PASMU      LLTNNGEIQHRL--AVPKFNTEKTYFAQVEGIPQERQGVVLND-GKTLPAKVRLVPEPNWLWQRNPPIRE
PUS5_ASHGO      LVSRNKRAAAMFSRSLRGFPLTRRYVAL---LAREAKGL------PSEGRIGDMITDYKRLEND------
QUEA_PROMP      ----------------------------------------------------------------------
Y1370_MYCLE     LLTNDELAHRLMH---PSHEVSKTYLATVKGAVPRGLG--------KKLSVG-LELDDGPAHVDDFAVVD


                         .         .         .         +         .         .         .:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
YJBO_BACSU      CANDDMTSVALQLETGRTHQIRVHMSYLGHPLCGDTLYGGTRQ-EIGRQALHSEHLSFIHPLTQENMRFH
YLYB_BACSU      RFQD-FTLVECQLETGRTHQIRVHMKYIGFPLAGDPKYGPRKTIDFNGQALHAGVLGFDHPRTGEYVEFE
YHCT_BACSU      NAKERLSLVELELETGRTHQIRVHLASLGHPLTGDSLYGGGSKL-LNRQALHANKVQAVHPITDELIVAE
Y1758_AQUAE     YEKYEITLLKVKIHTGRTHQIRVHFASIGHPVLGDRTYGFKLSLMGECNMLIAYHLGFYHPTKGEWMVFE
RLUD_NITEU      KF-TASTLLHCSLETGRTHQIRVHLLSIGHPLAGDPVYGADAVVRLPRQALHAWQLELTHPHSGQILLWE
RLUD_ZYMMO      PLKN-ASLIECRLETGRTHQVRVHMSSIGHSLLGDPVYGRSQSLAFQRQALHAAHLGFIHPISGKQVDFD
Y723_CHLP8      DLG-YFSLMDVTLHTGRTHQIRVHLQHLGHSILGDETYGGATPRTLSRQALHAQTLRFRQPTTGEPLSFS
RLUD_VIBVU      HFREH-TRIRLRLETGRTHQIRVHMSYLQHPLLGDAAYGGRMIRNFDRQALHAVMLRFEHPITGEEMEFH
Y901_CHLAA      TFGDYS-LLEVQLETGRTHQIRVHLRHLGYPIVGDPVYGPRRSLHLSRQFLHAAYLGLVHPRSGRWQEFT
RLUD_XYLFT      RFRAH-TALECRLDTGRTHQIRVHMAHLRHPIVGDRLYGGSLKLGFKRQALHAEVLEFLHPVRALPVRIV
RLUD_XYLFA      RFRAH-TALECRLDTGRTHQIRVHMAHLRHPIVGDRLYGGSLKLGFKRQALHAEVLEFLHPVGALPVRIV
RLUD_BORBU      NFGE-YSLLALKPKTGRTHQLRVHMKYLNFPILGDEVY-GRVDGSLKKLMLHSYKLE-IDVGKNSFKKFI
RLUD_YERPE      HFRAH-TXXXXXXETGRTHQIRVHMSHINHPLVGDQLYGGRILRGFDRQALHATMLRLYHPIRGIQMEWH
Y1629_SYNY3     RIGNHSWL-EFQLETGRTHQIRVHSKQMGHPLVGDNLYPGSVNVNLPGQALHAHQLSLIHPVSGEIITAI
RLUD_RALSO      VVDAQVSLVQCQLETGRTHQIRVHFESEGHPLLGDPVYTRNFRRGFARQALHAVRLGLVHPASGQSVHWH
RLUD_XANCP      RFRAH-TALECRLETGRTHQIRVHMAHLKSPIVGDPLYGGALKLGFKRQALHAETLEFLHPVSGEPIRAS
RLUD_PASMU      RFRNY-TXXXXXXETGRTHQIRVHMAHIAHPLLGDQTYGGRTLRDFKRQALHAIMLRLAHPITGELMEWH
RLUD_XANAC      RFRAH-TALECRLETGRTHQIRVHMAHLKSPIVGDPLYGGALKLTFKRQALHAETLEFLHPVSGEPVRAS
RLUD_BUCAI      RF-KFHTHIAIRLETGRTHQIRVHMLHIKYPLVGDPCYSGRKDYKFPRQALHANHLSLHHPIKKNVMSWT
Y292_MYCPN      Q-NEKAALIKCELLTGRTHQIRVHLQFIKHPVYNDPLYGLKSEQATEGQYLHAQQISFIHPTLNKEMGFE
RLUD_HAEIN      XXXXXXXXXXXX-ETGRTHQIRVHMAHIAHPLLGDQTYGGRVLRNFKRQALHAVMLRLAHPITGEMMEWY
RLUD_SALTY      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDQVYGGRTLRKFDRQALHATMLRLYHPVSGIEMEWH
RLUD_SALTI      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDQVYGGRTLRKFDRQALHATMLRLYHPVSGIEMEWH
