[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00302.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    1::228     e-109  82%  229 aa  GPMA2_LACSS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     e-108  84%  230 aa  GPMA2_LACPL RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     e-107  80%  230 aa  GPMA1_LACJO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     e-106  79%  230 aa  GPMA_LACAC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     9e-96  73%  228 aa  GPMA_ENTFA RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     4e-93  71%  227 aa  GPMA_PASMU RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPZ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPG RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPF RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRPB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRP8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRP6 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     6e-92  69%  231 aa  GPMA_STRP3 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     8e-92  71%  227 aa  GPMA_ACTPJ RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     8e-92  71%  227 aa  GPMA_ACTP7 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     8e-92  71%  227 aa  GPMA_ACTP2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-91  68%  231 aa  GPMA_STRP1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     5e-90  68%  230 aa  GPMA_STRSV RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRZJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRR6 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRPN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRPI RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRP7 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRP4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-89  68%  230 aa  GPMA_STRP2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-89  67%  230 aa  GPMA_STRTD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-89  67%  230 aa  GPMA_STRT2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-89  67%  230 aa  GPMA_STRT1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-89  67%  230 aa  GPMA_STRZT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-89  67%  230 aa  GPMA_STRZP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-89  67%  230 aa  GPMA_STRPS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-89  67%  230 aa  GPMA_STRPJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     7e-89  67%  230 aa  GPMA_STRGC RecName: Full=2,3-bisphosphoglycerate-dependent
    2::227     9e-89  69%  227 aa  GPMA_ACTSZ RecName: Full=2,3-bisphosphoglycerate-dependent
    2::227     1e-88  69%  227 aa  GPMA_MANSM RecName: Full=2,3-bisphosphoglycerate-dependent
    2::222     1e-88  69%  227 aa  GPMA_HAEIN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-88  68%  231 aa  GPMA_STRS7 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-88  68%  231 aa  GPMA_STREM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-88  68%  231 aa  GPMA_STRE4 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     3e-88  68%  229 aa  GPMA_LISIN RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     1e-87  67%  229 aa  GPMA_LISW6 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-87  66%  230 aa  GPMA_STRU0 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-87  67%  229 aa  GPMA_LISMH RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-87  66%  230 aa  GPMA_STRA5 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-87  66%  230 aa  GPMA_STRA3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-87  66%  230 aa  GPMA_STRA1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-87  66%  233 aa  GPMA_LACLA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     4e-87  66%  233 aa  GPMA_LACLS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     4e-87  66%  233 aa  GPMA_LACLM RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     6e-87  66%  229 aa  GPMA_LISMF RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     6e-87  66%  229 aa  GPMA_LISMC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     1e-86  66%  230 aa  GPMA_STRMU RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-86  66%  229 aa  GPMA_LISMO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     1e-85  65%  230 aa  GPMA_STRS2 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     1e-85  67%  227 aa  GPMA_HAEPS RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-85  67%  227 aa  GPMA_NEIM0 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     3e-85  67%  227 aa  GPMA_NEIMB RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     6e-85  67%  227 aa  GPMA_NEIG2 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     6e-85  67%  227 aa  GPMA_NEIG1 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     6e-85  67%  227 aa  GPMA_HAEDU RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     7e-85  67%  227 aa  GPMA_NEIMA RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-84  66%  227 aa  GPMA_NEIMF RecName: Full=2,3-bisphosphoglycerate-dependent
    2::222     3e-83  66%  227 aa  GPMA_HAEIE RecName: Full=2,3-bisphosphoglycerate-dependent
    2::222     3e-83  66%  227 aa  GPMA_HAEI8 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::222     7e-83  66%  227 aa  GPMA_HAEIG RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-82  65%  227 aa  GPMA_HAES2 RecName: Full=2,3-bisphosphoglycerate-dependent
    2::224     2e-82  65%  227 aa  GPMA_HAES1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     5e-81  61%  228 aa  GPMA_STACT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     1e-80  60%  228 aa  GPMA_STAAR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAW RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAAB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAA9 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAA8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAA3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAA2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-80  60%  228 aa  GPMA_STAA1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     6e-80  61%  228 aa  GPMA_STAHJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-78  61%  230 aa  GPMA_HALHL RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     2e-78  58%  248 aa  GPMA_ALTMD RecName: Full=2,3-bisphosphoglycerate-dependent
    2::227     2e-77  60%  228 aa  GPMA_FUSNN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     3e-77  57%  248 aa  GPMA_TERTT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-77  60%  248 aa  PMGY_CANAL RecName: Full=Phosphoglycerate mutase;       
    1::225     4e-77  59%  228 aa  GPMA_STAS1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-75  59%  247 aa  GPMA_CHLP8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-75  60%  229 aa  GPMA_POLNS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-75  59%  249 aa  GPMA_CHLT3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-74  59%  249 aa  GPMA_THETN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     1e-74  57%  232 aa  GPMA_ALHEH RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-74  59%  229 aa  GPMA_POLSQ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     2e-74  58%  247 aa  GPMA_GEOSL RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-74  57%  228 aa  GPMA_STAES RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     6e-74  59%  247 aa  GPMA_CHLTE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     8e-74  57%  228 aa  GPMA_STAEQ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     1e-73  60%  228 aa  GPMA_ZYMMO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-73  58%  247 aa  GPMA_PROVI RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     1e-73  56%  249 aa  GPMA_XANOP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     1e-73  59%  228 aa  GPMA_ERYLH RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     2e-73  56%  249 aa  GPMA_XANOR RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     2e-73  56%  249 aa  GPMA_XANOM RecName: Full=2,3-bisphosphoglycerate-dependent
    2::227     2e-73  55%  249 aa  GPMA_CLOPH RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-73  57%  247 aa  GPMA_CHLL2 RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     4e-73  56%  249 aa  GPMA_XANAC RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     5e-73  57%  249 aa  GPMA_XANCP RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     5e-73  57%  249 aa  GPMA_XANCB RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     5e-73  57%  249 aa  GPMA_XANC8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     5e-73  59%  240 aa  GPMA2_BACC1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-73  58%  251 aa  GPMA_THEP3 RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     9e-73  56%  249 aa  GPMA_XANC5 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     9e-73  58%  251 aa  GPMA_THEPX RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-72  57%  247 aa  GPMA_VARPS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-72  57%  250 aa  GPMA_POLNA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-72  59%  247 aa  GPMA_LEPCP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::226     2e-72  54%  248 aa  GPMA_BDEBA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-72  57%  234 aa  GPMA_GEOSM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-72  58%  247 aa  GPMA_ACIAC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     4e-72  56%  249 aa  GPMA2_NITEU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALTY RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALTI RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALSV RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALPC RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALPB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALNS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALHS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALG2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALEP RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALCH RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-72  57%  250 aa  GPMA_SALA4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     6e-72  56%  249 aa  GPMA_PELPB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     7e-72  57%  250 aa  GPMA_SALPK RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     7e-72  57%  250 aa  GPMA_SALPA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     7e-72  57%  250 aa  GPMA_SALDC RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_SHISS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_SHIFL RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_SHIF8 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_SHIBS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_SHIB3 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ESCF3 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOSM RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOSE RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOLU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOLI RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOLC RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOL6 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOL5 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOK1 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOHS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECODH RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECOBW RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO8A RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO81 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO7I RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO5E RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO57 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO55 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO45 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     9e-72  57%  250 aa  GPMA_ECO27 RecName: Full=2,3-bisphosphoglycerate-dependent
