[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00290.1

[Show Plain Result]


## Summary of Sequence Search
    1::273
  401::613     2e-41  40%  635 aa  XYNB_BUTFI RecName: Full=Endo-1,4-beta-xylanase B;       
  564::645     6e-04  28%  657 aa  YUXL_BACSU RecName: Full=Uncharacterized peptidase yuxL;       
  123::197     6e-04  29%  398 aa  AAAD_RABIT RecName: Full=Arylacetamide deacetylase;       
    1::273

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKHATIIICPGGGYHFVSDREADPVALKLITMGYNAFVL
XYNB_BUTFI      --------------------------------KRDCMLVIPGGGYCMCCSHEGELAAMEFYNRGMNAFVL
YUXL_BACSU      ----------------------------------------------------------------------
AAAD_RABIT      -------------------------------------------GYDLLSRRTADRLDVVVVSTNYRL---


                         .         .         *         .         .         .         .:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
XYNB_BUTFI      SYTTDITMSVPLEDISRAVRFIRKNASKYNIDGKKLVIMGFSAGSHVCGSLAVHFDDVKDNNPEYADISG
YUXL_BACSU      ----------------------------------------------------------------------
AAAD_RABIT      --APEYHFPIQFEDVYDALKLRQDVLEKYGVDPERVGVSGDSAGGNLAAAV-------------------


                         +         .         .         .         .         *         .:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
XYNB_BUTFI      RPDGVILSYPVITTGR-YTHADSVRTLLGANPTDEE--LTYFSLEKQVKDNTPPCFIWQTEEDSVVPVEN
YUXL_BACSU      ---------------------------LEHDMFEDTEKLWDRSPLKYAANVETPLLILHGERDDRCPIEQ
AAAD_RABIT      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRxxxxxxxxxxxxxxxxxxxxxxxx
XYNB_BUTFI      SYLFANALREKKIPFAHYVFPRGFHGLTVANDE------------------------------
YUXL_BACSU      AEQLFIALKKMGKETKLVRFPNASHNLSRTGHPRQRIKR------------------------
AAAD_RABIT      ---------------------------------------------------------------