RLUD_BLOFL      EFKAHSR-VRINLKTGRTHQIRVHMAYINHPLVGDQKYKGNFSLDFNRQALHACTLQLLHPITQVQMKWN
RLUD_NEIMB      YLTH--SYIECSLETGRTHQIRVHMREANHPLAADPVYGNRHPCGGARQALHAYRLSFTHPESGETVSFE
RLUD_NEIMA      YLAH--SYIECSLETGRTHQIRVHMREANHPLAGDPVYGNRHPCGGARQALHAYRLSFTHPESGETVSFE
RLUD_VIBPA      HFREH-TRIRLRLETGRTHQIRVHMSYLQHPLLGDTAYGGRMIRGFDRQALHAVMLRFEHPITGEELEFH
PUS2_ARATH      FAGGGSALVEWRLETGRTHQIRAHAKYMGVPLLGDEVYGGTKSMALDRPCLHAIVLGFTHPCTGEIVKFS
RLUD_PSEAE      RFRAH-THTRVKLETGRTHQIRVHMSHIGYPLVGDPVYGGRFRREFPRQALHARFLELDHPATGVRMKWE
RLUD_BUCAP      RF-KFHTHVSFRLETGRTHQIRVHMXXCNYFQENRNIY---RKFNLFRQALHADYIEFIHPFTQKVMSWS
RLUD_VIBCH      XXXXXXXXXXXXXXXXXXXQIRVHMAYLQHPLLGDTAYGGRMIRDFDRQALHAVMLKFEHPVTGEELEFH
PUS2_ORYSJ      FAGGGSALVEWRLETGRTHQIRAHAKYLGIPLLGDETYGGTKSMALDRPCLHAALLGFKHPHSGKILEFS
RLUC_VIBPA      KF-EQATLIQASPITGRTHQIRVHTQYTGHPIAWDDRYGDRRQLGLDRLFLHAANIKFQHPSNDEWMEIN
RLUA_SHIFL      YAADNTARVVLKPITGRSHQLRVHMLALGHPILGDRFYASPEARAMPRLLLHAEMLTITHPAYGNSMTFK
RLUA_ECOLI      YAADNTARVVLKPITGRSHQLRVHMLALGHPILGDRFYASPEARAMPRLLLHAEMLTITHPAYGNSMTFK
RLUD_BUCBP      RFTHH-THLKIILETGRTHQIRTHMLYINFPLVGDKTYGNKFKFKFPRQALHASRLCLYHPVTKHLMEWN
RLUC_VIBVU      KF-PQATLVQASPITGRTHQIRVHTQYSGHPIAWDDRYGDRAQHGLNRLFLHAANIRFTHPATEQPMEIN
RLUC_HAEDU      RY-PNATLIKASPITGRTHQIRVHTQYAGHPIACDDRYGDQAQAGLNRLFLHAHSIRFEHPKTAEQMFIT
RLUA_ECOL6      YAADNTARVVLKPITGRSHQLRVHMLALGHPILGDRFYASPEARAMPRLLLHAEMLTITHPAYGNSMTFK
RLUD_HAEDU      RFRNY-TXXXXXXETGRTHQIRVHMAHIAHPLLGDQLYGGRVLRAFQRQALHATMLRLEHPINGELIECH
RLUC_VIBCH      KFAE-ATLVQASPVTGRTHQIRVHTQYMGHPIAWDDRYGDRAQFGIERLFLHAANIQFVHPASEKKLEIH
RLUC_PASMU      RY-EYATLVKASPVTGRTHQIRVHTQYAGHPIALDDKYGDKTQLGLTRLFLHAFSIRFEHPKTGETLRIN
RLUA_SALTI      FAADNTARVVLKPITGRSHQLRVHMLALGHPILGDQFYASPEALSLPRLQLHAEMLTITHPAYGNSMTFK
RLUD_ECOLI      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
RLUA_SALTY      FAADNTARVVLKPITGRSHQLRVHMLALGHPILGDRFYASPEALSLPRLQLHAEMLTITHPAYGNSMTFK
RLUA_ECO57      YAADNTARVVLKPITGRSHQLRVHMLALGHPILGDRFYASPEARAMPRLLLHAEMLTITHPAYGNSMTFK
RLUC_SHIFL      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
RLUC_ECOLI      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
YDL36_YEAST     YDG-KTSIVKCKPLTGRSHQIRVHLQYLGHPIANDPIYSNDEVWG-------------------------
RLUC_ECOL6      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
RLUC_ECO57      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLNRLFLHAAALKFTHPGTGEVMRIE
RLUC_SALTY      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLKRLFLHAAALKFTHPGTGEVMRIE