    4::221     1e-71  57%  249 aa  PGAM_DICDI RecName: Full=Probable phosphoglycerate mutase;       
    2::220     1e-71  55%  248 aa  GPMA_METI4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-71  57%  247 aa  GPMA_PROA2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     2e-71  57%  250 aa  GPMA_SHIDS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     2e-71  57%  250 aa  GPMA_ECO24 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-71  58%  247 aa  GPMA_DELAS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-71  57%  247 aa  GPMA_CHLPD RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-71  57%  250 aa  GPMA_CITK8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-71  57%  247 aa  GPMA_CHLPB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     5e-71  55%  234 aa  GPMA_GEOBB RecName: Full=2,3-bisphosphoglycerate-dependent
    2::227     1e-70  53%  247 aa  GPMA_TREDE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-70  56%  248 aa  GPMA_RALEH RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     1e-70  57%  250 aa  GPMA_ENTS8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-70  57%  247 aa  GPMA_RHOFD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-70  56%  248 aa  GPMA_RALEJ RecName: Full=2,3-bisphosphoglycerate-dependent
    5::227     2e-70  54%  250 aa  GPMA_ERWCT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-70  55%  248 aa  GPMA_RALSO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-70  56%  248 aa  GPMA_CUPTR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-70  57%  247 aa  GPMA_GEOMG RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     5e-70  54%  248 aa  GPMA_METHJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     5e-70  57%  248 aa  GPMA_BORBZ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     5e-70  57%  248 aa  GPMA_BORBU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::227     9e-70  54%  250 aa  GPMA_SERP5 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     9e-70  55%  247 aa  GPMA_PELLD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     9e-70  57%  248 aa  GPMA_BORAP RecName: Full=2,3-bisphosphoglycerate-dependent
    5::227     1e-69  53%  250 aa  GPMA_PECCP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-69  56%  247 aa  GPMA_DIAST RecName: Full=2,3-bisphosphoglycerate-dependent
    1::218     2e-69  56%  247 aa  GPMA_THEFY RecName: Full=2,3-bisphosphoglycerate-dependent
    1::218     2e-69  56%  243 aa  GPMA_MARMM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-69  55%  247 aa  GPMA_ACISJ RecName: Full=2,3-bisphosphoglycerate-dependent
    5::222     3e-69  55%  250 aa  GPMA_PHOLL RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-69  56%  249 aa  GPMA_AZOSE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     3e-69  54%  248 aa  GPMA_SOLUE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-69  54%  247 aa  PMG1_YEAST RecName: Full=Phosphoglycerate mutase 1;       
    7::221     6e-69  56%  253 aa  GPMA_STRGG RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     6e-69  56%  248 aa  GPMA_BORGA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     7e-69  55%  228 aa  GPMA_SPHWW RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-69  56%  248 aa  GPMA_COPPD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-69  53%  247 aa  GPMA_CHLCH RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-69  56%  248 aa  GPMA_BORHD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     7e-69  57%  250 aa  GPMA_BORDL RecName: Full=2,3-bisphosphoglycerate-dependent
    7::225     1e-68  57%  249 aa  GPMA_LEIXX RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     1e-68  53%  243 aa  GPMA_CLOAB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-68  56%  248 aa  GPMA_BORT9 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::222     2e-68  54%  250 aa  GPMA_EDWI9 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     2e-68  57%  250 aa  GPMA_BORRA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::227     3e-68  53%  250 aa  GPMA_PROMH RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     3e-68  53%  248 aa  GPMA_PARD8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-68  55%  250 aa  GPMA_BORPD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-68  55%  251 aa  GPMA2_NITMU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     6e-68  55%  250 aa  GPMA_ERWT9 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     8e-68  55%  237 aa  GPMA_CAUSK RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  248 aa  GPMA_BURS3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURPS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURP6 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURP1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURP0 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURMS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURMA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURM9 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  249 aa  GPMA_BURM7 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::214     1e-67  55%  240 aa  GPMA_NITOC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     1e-67  53%  244 aa  GPMA_FRAAA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-67  55%  232 aa  GPMA_CLOB8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     1e-67  54%  249 aa  GPMA_AZOSB RecName: Full=2,3-bisphosphoglycerate-dependent
    7::228     2e-67  53%  253 aa  GPMA_STRAW RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-67  55%  248 aa  GPMA_BURCJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-67  55%  248 aa  GPMA_BURCC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-67  55%  250 aa  GPMA_BORPA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::225     2e-67  54%  247 aa  GPMA_METPP RecName: Full=2,3-bisphosphoglycerate-dependent
    9::227     3e-67  56%  251 aa  GPMA_RHOSR RecName: Full=2,3-bisphosphoglycerate-dependent
    9::227     3e-67  55%  251 aa  GPMA_RHOOB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-67  55%  250 aa  GPMA_BORPE RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-67  55%  250 aa  GPMA_BORBR RecName: Full=2,3-bisphosphoglycerate-dependent
    4::225     5e-67  54%  249 aa  GPMA_XYLFM RecName: Full=2,3-bisphosphoglycerate-dependent
    4::225     5e-67  54%  249 aa  GPMA_XYLFA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     5e-67  55%  250 aa  GPMA_BURTA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     7e-67  53%  253 aa  PGAM2_RAT RecName: Full=Phosphoglycerate mutase 2;       
    5::227     7e-67  54%  250 aa  GPMA_ENT38 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-67  54%  245 aa  GPMA_BACC3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     7e-67  54%  245 aa  GPMA_BACAH RecName: Full=2,3-bisphosphoglycerate-dependent
    5::221     9e-67  56%  245 aa  GPMA_NOCFA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     9e-67  55%  245 aa  GPMA1_BACC1 RecName: Full=2,3-bisphosphoglycerate-dependent
    7::220     1e-66  57%  251 aa  GPMA_CLAMS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-66  53%  248 aa  GPMA_BURPP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-66  55%  248 aa  GPMA_BURCM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-66  54%  245 aa  GPMA_BACC4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     2e-66  55%  228 aa  GPMA_NOVAD RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-66  55%  248 aa  GPMA_BURVG RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     2e-66  51%  248 aa  GPMA2_BACTN RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     3e-66  53%  253 aa  PGAM2_MOUSE RecName: Full=Phosphoglycerate mutase 2;       
    1::220     3e-66  54%  245 aa  GPMA_BACCR RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPY RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPP RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPN RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPG RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPE RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERPA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     3e-66  55%  250 aa  GPMA_YERP3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-66  54%  248 aa  GPMA_BURA4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     3e-66  53%  245 aa  GPMA_BACWK RecName: Full=2,3-bisphosphoglycerate-dependent
    4::225     5e-66  53%  249 aa  GPMA_XYLFT RecName: Full=2,3-bisphosphoglycerate-dependent
    4::225     5e-66  53%  249 aa  GPMA_XYLF2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     5e-66  51%  248 aa  GPMA_BACFR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     5e-66  51%  248 aa  GPMA_BACFN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     5e-66  54%  245 aa  GPMA_BACCQ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     5e-66  54%  245 aa  GPMA_BACC7 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     6e-66  54%  250 aa  GPMA_BORA1 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     6e-66  54%  245 aa  GPMA_BACHK RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     8e-66  54%  245 aa  GPMA_BACCZ RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     1e-65  52%  253 aa  PGAM2_HUMAN RecName: Full=Phosphoglycerate mutase 2;       
    1::218     1e-65  54%  228 aa  GPMA_SPHAL RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     1e-65  54%  250 aa  GPMA_YERE8 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     1e-65  53%  248 aa  GPMA_BRAHW RecName: Full=2,3-bisphosphoglycerate-dependent
    7::228     2e-65  53%  253 aa  GPMA_STRCO RecName: Full=2,3-bisphosphoglycerate-dependent
    5::226     2e-65  50%  249 aa  GPMA_HAMD5 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-65  54%  245 aa  GPMA_BACC0 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-65  54%  245 aa  GPMA_BACAN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-65  54%  245 aa  GPMA_BACAC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     2e-65  54%  245 aa  GPMA_BACAA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     3e-65  54%  248 aa  GPMA_CORGL RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     3e-65  54%  248 aa  GPMA_CORGB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     3e-65  52%  249 aa  GPMA1_BACTN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     4e-65  54%  249 aa  GPMA_UNCTG RecName: Full=2,3-bisphosphoglycerate-dependent