RLUA_VIBPA      EDGTKTTIVRLLPITGRSHQLRVHMQALGHPIVGDEFYAEEAKVFSERLELHASELSFYHP---------
RLUC_SALTI      RYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDRAGTGLKRLFLHAAALKFTHPGTGDVMRIE
RLUA_YERPE      RDDDGSTRVKLSPITGRSHQLRVHMLAMGHPILGDGFYAHPEAKAMSRLQLHAQQLCITHPEFGTPMHFK
RLUC_HAEIN      YI--NATLVKASPVTGRTHQIRVHTQYAGHPIALDDKYGDKNELGLNRLFLHAFSIRFEHPKNGETLRFN
Y745_HELPJ      FTSNGMDLIGAKLFTGRTHQIRAHLEYLNRHIIGDNLYGGVLSKEEIRIMLHAYLIEFKHPRSEQKLRFK
RLUA_PASMU      RYPNNTTRVKLTPITGRSHQLRLHMLALGHPILGDKFYAPPQAKALSRLCLHAEQLAFRHPITQE-----
RLUD_SHIFL      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
RLUD_ECOL6      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
RLUD_ECO57      HFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRTLRKFDRQALHATMLRLYHPISGIEMEWH
Y1567_MYCBO     AFV-AASLLDVHLETGRTHQIRVHFAALHHPCCGDLVYGARL--GLDRQWLHARSLAFAHPADGRRVEIV
Y1540_MYCTU     AFV-AASLLDVHLETGRTHQIRVHFAALHHPCCGDLVYGARL--GLDRQWLHARSLAFAHPADGRRVEIV
RLUA_VIBCH      ---EKTTVVRLIPITGRSHQLRVHMQSLGHPIVGDDLYAEAVEFA-DRLQLHAAELCFYHP---------
RLUC_PSEAE      RFGDFATLVEARPITGRTHQIRVHAKHAGHAIAGDPKYGDERELGGKRLFLHAAQLRVPLP---DGQVLE
RLUA_HAEDU      HLANNTTRVKFTPITGRSHQLRVHSLALGHPIIGDKFYANPLAKSLPRLCLHAESLTIAHPISAELMTFN
RIB2_YEAST      YDG-QTSIVKCKPLTGRTHQIRVHLQYLGFPIANDPIYSNPDIWGLGRGGLQNY----------------
RLUA_VIBVU      ANGAQTTIMRLLPVTGRSHQLRVHMQALGHPIVGDEFYAGDAFTFSERLELHAAELSFYHP---------
Y745_HELPY      FISNNLNLIGAKLFTGRTHQIRAHLEYLNRHIIGDNLYGGALPKEEIRIMLHAYLIEFKHPRSEQKLRFK
TRUC_VIBPA      FPTTRYCLMEMKPKTGRKHQLRRHMAHLRHPIVGDTSHGDRNEFDSHRLLLHASELRFVHPFTNEELVMK
RLUC_BUCBP      KY-TKNTLISITPITGRTHQIRVHLLHLNYPIVLDAKYGKKLDYNINRLLLHAESINFFHP---------
TRUC_HAEDU      YATTRYSLVALSPKTGRKHQLRRHMKHLFHPIMGDTKYGDRLKTGCNRLMLHARLLHFTHPKTLQK----
TRUC_PASMU      YPTTRYSLVRLIPHTGRKHQLRRHMKHLFHPILGDTQYGDTTHTGVQRLMLHAERLIFTHPITQQQ----
Y956_HELPJ      II-NKKTLLKVGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPS-SAKRLMLHAHKIA-------------
Y505_ZYMMO      AKNKGRSLVAFRPETGRTHQLRVHAATLGLPIVGDPFYGSHKDENISRMMLHAHSLEIAKPITAEAPLPK
RLUA_HAEIN      RLPNNSTRVKLTPVTGRSHQLRLHMLALGHPILGDKFYSPQAKVMSPRLCLHAEELTITHPITGETMTFN
Y956_HELPY      II-NKKTLLKVGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPSLA-KRLMLHAHKIA-------------
RUSD2_MOUSE     YNG-RSSVVQCRPLTGRTHQIRVHLQFLGHPILNDPIYNSTA-WGPSR----------------------
RUSD1_DANRE     YGGDQVTKVLLQPLTGRTHQLRVHCSAIGHPIVGDYTYSLRTDNSPYRMMLHAYFL--------------
RLUC_BUCAI      KF-SSSTLLSIIPKTGRTHQIRVHALHAGHPIFFDKRYGKKNNHKINRLLLHSSGVHFIHPKNGNKIYIK
YK27_CAEEL      LWSDTQSVVQVHIETGRTHQIRVHSQFLGHPIAGDQIYNSAV-WGPTKGKNADYQKSF------------