    5::222     4e-65  53%  250 aa  GPMA_SODGM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     4e-65  53%  249 aa  GPMA_DESMR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     4e-65  53%  245 aa  GPMA_BACCN RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     5e-65  52%  249 aa  GPMA_STRMK RecName: Full=2,3-bisphosphoglycerate-dependent
    4::223     9e-65  51%  249 aa  GPMA_STRM5 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     9e-65  53%  245 aa  GPMA_BACC2 RecName: Full=2,3-bisphosphoglycerate-dependent
    4::226     1e-64  53%  249 aa  GPMA_PROAC RecName: Full=2,3-bisphosphoglycerate-dependent
   11::229     1e-64  53%  254 aa  GPMA_CORJK RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     1e-64  52%  248 aa  GPMA_BURP8 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     1e-64  51%  254 aa  PGAM1_CHICK RecName: Full=Phosphoglycerate mutase 1;       
    1::220     2e-64  52%  228 aa  GPMA_RHOCS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     2e-64  52%  250 aa  GPMA_KLEP7 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     2e-64  52%  250 aa  GPMA_KLEP3 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     2e-64  53%  237 aa  GPMA_CAUCR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     2e-64  53%  237 aa  GPMA_CAUCN RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     2e-64  51%  249 aa  GPMA_METB6 RecName: Full=2,3-bisphosphoglycerate-dependent
    4::224     2e-64  54%  248 aa  GPMA_ARTS2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::218     7e-64  54%  247 aa  GPMA_NOCSJ RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     1e-63  52%  254 aa  PGAM1_RAT RecName: Full=Phosphoglycerate mutase 1;       
    5::224     1e-63  52%  254 aa  PGAM1_MOUSE RecName: Full=Phosphoglycerate mutase 1;       
    5::224     1e-63  52%  254 aa  PGAM1_HUMAN RecName: Full=Phosphoglycerate mutase 1;       
    4::218     1e-63  55%  248 aa  GPMA_ARTCA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     2e-63  52%  254 aa  PGAM1_BOVIN RecName: Full=Phosphoglycerate mutase 1;       
    5::236     2e-63  50%  237 aa  GPMA_BAUCH RecName: Full=2,3-bisphosphoglycerate-dependent
    5::221     3e-63  52%  254 aa  PGAM1_PONAB RecName: Full=Phosphoglycerate mutase 1;       
    2::231     3e-63  50%  251 aa  GPMA_TREPS RecName: Full=2,3-bisphosphoglycerate-dependent
    2::231     3e-63  50%  251 aa  GPMA_TREPA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     3e-63  50%  237 aa  GPMA_HYPNA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::220     6e-63  51%  249 aa  GPMA_DESVM RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     6e-63  49%  225 aa  GPMA1_LACPL RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     2e-62  49%  253 aa  GPMA_DESDG RecName: Full=2,3-bisphosphoglycerate-dependent
    1::219     2e-62  53%  245 aa  GPMA_VEREI RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     4e-62  50%  246 aa  GPMA_DICNV RecName: Full=2,3-bisphosphoglycerate-dependent
    7::220     5e-62  54%  251 aa  GPMA_CLAM3 RecName: Full=2,3-bisphosphoglycerate-dependent
    7::226     7e-62  52%  250 aa  GPMA_COREF RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     1e-61  50%  249 aa  GPMA_METPE RecName: Full=2,3-bisphosphoglycerate-dependent
    5::225     1e-61  46%  230 aa  GPMA_BUCAP RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     2e-61  47%  250 aa  GPMA_DESVH RecName: Full=2,3-bisphosphoglycerate-dependent
    7::224     2e-61  52%  251 aa  GPMA_MYCUA RecName: Full=2,3-bisphosphoglycerate-dependent
    5::229     6e-61  48%  259 aa  PMGE_MOUSE RecName: Full=Bisphosphoglycerate mutase;       
    5::229     8e-61  48%  259 aa  PMGE_MACFA RecName: Full=Bisphosphoglycerate mutase;       
    5::229     8e-61  48%  259 aa  PMGE_HUMAN RecName: Full=Bisphosphoglycerate mutase;       
    7::224     8e-61  52%  251 aa  GPMA_MYCMM RecName: Full=2,3-bisphosphoglycerate-dependent
    5::229     1e-60  49%  259 aa  PMGE_RABIT RecName: Full=Bisphosphoglycerate mutase;       
    5::224     2e-60  50%  254 aa  PGAM4_HUMAN RecName: Full=Probable phosphoglycerate mutase 4;      
    1::228     2e-60  50%  247 aa  GPMA_HYDS0 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     2e-60  46%  250 aa  GPMA_DESVV RecName: Full=2,3-bisphosphoglycerate-dependent
    5::223     2e-60  48%  231 aa  GPMA_BUCAT RecName: Full=2,3-bisphosphoglycerate-dependent
    5::223     2e-60  48%  231 aa  GPMA_BUCA5 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::223     3e-60  48%  231 aa  GPMA_BUCAI RecName: Full=2,3-bisphosphoglycerate-dependent
    4::216     3e-60  52%  246 aa  GPMA_BIFLO RecName: Full=2,3-bisphosphoglycerate-dependent
    4::216     3e-60  52%  246 aa  GPMA_BIFLI RecName: Full=2,3-bisphosphoglycerate-dependent
    4::216     3e-60  52%  246 aa  GPMA_BIFLD RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     4e-60  50%  248 aa  GPMA_CORDI RecName: Full=2,3-bisphosphoglycerate-dependent
    5::222     4e-60  46%  232 aa  GPMA_BLOFL RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-60  56%  210 aa  GPMA_PARL1 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::226     5e-60  48%  232 aa  GPMA_BLOPB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::208     6e-60  54%  221 aa  GPMA_TROWT RecName: Full=2,3-bisphosphoglycerate-dependent
    1::208     6e-60  54%  221 aa  GPMA_TROW8 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     8e-60  50%  254 aa  PGAM4_PANTR RecName: Full=Probable phosphoglycerate mutase 4;      
    7::221     2e-59  51%  249 aa  GPMA_MYCPA RecName: Full=2,3-bisphosphoglycerate-dependent
    7::221     2e-59  51%  249 aa  GPMA_MYCA1 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::229     2e-58  47%  259 aa  PMGE_BOVIN RecName: Full=Bisphosphoglycerate mutase;       
    1::223     6e-58  48%  248 aa  GPMA_PORGI RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     6e-58  48%  248 aa  GPMA_PORG3 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::228     6e-58  51%  229 aa  GPMA2_LACJO RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     1e-57  58%  207 aa  GPMA_BRAJA RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     1e-57  59%  207 aa  GPMA_NITHX RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     2e-57  57%  207 aa  GPMA_RHOPB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     3e-57  48%  248 aa  GPMA_CORK4 RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     4e-57  56%  207 aa  GPMA_BRASB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::224     5e-57  48%  253 aa  PGAM2_BOVIN RecName: Full=Phosphoglycerate mutase 2;       
    7::221     9e-57  49%  249 aa  GPMA_MYCTU RecName: Full=2,3-bisphosphoglycerate-dependent
    7::221     9e-57  49%  249 aa  GPMA_MYCTA RecName: Full=2,3-bisphosphoglycerate-dependent
    9::226     9e-57  48%  247 aa  GPMA_MYCLE RecName: Full=2,3-bisphosphoglycerate-dependent
    9::226     9e-57  48%  247 aa  GPMA_MYCLB RecName: Full=2,3-bisphosphoglycerate-dependent
    7::221     9e-57  49%  249 aa  GPMA_MYCBT RecName: Full=2,3-bisphosphoglycerate-dependent
    7::221     9e-57  49%  249 aa  GPMA_MYCBP RecName: Full=2,3-bisphosphoglycerate-dependent
    7::221     9e-57  49%  249 aa  GPMA_MYCBO RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     2e-56  56%  207 aa  GPMA_BRASO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::224     7e-56  47%  229 aa  GPMA_NAUPA RecName: Full=2,3-bisphosphoglycerate-dependent
    6::205     3e-55  55%  207 aa  GPMA_XANP2 RecName: Full=2,3-bisphosphoglycerate-dependent
    6::202     8e-55  56%  207 aa  GPMA_NITWN RecName: Full=2,3-bisphosphoglycerate-dependent
    5::221     8e-55  46%  232 aa  GPMA_BUCBP RecName: Full=2,3-bisphosphoglycerate-dependent
    6::205     1e-54  54%  207 aa  GPMA_OLICO RecName: Full=2,3-bisphosphoglycerate-dependent
    1::223     1e-54  46%  235 aa  GPMA1_LACSS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::222     1e-54  45%  248 aa  GPMA_ELUMP RecName: Full=2,3-bisphosphoglycerate-dependent
    5::228     2e-54  45%  234 aa  GPMA_WIGBR RecName: Full=2,3-bisphosphoglycerate-dependent
    6::194     2e-54  57%  207 aa  GPMA_RHOP5 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     7e-54  54%  211 aa  GPMA_AGRRK RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     9e-54  54%  206 aa  GPMA_RHILO RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-53  54%  206 aa  GPMA_METSB RecName: Full=2,3-bisphosphoglycerate-dependent
   10::207     3e-53  54%  211 aa  PMGY_SCHPO RecName: Full=Phosphoglycerate mutase;       
    5::204     1e-52  52%  211 aa  GPMA_RHIME RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-52  52%  211 aa  GPMA_RHILW RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-52  54%  206 aa  GPMA_OCHA4 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::194     2e-52  55%  213 aa  GPMA_CYTH3 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     2e-52  54%  206 aa  GPMA_BRUME RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     2e-52  54%  206 aa  GPMA_BRUMB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::220     5e-52  44%  230 aa  GPMA_BUCCC RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUSU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUSI RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUC2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUAB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUA2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-52  54%  206 aa  GPMA_BRUA1 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     6e-52  51%  211 aa  GPMA_AGRVS RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     8e-52  52%  211 aa  GPMA_RHIL3 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-51  53%  206 aa  GPMA_MESSB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-51  53%  206 aa  GPMA_BRUO2 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::202     1e-51  52%  206 aa  GPMA_BARBK RecName: Full=2,3-bisphosphoglycerate-dependent
    5::201     2e-51  52%  206 aa  GPMA_BART1 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     4e-51  51%  211 aa  GPMA_RHIE6 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::190     5e-51  55%  206 aa  GPMA_BARHE RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-50  52%  212 aa  GPMA_METPB RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     3e-50  52%  212 aa  GPMA_METEP RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     3e-50  52%  212 aa  GPMA_METC4 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-50  50%  211 aa  GPMA_SINMW RecName: Full=2,3-bisphosphoglycerate-dependent
    5::190     8e-50  54%  206 aa  GPMA_BARQU RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-49  50%  206 aa  GPMA_AZOC5 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     1e-48  50%  207 aa  GPMA_BEII9 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     4e-48  43%  238 aa  GPMA_PELUB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::228     4e-48  52%  235 aa  GPMA_METVS RecName: Full=2,3-bisphosphoglycerate-dependent
    1::217     1e-46  53%  226 aa  GPMA_PARUW RecName: Full=2,3-bisphosphoglycerate-dependent
    1::229     1e-46  52%  233 aa  GPMA_CYAP7 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-46  48%  211 aa  GPMA_RHISN RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     5e-46  50%  208 aa  GPMA_METS4 RecName: Full=2,3-bisphosphoglycerate-dependent
    5::204     2e-44  47%  212 aa  GPMA_METRJ RecName: Full=2,3-bisphosphoglycerate-dependent
    1::226     3e-42  48%  227 aa  GPMA_PSEA6 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     4e-42  47%  226 aa  GPMA_CHLMU RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     8e-42  47%  226 aa  GPMA_CHLTB RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     1e-41  47%  226 aa  GPMA_CHLT2 RecName: Full=2,3-bisphosphoglycerate-dependent
    1::230     1e-41  50%  232 aa  GPMA1_GLOVI RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     1e-41  47%  226 aa  GPMA_CHLTR RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     1e-41  47%  226 aa  GPMA_CHLTA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::188     1e-41  49%  219 aa  GPMA2_GLOVI RecName: Full=2,3-bisphosphoglycerate-dependent
    1::221     4e-41  38%  237 aa  GPMA1_NITMU RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     1e-40  49%  227 aa  GPMA_CHLAB RecName: Full=2,3-bisphosphoglycerate-dependent
    9::226     1e-40  38%  234 aa  GPMA1_NITEU RecName: Full=2,3-bisphosphoglycerate-dependent
    1::200     2e-39  42%  209 aa  GPMA_RHIEC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     8e-37  48%  227 aa  GPMA_CHLFF RecName: Full=2,3-bisphosphoglycerate-dependent
    1::212     2e-36  47%  227 aa  GPMA_CHLCV RecName: Full=2,3-bisphosphoglycerate-dependent
    1::213     3e-36  48%  228 aa  GPMA_CHLPN RecName: Full=2,3-bisphosphoglycerate-dependent
    7::233     5e-34  44%  241 aa  GPMA_METMA RecName: Full=2,3-bisphosphoglycerate-dependent
    1::226     9e-33  48%  248 aa  GPMA_METAC RecName: Full=2,3-bisphosphoglycerate-dependent
    8::279     2e-31  39%  303 aa  PMG3_YEAST RecName: Full=Phosphoglycerate mutase 3;       
   12::277     7e-30  37%  311 aa  PMG2_YEAST RecName: Full=Phosphoglycerate mutase 2;       
   18::210     2e-15  32%  230 aa  YO283_YEAST RecName: Full=Probable phosphoglycerate mutase YOR283W;
    1::113     5e-09  40%  269 aa  TIGAR_MOUSE RecName: Full=Probable fructose-2,6-bisphosphatase
    1::102     9e-09  31%  193 aa  PHOE_BACSU RecName: Full=Uncharacterized phosphatase phoE;       
    2::156     1e-08  32%  209 aa  YFFL_SCHPO RecName: Full=Probable phosphoglycerate mutase C1687.21;
    6::208     1e-08  34%  270 aa  TIGAR_BOVIN RecName: Full=Probable fructose-2,6-bisphosphatase
    6::234     4e-08  31%  270 aa  TIGAR_HUMAN RecName: Full=Probable fructose-2,6-bisphosphatase
    1::161     6e-08  30%  215 aa  GPMB_ECOUT RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECOL6 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECOL5 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECOK1 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECO81 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECO7I RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-08  30%  215 aa  GPMB_ECO45 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHISS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHIFL RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHIF8 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHIDS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHIBS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_SHIB3 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOSM RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOSE RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOLU RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOLI RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOLC RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOHS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECODH RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECOBW RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECO8A RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECO5E RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECO57 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECO55 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-07  30%  215 aa  GPMB_ECO24 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    2::85      2e-07  36%  202 aa  COBC_SALTY RecName: Full=Alpha-ribazole phosphatase;       
    6::100     4e-07  35%  257 aa  TIGRB_DANRE RecName: Full=Probable fructose-2,6-bisphosphatase
    1::161     5e-07  30%  215 aa  GPMB_ENTS8 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-07  28%  215 aa  GPMB_SALTI RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     6e-07  30%  215 aa  GPMB_KLEP3 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::92      8e-07  34%  215 aa  GPMB_PHOLL RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::161     8e-07  29%  215 aa  GPMB_KLEP7 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    2::84      8e-07  38%  202 aa  COBC_SALTI RecName: Full=Alpha-ribazole phosphatase;       
    1::161     1e-06  29%  215 aa  GPMB_ESCF3 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALTY RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALSV RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALPB RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALPA RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALNS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALHS RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALG2 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALEP RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALDC RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     2e-06  28%  215 aa  GPMB_SALA4 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    5::63      3e-06  41%  200 aa  GPM_THEAC RecName: Full=2,3-bisphosphoglycerate-dependent
    1::106     3e-06  30%  215 aa  GPMB_PROMH RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     5e-06  28%  215 aa  GPMB_SALAR RecName: Full=Probable phosphoglycerate mutase gpmB;    
  250::410     5e-06  35%  531 aa  F262_BOVIN RecName:
    1::89      7e-06  31%  215 aa  GPMB_SERP5 RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::100     7e-06  30%  215 aa  GPMB_ERWT9 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     7e-06  29%  215 aa  GPMB_ENT38 RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     9e-06  27%  215 aa  GPMB_SALPC RecName: Full=Probable phosphoglycerate mutase gpmB;    
    1::161     9e-06  27%  215 aa  GPMB_SALCH RecName: Full=Probable phosphoglycerate mutase gpmB;    
    2::85      9e-06  32%  203 aa  COBC_ECOLI RecName: Full=Alpha-ribazole phosphatase;       
  249::409     2e-05  32%  505 aa  F262_HUMAN RecName:
   89::152     2e-05  36%  289 aa  PGAM5_DROPS RecName: Full=Phosphoglycerate mutase family member 5
    1::161     2e-05  28%  215 aa  GPMB_CITK8 RecName: Full=Probable phosphoglycerate mutase gpmB;    
  250::411     2e-05  29%  470 aa  F26L_CHICK RecName: Full=6PF-2-K/Fru-2,6-P2ASE liver
    1::161     3e-05  27%  215 aa  GPMB_SALPK RecName: Full=Probable phosphoglycerate mutase gpmB;    
    2::77      3e-05  30%  164 aa  Y400_SYNY3 RecName: Full=Uncharacterized protein sll0400;        
  251::411     3e-05  31%  471 aa  F261_RAT RecName:
  252::412     4e-05  32%  557 aa  F262_RAT RecName:
  252::412     8e-05  32%  519 aa  F262_MOUSE RecName:
  249::310     1e-04  38%  469 aa  F264_MACFA RecName:
  249::310     1e-04  38%  469 aa  F264_HUMAN RecName:
   96::185     2e-04  38%  283 aa  PGAM5_CAEBR RecName: Full=Phosphoglycerate mutase family member 5
    1::91      2e-04  26%  215 aa  GPMB_YERPY RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPS RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPP RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPN RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPG RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPE RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPB RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERPA RecName: Full=Probable phosphoglycerate mutase gpmB;  
    1::91      2e-04  26%  215 aa  GPMB_YERP3 RecName: Full=Probable phosphoglycerate mutase gpmB;  
  251::411     2e-04  30%  471 aa  F261_MOUSE RecName:
  224::289     2e-04  36%  452 aa  F26_YEAST RecName: Full=Fructose-2,6-bisphosphatase;       
  249::310     2e-04  36%  469 aa  F264_RAT RecName:
  249::310     2e-04  36%  469 aa  F264_MOUSE RecName:
   48::112     3e-04  40%  154 aa  RISB_XYLFA RecName: Full=6,7-dimethyl-8-ribityllumazine synthase;  
   34::96      6e-04  34%  414 aa  PROA_LACRJ RecName: Full=Gamma-glutamyl phosphate reductase;       
   34::96      6e-04  34%  414 aa  PROA_LACRD RecName: Full=Gamma-glutamyl phosphate reductase;       
    6::47      8e-04  31%  271 aa  YK23_YEAST RecName: Full=Uncharacterized protein YKR043C;
   57::112     8e-04  41%  154 aa  RISB_XYLFT RecName: Full=6,7-dimethyl-8-ribityllumazine synthase;  
   57::112     8e-04  41%  154 aa  RISB_XYLFM RecName: Full=6,7-dimethyl-8-ribityllumazine synthase;  
   57::112     8e-04  41%  154 aa  RISB_XYLF2 RecName: Full=6,7-dimethyl-8-ribityllumazine synthase;  
   89::152     8e-04  34%  289 aa  PGAM5_DROME RecName: Full=Phosphoglycerate mutase family member 5
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
GPMA2_LACSS     MAKLVFIRHGQSEWNLSNQFTGWVDVNLSEEGVRQAQNAGALLKKEGILFDQAYTSVLTRAIKTLHYALE
GPMA2_LACPL     MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTRAIKTLHYVLE
GPMA1_LACJO     MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTRAIKTLHYALE
GPMA_LACAC      MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTRAIKTLHYALE
GPMA_ENTFA      MPKLVFSRHGLSEWNALNQFTGWADVDLAPEGVEEAKEGGRKIKEAGIEFDVAYTSVLTRAIKTCNYLLE
GPMA_PASMU      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGKKLLEAGFEFDIAFTSVLTRAIKTCNIVLE
GPMA_STRPZ      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPM      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPG      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPF      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPD      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPC      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRPB      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRP8      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRP6      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRP3      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_ACTPJ      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_ACTP7      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_ACTP2      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_STRP1      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTRAIKTTNLALE
GPMA_STRSV      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRZJ      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRR6      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRPN      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRPI      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRP7      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRP4      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRP2      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_STRTD      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKRAIKTTNLALE
GPMA_STRT2      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKRAIKTTNLALE
GPMA_STRT1      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKRAIKTTNLALE
GPMA_STRZT      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKRAIKTTNLALE
GPMA_STRZP      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKRAIKTTNLALE
GPMA_STRPS      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKRAIKTTNLALE
GPMA_STRPJ      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKRAIKTTNLALE
GPMA_STRGC      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKTTNLALE
GPMA_ACTSZ      --QLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRAIKTCNLVLE
GPMA_MANSM      --ELVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAAGFEFDIAFTSVLTRAIKTCNLVLE
GPMA_HAEIN      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKTAGKKLLDKGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_STRS7      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKRAIKTTNLALE
GPMA_STREM      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKRAIKTTNLALE
GPMA_STRE4      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIAFDLAFTSVLKRAIKTTNLALE
GPMA_LISIN      --KLVLIRHGQSEWNKLNLFTGWHDVDLSEEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_LISW6      --KLVLIRHGQSEWNKLNLFTGWHDVDLSEEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_STRU0      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKRAIKTTNLALE
GPMA_LISMH      --KLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_STRA5      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKRAIKTTNLALE
GPMA_STRA3      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKRAIKTTNLALE
GPMA_STRA1      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKRAIKTTNLALE
GPMA_LACLA      MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKRAIKTTNLALE
GPMA_LACLS      MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKRAIKTTNLALE
GPMA_LACLM      MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKRAIKTTNLALE
GPMA_LISMF      --KLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_LISMC      --KLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_STRMU      MVKLVFARHGESEWNKANLFTGWADVDLSEEGTQQAIDAGKLIKEADIKFDLAFTSVLTRAIKTTNLALE
GPMA_LISMO      --KLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLE
GPMA_STRS2      MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKRAIKTTNLALE
GPMA_HAEPS      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIM0      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIMB      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIG2      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIG1      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAEDU      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGVXXXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIMA      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_NEIMF      --ELVFIRHGQSEWNAKNLFTGWRDVKLSEQXXXXXXXXXXXXXXNGYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAEIE      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAEI8      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAEIG      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAES2      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIXXXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_HAES1      --ELVFIRHGFSEWNAKNLFTGWRDVNLTERGIXXXXXXXXXXXXXXYEFDIAFTSVLTRAIKTCNIVLE
GPMA_STACT      MPTLILCRHGQSVWNAENLFTGWTDVDLSDQGVEEATTSGDRLKQEGIEIDVAFTSVLQRAIKTTYHLLE
GPMA_STAAR      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIDIDVAFTSLLTRALDTTHYILT
GPMA_STAAW      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAT      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAS      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAN      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAM      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAE      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAC      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAAB      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAA9      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAA8      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAA3      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAA2      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAA1      MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYILT
GPMA_STAHJ      MPKLILCRHGQSEWNAKNLFTGWEDVQLSEQGRNEAITSGRKLKENGIEIDVAFTSLLTRALETTQFLLA
GPMA_HALHL      MPKLVLLRHGQSIWNLENRFTGWYDVDLSDQGINEAREAGVALREAGIAPQVAYTSVLKRAIRTLWLSLA
GPMA_ALTMD      MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGVAQAKTAGQLLKDAGFTFDQAYTSVLLRAIKTLNIALE
GPMA_FUSNN      --KLVLIRHGESAWNLENRFTGWKDVDLSPKGMEEAKSAGKILKEMNLVFDVAYTSYLKRAIKTLNIVLE
GPMA_TERTT      MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGREQARNGGRMLKEAGFEFDLAYSSVLTRAIRTLNLVLE
PMGY_CANAL      MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGINVDVLHTSKLSRAIQTANIALD
GPMA_STAS1      MPKLILCRHGQSVWNAENLFTGWADVDLSEQGENEAITSGKKLKAQGIEIDIVYTSLLERAIKTTYHLLN
GPMA_CHLP8      MKKLVLLRHGESQWNRENRFTGWVDIDLSEKGREEAKAAGQLLKDEGFVFDMAYASVLKRAIRTLWTVLD
GPMA_POLNS      MKQLVLIRHGESAWNLENRFTGWADVDLTPKGAEQALAAGENLKKAGYEFDVAYTSVLRRAIRTLWNVQD
GPMA_CHLT3      MIKLVLLRHGESVWNKENRFTGWKDVDLTEKGVQEAKRAGEFMKKEGLDFDIAYTSVLKRAIRTLNLALN
GPMA_THETN      MYKVVLLRHGESIWNMENRFTGWTDVDLSPKGIEEAKQAGKILKEKGFTFDAAFTSVLKRAIRTLWIVLD
GPMA_ALHEH      MKKLVLLRHGQSIWNQENRFTGWHDVDLTEKGREEAQAAGQLMKRHGLRFDYAYTSVLKRAIRTLWIGLD
GPMA_POLSQ      MKQLVLIRHGESAWNLENRFTGWADVDLTPKGAEQALAAGEHLRKAGYEFDVAYTSVLRRAIRTLWHVQD
GPMA_GEOSL      MRTLVLIRHGESVWNRENRFTGWTDVGLTDKGAAEALRAGRTLKNEGFAFDEAFTSVLKRAIKTLWIVLE
GPMA_STAES      MPKLILCRHGQSEWNAKNLFTGWADVKLSKQGIEEAQSAGKKIYDNQIEIDIAFTSLLTRALETTQYILA
GPMA_CHLTE      MKKLVLLRHGESQWNRENRFTGWVDVDLSEKGREEARTAGQLLKDEGFVFDLAYTSVLKRAIRTLWTVLD
GPMA_STAEQ      MPKLILCRHGQSEWNAKNLFTGWADVKLSKQGIEEAQSAGKKIYGNQIEIDIAFTSLLTRALETTQYILA
GPMA_ZYMMO      MPTLVLSRHGQSEWNLENRFTGWWDVNLTEQGVQEATAGGKALAEKGFEFDIAFTSVLTRAIKTTNLILE
GPMA_PROVI      MIKLVLLRHGESQWNLDNRFTGWHDIDLTDKGRREASNAGKLLCEAGFEFDVAYVSVLKRAIRTLWNVLD
GPMA_XANOP      --KLVLLRHGQSQWNLDNRFTGWVDVELTDQGCQEAVAAGKLMKDEGLQFDVAHTSVLKRAIHTLQGALK
GPMA_ERYLH      MPTLILVRHGQSQWNLENRFTGWWDVDLTEKGVEEAKAAGTLLKEKGVLPTVAFTSFQTRAIKTLHLALE
GPMA_XANOR      --KLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLKRAIHTLQGALK
GPMA_XANOM      --KLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLKRAIHTLQGALK
GPMA_CLOPH      --KLVLLRHGESEWNKENLFTGWMDVDLSETGKAEAASAGITLKQKGYDFDVCYTSYLKRAIHTLNLALD
GPMA_CHLL2      MIKLVLLRHGESQWNLENRFTGWHDIDLTDNGRIEASNAGRAIKEAGLTFDIAYTSVLKRAIRTLWNALD
GPMA_XANAC      --KLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGRLMKDEGLQFDVAHTSVLKRAIHTLQGALK
GPMA_XANCP      --KLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLKRAIHTLQGALK
GPMA_XANCB      --KLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLKRAIHTLQGALK
GPMA_XANC8      --KLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLKRAIHTLQGALK
GPMA2_BACC1     MVKLVLIRHGQSEWNVENRFTGWTDVDLSSKGLEEAREAGVMLKASGFSFDIAYTSVLRRAMRTLWITLE
GPMA_THEP3      MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKRAIRTLWIVLD
GPMA_XANC5      --KLVLLRHGQSQWNLDNRFTGWVDVELTDQGRQEAVAAGKLMKDEGLQFDVAHTSVLKRAIHTLQGALK
GPMA_THEPX      MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKRAIRTLWIVLD
GPMA_VARPS      MHKLVLIRHGESTWNLENRFTGWTDVDLTETGIEQAKQAGRLLKAEGYDFDVAYTSVLKRATRTLWHTLD
GPMA_POLNA      MYKLVLIRHGESTWNLDNRFTGWTDVDLTETGIAQAKNSGQLLKAEGYDFDLAYTSVLKRATRTLWHVLD
GPMA_LEPCP      MYKLVLIRHGESTWNLENRFTGWTDVELTPTGVSQAQQAGRLLKEGGYEFDIAYTSVLKRAIWTLWHALD
GPMA_BDEBA      MYKLVLIRHGESVWNQENRFTGWQDVDLSEKGRAEALKGGKALREKGFSFDVAYTSVLKRAIKTLNFVLD
GPMA_GEOSM      MHQLVLLRHGESVWNKENLFTGWTDVELSPSGEEESRKAGLLLKEHGFVFDMAFTSLLKRAIKTLWIVLE
GPMA_ACIAC      MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKTAGRLLKAEGYEFDLAFTSVLKRATRTLWHVLD
GPMA2_NITEU     MKKLVLLRHGESIWNQENRFTGWTDVDLTPKGLKEAEEAGRLLRENGFSFDIAYTSLLKRAIRTLWIALD
GPMA_SALTY      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALTI      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALSV      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALPC      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALPB      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALNS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALHS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALG2      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALEP      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALCH      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALA4      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_PELPB      MIKLVLLRHGESQWNRENRFTGWYDIDLTDQGREEAANAGKLLREGGFVFDVAYTSVLKRAIRTLWSVLD
GPMA_SALPK      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALPA      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SALDC      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGISEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_SHISS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_SHIFL      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_SHIF8      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_SHIBS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_SHIB3      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ESCF3      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOSM      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOSE      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOLU      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOLI      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOLC      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOL6      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOL5      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOK1      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOHS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECODH      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECOBW      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO8A      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO81      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO7I      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO5E      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO57      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO55      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO45      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO27      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
PGAM_DICDI      --KLVLIRHGESTWNKENKFTGWTDVDLSEKGVQEAHEAGKRLLKAGFTFDIAYTSVLKRAIRTLWILLE
GPMA_METI4      --KVVFLRHGESIWNRENRFTGWTDVDLSSRGIEEAENAARLLKEEGFEFDVAFCSVLKRAIRTLWIVLD
GPMA_PROA2      MIKLVLLRHGESQWNRENRFTGWRDIDLSEKGLAEAANAGVLMKEEGLTFDIAYTSVLKRAIRTLWNALD
GPMA_SHIDS      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_ECO24      --KLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_DELAS      MYKLVLIRHGESTWNLENRFTGWTDVDLTATGVEQAKNAGRLLKAEGYDFDLAYTSVLKRATRTLWHTLD
GPMA_CHLPD      MIKLVLLRHGESQWNRENRFTGWHDIDLTENGRNEAFQAGRLMKEAGLVFDMAYTSVLKRAIRTLWNAMD
GPMA_CITK8      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
GPMA_CHLPB      MIKLVLLRHGESQWNRENRFTGWYDIGLSEKGETESRAAGELLKKEGFTFDVAFTSVLKRAIGTLWNVLE
GPMA_GEOBB      MHQLVLLRHGESVWNKENLFTGWTDVELSPRGEEESRNAGLLLKEHGFVFDLAFTSLLKRAIKTLWIVLE
GPMA_TREDE      --RLVLVRHGESEWNKLNLFTGWTDVDLSEKGVEEAKEGGTYLKKEGFDFDICYTSYLKRAIHTLNYILS
GPMA_RALEH      MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLKDAGLGFDVAYTSVLKRAIRTLWHVQD
GPMA_ENTS8      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGYSFDFAYTSVLKRAIHTLWNILD
GPMA_RHOFD      MYKLVLIRHGESTWNLDNRFTGWTDVDLTPLGIEQAKNAGRLLKAEGYEFDVAYTSVLKRATRTLWHVLD
GPMA_RALEJ      MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGAAQARLAGKLLKEAGFAFDVAYTSVLKRAIRTLWHVQD