RLUC_RICFE      SLDNNLFLIEFTPVTGRMHQLRLHAKLLGCPIVGDDKYGNK-----EIMPYSKYMFLHANNICLSEKIFG
RLUC_BUCAP      YL--FTTLVSITPKTGRTHQIRVHTLHAGHPILFDKRYGKRLDCNIKRLLLHATSINFIHPET-------
RUSD2_HUMAN     YNG-QSSVVRCRPLTGRTHQIRVHLQFLGHPILNDPIYNS-VAWGPSR----------------------
RUSD1_MOUSE     YAGDPVSKVLLKPLTGRTHQLRVHCSALGHPIVGDLTYGQAEDQEDQRMMLHAFYL--------------
TRUC_PECCC      YPTARYSLMELKPQTGRKHQLRRHMSHIHHPIIGDTAHGDRHNRGMERLMLHASELQLNHP---------
RLUC_RICTY      XXXXXXXXIEFMPVTGRMHQLRLHAQLLGCPILGDDKYGNKEVMPYSKMFLHANNIYLSESIVGKEIKLE
RLUC_RICPR      XXXXXXXXIEFMPVTGRMHQLRLHAQLLGCPILGDDKYGNKEIMPYSKMFLHANNIYLSETIVGKEIKLE
Y209_MYCGE      VINEKAALISLELLTGRTHQIRVHLKFIQHPVYNDPLYGIKSEYG---QFLHANRICFIHP---------
Y370_MYCGE      YIAQKMSLITIRLISGRTHQIRACLNLFSNQLVGDKKYSKNRNNKYKHQALHAYELVF------------
RLUC_YERPE      RF-EHATLVKASPVTGRTHQIRVHALHAGHPIAFDDRYGYR-----------------------------
PUS6_YEAST      FSHADETVVACKPITGRTHQIRIHLARLGHPIVNDSVYCSHITKYPER-------LKFITQFPR----WE
TRUC_VIBVU      FPTTRYGLMELKPKTGRKHQLRRHMAHLRHPIVGDTTHGDREEFDAPRLLLHASELRFVHPYTQQEVVIR
YA32_SCHPO      AFDGHTSLVLCKPLTGRTHQLRVHLQYLGYPIANDPIYANKRVWG-------------------------
RLUC_RICCN      SLDNNLFLIEFTPVTGRMHQLRLHAKLLGCPILGDDKYGNK-----EIMPYSKYMFLHANNICLSEKIFG
RLUC_RICBR      SLTNNLFLVEFIPITGRMHQLRLHAKLLGCPIFGDNKYG-------------------------------
TRUC_YERPE      YETARYSLVALKPETGRKHQLRRHMAHIRHPIIGDSTHGDAQHFGCSRLMLHASHLHLNHPVTGE-----
TRUC_ECOL6      YPTTRYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGGAEHFGLQRLMLHASQLSLTHPFTGE-----
TRUC_SHIFL      YPTTRYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGGAEHFGLQRLMLHASQLSLTHPFTGE-----
TRUC_ECOLI      YPTTRYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGGAEHFGLQRLMLHASQLSLTHPFTGE-----
TRUC_ECO57      YPTTRYGLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGGAEHFGLQRLMLHASQLSLTHPFTGE-----
PUS5_ORYSJ      RLKHNHTLIQVEIHSGRPHQIRIHLAYIGHPLVDDPLYG-------------------------------
PUS5_ARATH      RDREKCSLVKVEIQSGRPHQIRIHLAYMGHPLVGDPLY--------------------------------
TRUC_HAEIN      YQTARYSLVKLIPHTGRKHXLRXHMKHVFHPIXGDTQYGDMSHLGCSRLFLHSDSLSFIHPITKEQITIT
TRUC_VIBCH      FATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTTHGDREHFSAQRLMLHASELRFMHPYTQQPLVIR
RUSD1_HUMAN     YAGDPVSKVLLKPLTGRTHQLRVHCSALGHPVVGDLTYGGREDRPF-RMMLHAFYL--------------
Y347_HELPJ      YNPFDISLLKITPLTGRTHQIRLHLSSVDHRIVGEGLYG-------------------------------
PUS7_ARATH      DTNGTHSLVSCEPVTGRTHQIRVHLQYTGHPIANDPLY--------------------------------