GPMA_ERWCT      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGQLLKDEGFAFDFAYTSVLKRAIHTLWSVLD
GPMA_RALSO      MHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGRLLREAGFTFDLAYTSVLKRAIRTLWHVQD
GPMA_CUPTR      MYKLVLIRHGESTWNLENRFTGWVDVDLTETGAAQARQAGKLLKEAGMGFDVAYTSVLKRAIRTLWHVQD
GPMA_GEOMG      MKKLVLLRHGESVWNRENRFTGWTDVGLSEKGIEEAISAGRTLKEEGFVFDVAYTSVLKRAIKTLWLVLE
GPMA_METHJ      MYTLVLIRHGESLWNRENRFTGWRDIDLSPQGIDEARAAGKALREQGFEFDLAYTSVLKRAIRTLWLIQE
GPMA_BORBZ      MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILR
GPMA_BORBU      MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILR
GPMA_SERP5      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGELLKNEGFAFDFAYTSVLKRAIHTLWNILD
GPMA_PELLD      MIKLVLLRHGESQWNLENRFTGWHDIDLTERGRKEAANAGKLIRAEGIVFDVAYTSVLKRAIRTLWSVLD
GPMA_BORAP      MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGVDEAIEAGLLLKQEGYFFDIAFSSLLSRANDTLNIILK
GPMA_PECCP      --KLVLVRHGESQWNNENRFTGWYDVDLSDKGRSEAKAAGQLLKDEGFAFDFAYTSVLKRAIHTLWNVLD
GPMA_DIAST      MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKNAGRLLKAEGYEFDLAYTSVLKRATRTLWHCLD
GPMA_THEFY      MSTLVLLRHGESVWNAEGLFTGWVDVDLSPKGEEEARRGGRLLAEAGIRPDVVHTSLLKRAIRTANIALE
GPMA_MARMM      MPQLALIRHGQSEWNLQNRFTGWVDVDLTDEGVAQARQSGELLAKAGFEPTHAFVSVLKRAIKTLNFTLE
GPMA_ACISJ      MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKNAGRLLKAEGYDFDLAYTSVLKRATRTLWHCLD
GPMA_PHOLL      --KLVLVRHGESEWNRENRFTGWTDVALSEKGRAEAQQAGQLLKEEGFVFDFAYTSVLKRAIHTLWNILD
GPMA_AZOSE      MYKIVLLRHGESTWNKDNRFTGWTDVDLTEKGVEEARGAGHLLKREGYTFDLAYTSVLKRANKTLNIVLE
GPMA_SOLUE      MKKLVLIRHGESTWNKENRFTGWTDVDLSDEGRQQATEAAEVLKREGYVFDVAYTSVLKRAIRTLWTVLD
PMG1_YEAST      MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
GPMA_STRGG      --KLILLRHGESEWNAKNLFTGWVDVNLTEKGEKEAVRGGELLKDAGLLPDVLHTSLQRRAIRTAQLALE
GPMA_BORGA      MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGINEALEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILR
GPMA_SPHWW      MPTLVLIRHGQSAWNLENRFTGWWDVNLTDQGIXXXXXXXXXXXXXXXDFDQCYTSFQTRAIKTLNIALE
GPMA_COPPD      MYKVVMIRHGESEWNKLNLFTGWTDVDLSDRGVEEAIWAGKKLKEEGYTFDVAFTSVLKRAIKTLNLVLE
GPMA_CHLCH      MIKLVLLRHGESQWNRENRFTGWHDIDLTDQGRIEASNAGKLLRAEGFTFDIAYTSVLKRAIRTLWHVLD
GPMA_BORHD      MYKLVLVRHGESEWNRENLFTGWTDVKLSEKGISEALEGGRVLKQNGYSFDIAFSSMLVRANDTLNIILR
GPMA_BORDL      MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGVSEACEGGRILKEEGYSFDIAFSSMLVRANDTLNIILC
GPMA_LEIXX      ---LILLRHGNSEWNRQNLFTGWVDVRLSEQGVAEAKRAGELLAESGLVPDILYTSLLTRAIQTANHALD
GPMA_CLOAB      MRKLVLLRHGQSEWNKENRFTGWTDVDLSVDGVSEAAQAGRILKKNNYTFDAAYTSVLKRAIRTLQIVLY
GPMA_BORT9      MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGISEALEGGRVLKQEGYSFDIAFSSVLVRANDTLNIILR
GPMA_EDWI9      --KLVLLRHGESEWNRENRFTGWTDVELSEKGRQEALAAGRLLKAQGFSFDIAYTSVLKRAIHTLWHVLD
GPMA_BORRA      MYKLVLVRHGESKWNKENLFTGWTDVKLSEKGVSEACEGGRILKEEGYSFDIAFSSMLVRANDTLNIILC
GPMA_PROMH      --KLVLVRHGESVWNKENRFTGWTDVELSDKGRNEAQEAGKLLKAEGFTFDYAYTSVLKRAIHTLWNILD
GPMA_PARD8      MKSIVLLRHGESIWNKENRFTGWTDVDLTEKGVAEAYRAGNLLKEKGYVFNKAYTSYLKRAVKTLNCVLD
GPMA_BORPD      MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKKEGYQFDLAYTSVLKRAIRTLWIALD
GPMA2_NITMU     MKKLVLLRHGESTWNKENRFTGWTDVDLTPKGAEEAHNSGRLLREAGFTFDIAYTSVLKRAIRTLWIVLD
GPMA_ERWT9      --KLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_CAUSK      MPVLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIKAAGINLDEAFTSVQTRAIRTGNLALD
GPMA_BURS3      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURPS      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURP6      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURP1      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURP0      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURMS      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURMA      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURM9      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURM7      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_NITOC      ---MILLRHGESVWNLENRFTGWTDVDLSANGVEEARLAGKILKNEGYQFDKAYTSVLKRAIRTLWIVEE
GPMA_FRAAA      MTTLVLLRHGESNWNRENLFTGWVDVDLSEKGLKEATRGGELLAEAGVLPDVVHTSLLTRAIRTAWLALD
GPMA_CLOB8      MIKLVLVRHGESLWNLENRFTGWTDVDLSENGLKEARRAGKILKKNGFVFDVAYTSVLKRAIRTLWIILY
GPMA_AZOSB      MYKIVLLRHGESTWNKENRFTGWTDVDLTELGVGEARAAGQLLKREGYSFDLAFTSVLKRANKTLNIVLE
GPMA_STRAW      --KLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDAGLLPDVVHTSLQKRAIRTAQLALE
GPMA_BURCJ      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURCC      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BORPA      MYKLVLIRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKRAIRTLWIALD
GPMA_METPP      MTQLVLIRHGESTWNLENRFTGWTDVELTPTGVAQAQQAGRLLKQAGIDFDTVYTSVLKRAIWTAWHCLD
GPMA_RHOSR      ---LVLLRHGESEWNALNLFTGWVDVHLTDKGIAEGKRAGELLLEHNLLPDVLYTSLLRRAISTANIALD
GPMA_RHOOB      ---LVLLRHGESEWNALNLFTGWVDVHLTDKGIAEGKRAGELLLEHNLLPDVLYTSLLRRAISTANIALD
GPMA_BORPE      MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKRAIRTLWIALD
GPMA_BORBR      MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKRAIRTLWIALD
GPMA_XYLFM      --KLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKEEGLEFDVAHTSLLKRAIHTLQDALK
GPMA_XYLFA      --KLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKEEGLEFDVAHTSLLKRAIHTLQDALK
GPMA_BURTA      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNSEARQAGLLLKEAGYTFDIAYTSVLKRAIRTLWHVQD
PGAM2_RAT       --RLVMVRHGESSWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVLKRAIRTLWTILD
GPMA_ENT38      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKDEGFSFDFAYTSVLKRAIHTLWNVLD
GPMA_BACC3      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACAH      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_NOCFA      ---LVLLRHGESEWNALNLFTGWVDVHLTDKGVAEGKRAGELLAEHGILPDIVYTSLLRRAISTANIALD
GPMA1_BACC1     MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_CLAMS      ---LVLLRHGNSDWNQKNLFTGWVDVELSEQGVAEGQRAGELLAESGILPDVLHTSVLIRAIDTANIALK
GPMA_BURPP      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNNEAQQAGVLLKESGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BURCM      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BACC4      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDMAYTSVLKRAIRTLWIVLH
GPMA_NOVAD      MPRLILIRHGQSQWNLENRFTGWWDVDVTXXXXXXXXXXXXXXKDKGVLPTLAFTSLQTRAIKTLHLALE
GPMA_BURVG      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGALLKEAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA2_BACTN     MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGVAEAEKAGVTLREYGFNFDKAYTSYLKRAVKTLNCVLD
PGAM2_MOUSE     --RLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVLKRAIRTLWTILD
GPMA_BACCR      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_YERPY      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPS      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPP      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPN      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPG      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPE      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPB      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERPA      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_YERP3      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILD
GPMA_BURA4      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLREAGYTFDIAYTSVLKRAIRTLWHVQD
GPMA_BACWK      MIKLVLIRHGQSLWNLENRFTGWTDVDLSKNGLSEAREAGTILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_XYLFT      --KLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKKEGLEFDVAHTSLLKRAIHTLQDALK
GPMA_XYLF2      --KLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKKEGLEFDVAHTSLLKRAIHTLQDALK
GPMA_BACFR      MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGIAEACKAGELLKENGFNFDKAYTSYLKRAVKTLNCVLD
GPMA_BACFN      MKKIVLLRHGESAWNKENRFTGWTDVDLTEKGIAEACKAGELLKENGFNFDKAYTSYLKRAVKTLNCVLD
GPMA_BACCQ      MIKLVLIRHGQSLWNLENRFTGWTDVDLSEKGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACC7      MIKLVLIRHGQSLWNLENRFTGWTDVDLSEKGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BORA1      MYKLVLMRHGESQWNLENRFTGWTDVDLTEVGREQARRAGELLKREGYTFDLAYASVLKRAIRTLWIALD
GPMA_BACHK      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACCZ      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
PGAM2_HUMAN     --RLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILD
GPMA_SPHAL      MPQLILIRHGQSQWNLENRFTGWWDVDVTEKXXXXXXXXXXLMKAKGVAPDTCFTSVQTRAIKTLNLALE
GPMA_YERE8      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWSILD
GPMA_BRAHW      MTKVVLIRHGESVWNKENLFTGWADVTLSXXXXXXXXXXXXXXXXXXFTFDKAYTSTLTRAIKTLNLVLE
GPMA_STRCO      --KLILLRHGESEWNEKNLFTGWVDVNLTPKGEKEATRGGELLKDAGLLPDVVHTSVQKRAIRTAQLALE
GPMA_HAMD5      --KLILVRHGESEWNKENRFTGWADVDLSEKGRVEAQQAGNLLKKKGFSFDFAYTSVLRRATNTLSLILD
GPMA_BACC0      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACAN      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACAC      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_BACAA      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKRAIRTLWIVLH
GPMA_CORGL      --KLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGELLVEAGVLPGVVYTSLLRRAIRTANIALN
GPMA_CORGB      --KLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGELLVEAGVLPGVVYTSLLRRAIRTANIALN
GPMA1_BACTN     MKRIVLLRHGESLWNKENRFTGWTDVDLSEKGVEEACKAGDALREAGFSFEAAYTSYLKRAVKTLNCVLD
GPMA_UNCTG      MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQLKKDGFTFDLAYTSVLKRAIKTLWNVLN
GPMA_SODGM      --KLVLIRHGESQWNNENRFTGWTDVDLSDKGLTEAKQAGQVLKADGYVFDFAYTSVLKRAIHTLWGVLD
GPMA_DESMR      MHTLVLVRHGQSVWNLENRFTGWTDVGLTPQGREEAAQAANLLRDGGYDFDACLTSVLSRAVMTLDILLT
GPMA_BACCN      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLHEARTAGAILKKNGYTFDVAYTSVLKRAIRTLWIILH
GPMA_STRMK      --KLVLLRHGQSQWNLDNRFTGWVDVDLTXXXXXXXXXXXXXXXXXXLQFDVAHTSVLKRAIHTLQGALA
GPMA_STRM5      --KLVLLRHGQSQWNLDNRFTGWVDVDLTXXXXXXXXXXXXXXXXXXLQFDVAHTSVLKRAIHTLQGALA
GPMA_BACC2      MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNRYTFDVAYTSVLKRAIRTLWIVLH
GPMA_PROAC      --KLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLRRAIHTAYLALD
GPMA_CORJK      ---LILLRHGQSEWNASNQFTGWVDVRLTEKGRAEAVRGGEMIKEAGLEPTILYTSLLRRAITTANIALD
GPMA_BURP8      MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGTLLKDSGYMFDIAYTSVLKRAIRTLWHVQD
PGAM1_CHICK     --RLVLVRHGESAWNLENRFCGWYDADLSPAGQQEARRGGEALRDAGYEFDICFTSVQKRAIRTLWNVLD
GPMA_RHOCS      MTKLVLIRHGQSVWNQQDLFTGWTDVELTEQGVXXXXXXXXXXXXXXYDFDACHTSVLKRAIKTLNLVLE
GPMA_KLEP7      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGVSXXXXXXXXXXXXXFSFDFAYTSVLKRAIHTLWNVLD
GPMA_KLEP3      --KLVLVRHGESQWNNENRFTGWYDVDLSEKGVSXXXXXXXXXXXXXFSFDFAYTSVLKRAIHTLWNVLD
GPMA_CAUCR      MPTLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIAAAGIEIDRLFTSVQTRAIRTGNLALD
GPMA_CAUCN      MPTLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIAAAGIEIDRLFTSVQTRAIRTGNLALD
GPMA_METB6      MYTLVLLRHGESTWNKENRFTGWTDVDLSKDGIVEAGRSGRLLNEAGFTFDLCHTSVLRRAIRTLWIVLD
GPMA_ARTS2      --KLILLRHGHSEWNAKNLFTGWVDVDLNDQGREEAARGGELLVENNVLPDVLYTSLLKRAINTANIALD
GPMA_NOCSJ      ---LILLRHGESEWNAKNLFTGWVDVNLTEKGRAEAVRGGELMREAGVLPDVVHTSVQRRAINTACLALD
PGAM1_RAT       --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
PGAM1_MOUSE     --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
PGAM1_HUMAN     --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
GPMA_ARTCA      --KLILLRHGHSEWNAKNLFTGWVDVDLNDQGRAEAARGGELLVENNILPDVLYTSLLKRAINTANIALD
PGAM1_BOVIN     --KLVLIRHGESTWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
GPMA_BAUCH      --KLVLIRHGESKWNNENRFTGWTDIDLSDQGRIEAKNAGQLLKQAGFIFDFAYTSVLKRAIHTLWYILD
PGAM1_PONAB     --KLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLD
GPMA_TREPS      --KLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRAIRTLNFVLQ
GPMA_TREPA      --KLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRAIRTLNFVLQ
GPMA_HYPNA      MTKLALIRHGQSAWNLENRFTGWWDADLTAQGEAEARHSGKLLAEVDADFRAGFTSVQTRAIRTMWLALT
GPMA_DESVM      MHTLVLLRHGQSAWNLENRFTGWTDVDLSPEGEQEARDAARLLTDEGLTFDVCHTSVLTRAIRTLYIVQH
GPMA1_LACPL     MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRATGLQFGAVHTSVLKRAIVTANIMLS
GPMA_DESDG      MYKLVLVRHGQSTWNLENRFTGWTDVDLTPLGETEAREGARLIAAAGLTFDECHTSVLKRAIRTLNIIQE
GPMA_VEREI      MHQLVLIRHGESTWNLENRFTGWTDVPLTPTGVSQALSAGRLLKAEGYMFDLACTSVLQRAIHTLWHVLD
GPMA_DICNV      MKKLVLVRHGQSQWNLENLFTGWTDVDLTEQGQKEAATAAQLLQKEGIFFQTAFTSYLKRAIKTLNIILD
GPMA_CLAM3      ---LVLLRHGNSDWNQKNLFTGWVDVELSEQGVAEGQRAGELLAESGILPDVLHTSVLIRAIDTANIALK
GPMA_COREF      --KLILLRHGQSAWNASNQFTGWVDVDLTTIGEAEAKRGGELLVENNVLPDVVYTSLLRRAIRTANLALD
GPMA_METPE      MYTLVLLRHGESAWNKENRFTGWTDVDLSPQGIEEAHRAATLLHDGGYSFDLAYTSVLKRAIRTLWIVLD
GPMA_BUCAP      --KLVLIRHGQSKWNKLNKFTGWHDIELSDNGINEALKAGSLLKKEKFFFDYAHTSMLKRAIHTLRYILD
GPMA_DESVH      MARLILLRHGQSAWNLENRFTGWTDVDLSPXXXXXXXXXXRLIRDEGLDFSVCHTSMLTRAIRTLHLVQQ
GPMA_MYCUA      ---LVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSLLRRAITTAHLALD
PMGE_MOUSE      --KLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILE
PMGE_MACFA      --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
PMGE_HUMAN      --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
GPMA_MYCMM      ---LVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSLLRRAITTAHLALD
PMGE_RABIT      --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
PGAM4_HUMAN     --KLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTVLD
GPMA_HYDS0      MYTLVLLRHGQSLWNLENKFTGWIDVDLSDQGKEEAKNAGKAMLEAGITPKAAFTSYLRRAINTLNIALD
GPMA_DESVV      MARLILLRHGQSAWNLENRFTGWTDVDLSPXXXXXXXXXXRLIRDEGLDFSVCHTSMLTRAIRTLHLVQH
GPMA_BUCAT      --QVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLLKRAIHTLQYILD
GPMA_BUCA5      --QVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLLKRAIHTLQYILD
GPMA_BUCAI      --QVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLLKRAIHTLQYILD
GPMA_BIFLO      --KLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLRRAINTANIALD
GPMA_BIFLI      --KLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLRRAINTANIALD
GPMA_BIFLD      --KLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLRRAINTANIALD
GPMA_CORDI      --KLILLRHGQSEWNASNQFTGWVDVNLTXXXXXXXXXXXXLLKAQGVLPSVVYTSLLRRAIRTANIALN
GPMA_BLOFL      --KTVLIRHGESQWNKDNRFTGWIDVDLSNQGYSEAKRAGQLLKKYKFIFDYGYTSVLKRTIHTLWVILD
GPMA_PARL1      ---LVLVRHGQSEWNKKNLFTGWRDPGLTEQGMEEAREAGQAIKAKGLVFDVAYTSALSRAQETNRIVLE
GPMA_BLOPB      --KLVLIRHGESQWNKENRFTGWVDVDLSEKGRSEAQCAGRILKKNGFFFNYGYTSVLKRAIHTLWIILD
GPMA_TROWT      MDNLVLLRHGNSLWNQENLFTGWVDVRLSELGEKEAKTAGQLLREANRYPDVLFTSLLTRSIQTAHIALM
GPMA_TROW8      MDNLVLLRHGNSLWNQENLFTGWVDVRLSELGEKEAKTAGQLLREANRYPDVLFTSLLTRSIQTAHIALM
PGAM4_PANTR     --KLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTVLD
GPMA_MYCPA      ---LVLLRHGESEWNSLNLFTGWVDVGLTDKGRAEAVRSGELLAEQGLLPDALYTSLLRRAITTAHLALD
GPMA_MYCA1      ---LVLLRHGESEWNSLNLFTGWVDVGLTDKGRAEAVRSGELLAEQGLLPDVLYTSLLRRAITTAHLALD
PMGE_BOVIN      --KLIMLRHGEGAWNKENRFCSWVDQKLNSDGLQEARNCGKQLKALNFEFDLVFTSILNRSIHTAWLILE
GPMA_PORGI      MKRIVLIRHGESLWNKENRFTGWTDVDLSXXXXXXXXXXXXLMKKEGFQFTKAYTSYLKRAVKTLNGVLD
GPMA_PORG3      MKRIVLIRHGESLWNKENRFTGWTDVDLSXXXXXXXXXXXXLMKKEGFQFTKAYTSYLKRAVKTLNGVLD
GPMA2_LACJO     LAKLVLVRHGESVANRDNVYTGWNDVPLSKKGIAQAKNAGLKVEKIA-EFTHIHTSVLSRAIMTANIIAD
GPMA_BRAJA      ---LVLVRHGQSEWNLKNLFTGWKDPDLTEQGVAEAREAGRKLKAQGLVFDVAYTSVLTRAQHTLDLILG
GPMA_NITHX      ---LVLVRHGQSEWNLKNLFTGWKDPDLTELGVTEAKDAGRKLKEQGFAFDIAFTSVLIRAEHTLDLVLE
GPMA_RHOPB      ---LVLVRHGQSEWNLKNLFTGWKDPGLTEKGVAEAIEAGKKLKAQGLVFDVAFTSVLTRAQTTLDLMLN
GPMA_CORK4      --KLILLRHGQSQWNSTNQFTGWVDVDLTXXXXXXXXXXXXLIKEKGLHPEVLYTSLLRRAIRTADIALN
GPMA_BRASB      ---LVLVRHGQSEWNLKNLFTGWKDPDLTEQGVSEAKEAGRKLKAHGLTFDVAFTSELTRAQHTLKLILD
PGAM2_BOVIN     --RLVMVRHGESTWNQENRFCGWFDXXXXXXXXXXXXXXXXXXXXXXMEFDICYTSVLKRAIRTLWTILD
GPMA_MYCTU      ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCTA      ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCLE      ---LILLRHGESDWNARNLFTGWVDVGLTDKGRAEAVRSGELLAEHNLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCLB      ---LILLRHGESDWNARNLFTGWVDVGLTDKGRAEAVRSGELLAEHNLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCBT      ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCBP      ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
GPMA_MYCBO      ---LVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALD
GPMA_BRASO      ---LVLVRHGQSEWNLKNLFTGWKDPDLTAQGVSEAKDAGRKLKAHGLSFDVAFTSELTRAQHTLKLILD
GPMA_NAUPA      MAKLVLVRHGKSEWNKQNRFTGWVDVDLAPEGIEEAKKAGQKLKEAGFCFDICFSSYLKRAIKTGXXXXX
GPMA_XANP2      ---LVLVRHGQSEWNLKNLFTGWRDPDLTEQGVSEAKRAGALLKAEGLKFDVAFTSDLTRAQKTLGLILG
GPMA_NITWN      ---LVLVRHGQSEWNLKNLFTGWKDPDLTELGAAEAKDAGRKLKAQGFVFDIAFTSTLIRAQHTLDLVLK
GPMA_BUCBP      --KLVLMRHGESIWNELNKFTGWHDVDLSNRGVQESLKAAKLLKKHGFYFDYAYSSVLKRSIHTLWNIIK
GPMA_OLICO      ---LVLVRHGQSEWNLKNLFTGWKDPDITAQGVDEAKRAGKLLKAEGFVFDAAFVSELTRAKHTLSLILE
GPMA1_LACSS     MANLVIVRHGESVANQLKTYTGWSDVALTAKGRQQAHQVGRQIKDAGFQFSHVHTSLLKRAILTSYIVLE
GPMA_ELUMP      MKKIVLLRHGESTWNKENRFTGWTDVDLTXXXXXXXXXXXXILKKEGFIFDKAYTSYLKRAVKTLNCVLD
GPMA_WIGBR      --KLVLMRHGSSIWNDQDRFTGWTDIDLSEKGKNEVKYAGKMLKSFGYSFNFAYTSLLKRAIHSLWVILK
GPMA_RHOP5      ---LVLVRHGQSDWNLKNLFTGWKDPDLTEQGVAEAKAAGQKLKTQGFVFDVAFTSALTRAQHTLDLMLT
GPMA_AGRRK      ---LVLVRHGQSDWNLKNLFTGWKDPDLTALGVEEAKTGGKALADYGIKYDIAFTSVLTRAQHTLKIILD
GPMA_RHILO      ---LVLVRHGQSEWNLKNLFTGWRDVDLTEQGHAEAKAAGQKLKARGLKFDIAFTSALSRAQKTCQHILD
GPMA_METSB      ---LVLVRHGQSEWNLQNLFTGWKDPDLTDLGVSEAKAAGRALKTAGVGFDIGFTSDLLRAQRTMKLLLA
PMGY_SCHPO      ---LVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILE
GPMA_RHIME      ---LVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAKAGGKALADYGIKFDIAFTSVLIRAQRTCQLVLD
GPMA_RHILW      ---LVLVRHGQSDWNLKNLFTGWKDPDLTALGIEEANAGGKALAEYGIKFDIAYTSVLVRAQHTLKLILD
GPMA_OCHA4      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_CYTH3      MPILVIVRHGQSEWNLKNLFTGWSDVELTPTGEHEAEYAGIVLRP--YHFDIAFTSVLKRAIHTLSIILN
GPMA_BRUME      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUMB      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BUCCC      --KIILMRHGESKWNKLNKFTGWQDIGLTXXXXXXXXXXXXXXXXXXFIFDIAYTSILKRAIYTLWIILK
GPMA_BRUSU      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUSI      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUC2      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUAB      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUA2      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BRUA1      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_AGRVS      ---LVLVRHGQSDWNLKNLFTGWRDPDLTDLGVQEANAGGKALKDYGIQFDIAFTSDLSRAQKTCGIILD
GPMA_RHIL3      ---LVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANTGGAALAEYGIKFDVAYTSVLVRAQHTLKLILD
GPMA_MESSB      ---LILVRHGQSEWNLKNLFTGWRDPGLSELGHEEATSAGRKIKDRGLRPDIAFTSVLSRAKVTNTHILE
GPMA_BRUO2      ---LVLVRHGQSEWNLKNLFTGWRDPGLTEQGHAEAKAAGQRLKAAGLKFDIAYTSALSRAQVTCQHILD
GPMA_BARBK      ---LVLVRHGQSEWNIKNLFTGWKDPDLTEKGRTEAITAGKNLKKAGLKFDIAYTSALQRAQKTAQHILE
GPMA_BART1      ---LVLIRHGQSEWNLKNLFTGWKDPDLTEKGHAEAIAAGKKLKETGVKFDIAYTSALQRAQKTAQHILE
GPMA_RHIE6      ---LVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANAGGAALAEYGIKFDVAYTSALVRAQHTLKLILD
GPMA_BARHE      ---LVLIRHGQSEWNLKNLFTGWKDPGLTEKGRTEAIAAGKKLKETGLKFDIAYTSALQRAQKTAQNILE
GPMA_METPB      ---LVLARHGQSEWNLKKLFTGWRDPELTELGIDEARRAGRWLKSQGTQFDVAFTSNLRRAQNTCALILE
GPMA_METEP      ---LVLARHGQSEWNLKKLFTGWRDPELTELGIDEARRAGRWLKSQGTQFDVAFTSNLRRAQHTCSLILE
GPMA_METC4      ---LVLARHGQSEWNLKKLFTGWRDPELTELGIDEARRAGRWLKSQGTQFDVAFTSNLRRAQHTCSLILE
GPMA_SINMW      ---LVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAMAGGKALADYGIKFDIAFTSDLIRAQRTCQLVLD
GPMA_BARQU      ---LVLIRHGQSEWNIKNLFTGWKDPGLTEKGHAEAITAGKNLKAAGLKFDIAYTSALQRAQKTAQHILE
GPMA_AZOC5      ---LVLVRHGQSEWNLKNLFTGWRDPNLTDQGVSXXXXXXXXXXXXXXSFDVAYTSALTRAQRTCQLVLE
GPMA_BEII9      ---LVLVRHGQSDWNLKNLFTGWKDPDLTEKGIGEXXXXXXXXXXXXXXFDIAFTSALTRAQHTLKLILG
GPMA_PELUB      MTHLILVRHGQSEWNLEKRFTGWVDVDLTGQGKLEACKAGEYIKETKIDIDYFYSSFQLRAINTLKFIQD
GPMA_METVS      MANLVFLRHGESIWNKMNIFTGWVDVPLSKGGVKEAKIAGKLLKS--YKFDVAYSSELIRALNTLILVMQ
GPMA_PARUW      MVKLILMRHGQSQWNLANLFTGWVDIPLSFKGIEEAIEAGKQIKNYPI--DLIFTSSLIRAQMTAMLAMS
GPMA_CYAP7      MSKLILIRHGQSLWNAANKFTGWVDIPLSRRGRAEAMIAASKLQEQGYRIDVCFTSLLIRAMETAIIALT
GPMA_RHISN      ---LVLVRHGQSEWNLKNLFTGWRDPDLTXXXXXXXXXXXXXXXXXXIKFDIAFTSVLVRAQRTCQMVLD
GPMA_METS4      ---LVLARHGQSEWNLKNLFTGWRDPDLTEVGIAEXXXXXXXXXXXXXXFDICFTSALTRAQRTAALILE
GPMA_METRJ      ---LVLVRHGQSEWNLRNLFTGWRDPDLTXXXXXXXXXXXXXLKRDGYGFDVAFTSALIRAQRTCALVLE
GPMA_PSEA6      MSLLTLIRHGQSIWNQQNRFTGWVDVSLSQSGVKEAQRAAQMLSQQ--RFDLAFTSELLRAQDTLYEILR
GPMA_CHLMU      MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEALTAGEAIKNLPI--DCIFTSTLVRSLMTALLAME
GPMA_CHLTB      MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPI--DCIFTSTLVRSLMTALLAMQ
GPMA_CHLT2      MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPI--DCIFTSTLVRSLMTALLAMQ
GPMA1_GLOVI     MAHLILIRHGQSLWNAANKFTGWVDVPLSERGRAEATIASCKLRDYRVNV--CFTSMLMRAIETAHEADD
GPMA_CHLTR      MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPI--DCIFTSTLVRSLITALLAMQ
GPMA_CHLTA      MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPI--DCIFTSTLVRSLITALLAMQ
GPMA2_GLOVI     MALLVMVRHGQSIWNLENRFTGWTDVPLTEKGRAEARACGELIY--CVPFAVAFTSKLTRAQDTLRLILE
GPMA1_NITMU     MTQLVLLRHGESVSNRDGCFTGWGDAPLTPRGEREAEQAGNLLKKAGHKFDICFTSELSRANDTLRIVLS
GPMA_CHLAB      MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPI--DCIFTSSLVRSLMTALLAMT
GPMA1_NITEU     --RLVLLRHGQSIWNQDRHFTGWGDIVLSPQGEQEALRAGHLLKQAGFTFDACFCSELQRASDTLAIVQS
GPMA_RHIEC      MSTLVIVRHGQSEGNARGEFTGTSDVPLTQEGWSESRRAGSLLANLGISFDIAFSSALLRTVDTCRAILN
GPMA_CHLFF      MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAILAGQVIKDLPI--DCIFTSSLVRSLMTALLAMS
GPMA_CHLCV      MAFLILLRHGKSVWNEKNLFTGWVDIPLSQQGIDEAIHAGQVIKDLPI--DCIFTSSLVRSLMTALLAMS
GPMA_CHLPN      MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQ--NLPIDCIFTSTLVRSLMTALLAME
GPMA_METMA      ---LILVRHGEPGLKPGERLSGWIDIPLSRKGIEEALECAKALE--NIEIDIAFASDLVRTQETLFIILE
GPMA_METAC      MSYLIIVRHGESGWNVDGRFGGWVDVPLTGKGIKEALLCAAELE--GIDLDVTFTSKLIRAQETLFLILE
PMG3_YEAST      --KLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFNISLPQGYTSRLIRTQQTMDVILE
PMG2_YEAST      ---LFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIKANNLRLPQGYTSRLIRTQQTIEFGSD
YO283_YEAST     --RLFIIRHGQTEHNVKKILQGHKDTSINPTGEEQATKLGHYLRSRGIHFDKVVSSDLKRCRQTTALVLK
TIGAR_MOUSE     MPRLTVIRHGETRLNKEKIIQGQGDAPLSETGFRQAAAAGQFL--SNVQFTHAFSSDLTRTKQTIHGILE
PHOE_BACSU      MTAVCLVRHGETDWNLQQKCQGKTDIPLNATGERQARETGEYVKD--FSWDIIVTSPLKRAKRTAEIINE
YFFL_SCHPO      --KVFLIRHGQTDQNKRGILQGSVDTNLNETGXXXXXXXXXXXXXXDI--DQIFCSSMKRCRETIAPYLE
TIGAR_BOVIN     ---LTVVRHGETRLNKEKIIQGQGDEPLSETGFKQAAAAGIFLKD--VKFTHVFSSDLTRTKQTVHGILE
TIGAR_HUMAN     ---LTVVRHGETRFNKEKIIQGQGDEPLSETGFKQAAAAGIFLNN--VKFTHAFSSDLMRTKQTMHGILE