PUS1_ORYSJ      KAADLTSLVRAYPQSGRTHQIRLHCQYLGFPIRGDVKYSGVIEWNYDGHALHAESLSFVHPVTGLPVTFR
Y347_HELPY      YNPFDISLLKITPLTGRTHQIRLHLSSVDHRIVGEGLYG-------------------------------
RUSD1_BOVIN     YAGDPVSKVLLQPLTGRTHQLRVHCSALGHPIVGDLTYGHAL--GQERMMLHAFYL--------------
Y548_MYCPN      YLTKDLSLLTIRLVSGKTHQIRACLNLLNTQLVGDRKYQKNRNRDFKHQALHATNLSFAQLDKQKFPLLA
PUS4_ARATH      YRVIESTWLELRPLTGRKHQLRVHCAEVGTPIVGDYKYG-------------------------------
Y042_HAEIN      SCEPNLRLFILKPQTGKTHQLRVAMKSLGSPILGDGLYGKNTE-KIDRTYLHATQLEF------------
PUS7_ORYSJ      CTDGIHSIVLCKPVTGRTHQIRVHLKHIGYPIANDEVY--------------------------------
TRUC_SALTY      ------GLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGAAEHFACRRLMLHASRLELTHPFTGQPLIIQ
TRUC_SALTI      ------GLVELEPKTGRKHQXXXXXXXXXXPIIGDSKHGAAEHFACRRLMLHASRLELTHPFTGQPLIIQ
Y714_MYCCT      FXXXXXXXXXXXXXTGKKHQIRSVLSFYNNPILNDFRYNGKKE--------NDQKMIYLAAFKIEFKSLK
PUS3_ORYSJ      PTIHGCSWIELRPLTGRKHQLRVHCAALGTPIVGDYKYG----WFVHQRWKQNPQPDF-EPFTGEP--YK
RUSD4_HUMAN     STLSSA-LVELQPITGIKHQLRVHLSGLDCPILGDHKYS---DW--------------------------
PUS4_ORYSJ      SCPQGYTWLELFPRTGRKHQ--------------------------------------------------
RUSD4_XENTR     YAASGASLVELHPITGVKHQLRVHLAGLNCPILGDHKYSGRL----------------------------
RUSD4_RAT       STPSSA-LVELQPVTGIKHQLRVHLAGLDCPILGDHKYS---DW--------------------------
Y1592_SYNY3     RSPEK-TWLEVEIRTGRPHQIRIHLASLGYPLLGDRLYGGGVPINCRTYTLHSYQLGFLHLHTQQAIKLT
PUS1_ARATH      XXXXXXXXXXCELRSGRTHQIRLHCQYLGIPIRGDVKYHGVYEWNFEGHELHAECLSLDHPVTGDSIVIR
PUS5_YEAST      FKEVDENCIVLQLVTGKKHQIRNHVSQINQPILNDKRHGSTVNF--------------------------
PUS3_ARATH      PKINGCSWVELRPITSRKHQLRVHCAALGTPIVGDYKYG----WFVHKR---WKQMPQVDIEPTTGKPYK
RUSD4_DANRE     VLDNTSSLVELQPLTGVKNQLRVHMAALTCPILGDHKY--------------------------------
RUSD4_BOVIN     XXXXXXXXXELQPITGIKHQLRVHMSGLDCPILGDHKYS---DW--------------------------
RUSD4_MOUSE     XXXXXXXXXELQPVTGIKHQLRVHLSGLDCPILGDHKYS---DW--------------------------
PUS6_ORYSJ      VWPQQEAAYECKINTGKTHQIRAQLAAIGTPIVGDSAY--------------------------------
PUS5_CANGA      XXXXXXXXXXXELKTGKKHQIRKHLANLNCPIVNDTYYGGSVVKGVNGQALHSAHLVGIEP--QEQTLWK
MLRR1_PLAF7     ------TLCNVKIHTGRTHQIRVHMRHIGHPLVSDKKY--------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUB_BACSU      XXXXXQTIIQLTIHEGRNRQVRRMFEAIGHEVI-------------------------------------
Y1464_AQUAE     ---GKNTLLEITFHEGRKHLVKRFLGAFGH----------------------------------------
RLUE_PASMU      RKQIPTSWLEIKIHEGRNRQVR------------------------------------------------
PUS5_ASHGO      -------LVLLQLQTGRKHQIRKQMAQVGQPVVNDKMYGG------------------------------
QUEA_PROMP      ----------------------------------------------------------------------
Y1370_MYCLE     AIPGK-TLVRLTLHEGRKRIVR------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SEMPKDLENLIVRLKN
YJBO_BACSU      APLPQDMSKLI-----
YLYB_BACSU      APLPEDMAELIENLR-
YHCT_BACSU      APFPADMKNL------
Y1758_AQUAE     IEEPETFKSV------
RLUD_NITEU      SPLPDDMAALLQAIRN
RLUD_ZYMMO      AEMPQDMQLLFKML--
Y723_CHLP8      APLPEDMELVLEKIR-
RLUD_VIBVU      APVPDDMVELTETLR-
Y901_CHLAA      APLPADLQIVLRQLQD
RLUD_XYLFT      APVPEDLCQLLAALR-
RLUD_XYLFA      APVPEDLCQLLAVLR-
RLUD_BORBU      SEFPK-----------
RLUD_YERPE      AALPEDMVELINALK-
Y1629_SYNY3     APMPAHFEKLLVYLR-
RLUD_RALSO      AGVPDDLAELMDALE-
RLUD_XANCP      APVPEDLQRLMSALR-
RLUD_PASMU      APLPTDFVELVEALK-
RLUD_XANAC      APVPADLQRLMTVLR-
RLUD_BUCAI      VPLPQDIQELLLKI--
Y292_MYCPN      AQLDKKLDNLNLKIAN
RLUD_HAEIN      APLPDDFVELLNALK-
RLUD_SALTY      APIPQDMVDLI-----
RLUD_SALTI      APIPQDMVDLI-----
RLUD_BLOFL      APLPQDILQLIAILK-
RLUD_NEIMB      APIPNDIYHLLSVLR-
RLUD_NEIMA      APIPDDIYHLLSVLR-
RLUD_VIBPA      APVPDDM---------
PUS2_ARATH      CPPPSDLAEIVGLLR-
RLUD_PSEAE      SPLPEDFLWLLSLLR-
RLUD_BUCAP      ASLPQDMKDILLYLK-
RLUD_VIBCH      APVPDDMVEMTLALR-
PUS2_ORYSJ      CPPPDDFTEVLNEL--
RLUC_VIBPA      APMESKLEKVLVGLR-
RLUA_SHIFL      A---------------
RLUA_ECOLI      A---------------
RLUD_BUCBP      STLPRDMLNLIALL--
RLUC_VIBVU      APMGEQLEKVVQSLR-
RLUC_HAEDU      APLDHHLKTILAKLR-
RLUA_ECOL6      A---------------
RLUD_HAEDU      APLPADFVELIEALK-
RLUC_VIBCH      APLEAHLEQALTKMR-
RLUC_PASMU      APLDPEMKKILGALR-
RLUA_SALTI      ----------------
RLUD_ECOLI      APIPQDMVELI-----
RLUA_SALTY      ----------------
RLUA_ECO57      A---------------
RLUC_SHIFL      APMDEGLKRCLQKLRN
RLUC_ECOLI      APMDEGLKRCLQKLRN
YDL36_YEAST     ----------------
RLUC_ECOL6      APMDEGLKRCLQKLRN
RLUC_ECO57      APMDDGLKRCLQKLRN
RLUC_SALTY      APMDNALKRCLQVLRN
RLUA_VIBPA      ----------------
RLUC_SALTI      APMDKQLKRCLEVLRS
RLUA_YERPE      CE--------------
RLUC_HAEIN      ASLDHQMKAILQKLR-
Y745_HELPJ      VPLLKDM---------
RLUA_PASMU      ----------------
RLUD_SHIFL      APIPQDMVELI-----
RLUD_ECOL6      APIPQDMVELI-----
RLUD_ECO57      APIPQDMVELI-----
Y1567_MYCBO     SPYPADLQHALKILR-
Y1540_MYCTU     SPYPADLQHALKILR-
RLUA_VIBCH      ----------------
RLUC_PSEAE      LEAPVD----------
RLUA_HAEDU      TE--------------
RIB2_YEAST      ----------------
RLUA_VIBVU      ----------------
Y745_HELPY      VPLLKDM---------
TRUC_VIBPA      ASIDDTWQQLFTRFE-
RLUC_BUCBP      ----------------
TRUC_HAEDU      ----------------
TRUC_PASMU      ----------------
Y956_HELPJ      ----------------
Y505_ZYMMO      A---------------
RLUA_HAEIN      AK--------------
Y956_HELPY      ----------------
RUSD2_MOUSE     ----------------
RUSD1_DANRE     ----------------
RLUC_BUCAI      APLDIDFQNYL-----
YK27_CAEEL      ----------------
RLUC_RICFE      KEI-------------
RLUC_BUCAP      ----------------
RUSD2_HUMAN     ----------------
RUSD1_MOUSE     ----------------
TRUC_PECCC      ----------------
RLUC_RICTY      AKLP------------
RLUC_RICPR      AKLP------------
Y209_MYCGE      ----------------
Y370_MYCGE      ----------------
RLUC_YERPE      ----------------
PUS6_YEAST      NQQDLDAEELKVRFQ-
TRUC_VIBVU      AEVDKVWQQLFERFE-
YA32_SCHPO      ----------------
RLUC_RICCN      QE--------------
RLUC_RICBR      ----------------
TRUC_YERPE      ----------------
TRUC_ECOL6      ----------------
TRUC_SHIFL      ----------------
TRUC_ECOLI      ----------------
TRUC_ECO57      ----------------
PUS5_ORYSJ      ----------------
PUS5_ARATH      ----------------
TRUC_HAEIN      AGLDEQWQQLM-----
TRUC_VIBCH      AGLDEVWQGLL-----
RUSD1_HUMAN     ----------------
Y347_HELPJ      ----------------
PUS7_ARATH      ----------------
PUS1_ORYSJ      SPLP------------
Y347_HELPY      ----------------
RUSD1_BOVIN     ----------------
Y548_MYCPN      NYSQRQFKSQLV----
PUS4_ARATH      ----------------
Y042_HAEIN      ----------------
PUS7_ORYSJ      ----------------
TRUC_SALTY      A---------------
TRUC_SALTI      A---------------
Y714_MYCCT      K--PLDYLNNKVIIKN
PUS3_ORYSJ      LRRPEGLE--------
RUSD4_HUMAN     ----------------
PUS4_ORYSJ      ----------------
RUSD4_XENTR     ----------------
RUSD4_RAT       ----------------
Y1592_SYNY3     APLPPEL---------
PUS1_ARATH      APLP------------
PUS5_YEAST      ----------------
PUS3_ARATH      LRRPEGLD--------
RUSD4_DANRE     ----------------
RUSD4_BOVIN     ----------------
RUSD4_MOUSE     ----------------
PUS6_ORYSJ      ----------------
PUS5_CANGA      SMLPDDIVRTLTRDK-
MLRR1_PLAF7     ----------------
RLUF_ECOLI      ----------------
RLUF_SHIFL      ----------------
RLUF_SALTY      ----------------
RLUF_ECOL6      ----------------
RLUF_ECO57      ----------------
RLUF_SALTI      ----------------
RLUB_BACSU      ----------------
Y1464_AQUAE     ----------------
RLUE_PASMU      ----------------
PUS5_ASHGO      ----------------
QUEA_PROMP      ----------------
Y1370_MYCLE     ----------------