GPMB_ECOUT      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOL6      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOL5      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOK1      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO81      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO7I      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO45      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SHISS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SHIFL      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SHIF8      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SHIDS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTVEIIAQ
GPMB_SHIBS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SHIB3      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOSM      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOSE      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOLU      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOLI      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOLC      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOHS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECODH      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECOBW      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO8A      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO5E      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO57      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO55      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_ECO24      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
COBC_SALTY      --RLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQAKTLHTLLRHA--PFDRVLCSELERARHTARLVLE
TIGRB_DANRE     ---LTIVRHGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
GPMB_ENTS8      MLQVYLVRHGETQWNAERRIQGQSDSPLTEKGERQAMQVAQRAKALGI--THIITSDLGRTQRTAEIIAQ
GPMB_SALTI      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_KLEP3      MLQVYLVRHGETQWNAERRIQGQSDSPLTAHGERQAWQVGERARTLGI--THIITSDLGRTRRTAEIIAE
GPMB_PHOLL      MLQVYLVRHGESEWNAARRIQGQSDSPLTETGEHQARLVAQRVKSESI--THIITSDLGRTRRTAEIIAK
GPMB_KLEP7      MLQVYLVRHGETQWNAERRIQGQSDSPLTAHGERQAWQVGERARTLGI--THIITSDLGRTRRTAEIIAE
COBC_SALTI      --RLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQAKTLHTLLRHA--PFDRVLCSELERARHTARLVLE
GPMB_ESCF3      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGI--THIISSDLGRTRRTAEIIAQ
GPMB_SALTY      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALSV      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALPB      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALPA      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALNS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALHS      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALG2      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALEP      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALDC      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPMB_SALA4      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
GPM_THEAC       ----ILIRHGESDINVKGILSDTIDNNLTEKGMRQAEHAAAELK--GIDIKNFYSSPIKRAFDT------
GPMB_PROMH      MLQVYLVRHGETEWNVARRIQGQSDSPLTAMGVRQAQQVAERVKSAGI--THIISSDLGRTCQTAEIIAQ
GPMB_SALAR      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
F262_BOVIN      -PRTIYLRHGESEFNLLGKIGG--DSGLSVRGKQFAQALRKFLEEQEIADLKVWTSQLKRTIQT----AE
GPMB_SERP5      MLQVYLVRHGETEWNAARRIQGQSDSPLTANGEHQARLVAQRVSKQGI--THVITSDLGRTRRTAQIIAE
GPMB_ERWT9      MLQVYLVRHGETLWNAARRIQGQSDSALTEKGEQQAYQVGQRVRDLGI--THVIASDLGRTRRTAEIIAD
GPMB_ENT38      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQARQVAERARTLGI--THIIASDLGRTQQTARIIAD
GPMB_SALPC      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLG--STHIISSDLGRTKRTAEIIAQ
GPMB_SALCH      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLSI--THIISSDLGRTKRTAEIIAQ
COBC_ECOLI      --RLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLH--GVSFDLVLCSELERAQHTARLVLS
F262_HUMAN      -PRTIYLRHGESEFNLLGKIGG--DSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQT------
PGAM5_DROPS     ---IILIRHGE----YLDVGDTDETHHLTERGREQAKYTGKRLCELGIKWDKVIASTMVRAQETADIILN
GPMB_CITK8      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARTLGI--THIVSSDLGRTRRTAEIIAQ
F26L_CHICK      -PRAIYLRHGESQLNLKGRIGG--DAGLSTRGRQYAQALAEFIRSQSIRELKVWTSHMKRTIET------
GPMB_SALPK      MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVGERARSLGI--THIISSDLGRTKRTAEIIAQ
Y400_SYNY3      --ELYLIRHGIAQEQSPDIPDG--DRQLTKKGKDKTQRVAQRLQAIGVEFDLILTSPLVRAQQTAQILMD
F261_RAT        -PRSIYLRHGESELNLRGRIGG--DSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQT------
F262_RAT        -PRTIYLRHGESEFNLLGKIGG--DSGLSLRGKQFAQALKKFLEEQEIQDLKVWTSQLKRTIQT----AE
F262_MOUSE      -PRTIYLRHGESEFNLLGKIGG--DSGLSVRGKQFAHALKKFLEEQEIQDLKVWTSQLKRTIQT----AE
F264_MACFA      -PRSIYLRHGESELNLKGRIGG--DPGLSPRGREFAKSLAQFISDQNIKDLKVWTSQMKRTIQT------
F264_HUMAN      -PRSIYLRHGESELNLKGRIGG--DPGLSPRGREFAKSLAQFISDQNIKDLKVWTSQMKRTIQT------
PGAM5_CAEBR     ---IFLIRHGQYHLDR-------EQKHLTELGREQAELLGKRLANSDIKFTNMTMSTMTRATETANIILK
GPMB_YERPY      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPS      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPP      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPN      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPG      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPE      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPB      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERPA      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
GPMB_YERP3      MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRNQGI--THIISSDLGRTQQTAKIIAD
F261_MOUSE      -PRSIYLRHGESELNLRGRIGG--DSGLSARGKQYAYALANFIRSQSISSLKVWTSHMKRTIQT------
F26_YEAST       -PKYIWLRHGESIYNVEKKIGG--DSSLSERGFQYAKKLEQLVKESAGEINTVWTSTLKRTQQTANY---
F264_RAT        -PRSIYLRHGESELNLKGRIGG--DPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQT------
F264_MOUSE      -PRSIYLRHGESELNLKGRIGG--DPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQT------
RISB_XYLFA      ----------------------------------------------------------------------
PROA_LACRJ      ----------------------------------------------------------------------
PROA_LACRD      ----------------------------------------------------------------------
YK23_YEAST      -PRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESV---------------------------
RISB_XYLFT      ----------------------------------------------------------------------
RISB_XYLFM      ----------------------------------------------------------------------
RISB_XYLF2      ----------------------------------------------------------------------
PGAM5_DROME     ---IILVRHGEY------LDVGDSDDHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIILK


                         .         .         *         .         .         .         .:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
GPMA2_LACSS     GSDQLWIPETKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDTLPPLLDASDEGSAANDRRYAH
GPMA2_LACPL     ESDQLWIPETKTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVLPPLLSADDEGSAVNDRRYAD
GPMA1_LACJO     ESDQLWIPETKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVLPPAIDDDNEYSQAHDRRYAN
GPMA_LACAC      ESDQLWIPETKTWRLNERHYGALQGLNKKATAEKYGDEQVHIWRRSYDVLPPAIDDDNEFSQAHDRRYAN
GPMA_ENTFA      YSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTLPPLMEATDEGSAANDRRYAM
GPMA_PASMU      ESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPHSAHNDRRYAH
GPMA_STRPZ      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPM      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPG      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPF      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPD      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPC      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRPB      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRP8      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRP6      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRP3      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_ACTPJ      ESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDAADPNSAHNDRRYAH
GPMA_ACTP7      ESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDAADPNSAHNDRRYAH
GPMA_ACTP2      ESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDAADPNSAHNDRRYAH
GPMA_STRP1      NAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFCDEQVHIWRRSYDVLPPAMAKDDEYSAHKDRRYAD
GPMA_STRSV      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRZJ      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRR6      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRPN      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRPI      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRP7      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRP4      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRP2      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRTD      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPKMDRDDEYSAHKDRRYAS
GPMA_STRT2      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPKMDRDDEYSAHKDRRYAS
GPMA_STRT1      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPKMDRDDEYSAHKDRRYAS
GPMA_STRZT      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRZP      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRPS      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRPJ      ASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPNMDRDDEHSAHTDRRYAS
GPMA_STRGC      AADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMPHDDEYSAHTDRRYAS
GPMA_ACTSZ      ESDQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYXXXXXXXXXXXXNSAHNDRRYAH
GPMA_MANSM      ESNQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYXXXXXXXXXXXXNSAHNDRRYAH
GPMA_HAEIN      ESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYAN
GPMA_STRS7      YSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAH
GPMA_STREM      YSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAH
GPMA_STRE4      YSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAH
GPMA_LISIN      ESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_LISW6      ESDQMWVPVNKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_STRU0      YSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAH
GPMA_LISMH      ESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_STRA5      AADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAS
GPMA_STRA3      AADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAS
GPMA_STRA1      AADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLPPDMAKDDEHSAHTDRRYAS
GPMA_LACLA      YSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVLPPAMDHDDKYTAHGDRRYAG
GPMA_LACLS      FSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVLPPAMDHDDKYTAHGDRRYAG
GPMA_LACLM      FSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVLPPAMDHDDKYTAHGDRRYAG
GPMA_LISMF      ESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_LISMC      ESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_STRMU      YSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEKFGDEQVHIWRRSYDVLPPAMAKDDPYSAHTDRRYAN
GPMA_LISMO      ESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQL
GPMA_STRS2      AADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTLPPEMAKDHEHSAHTDRRYAH
GPMA_HAEPS      ESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYAH
GPMA_NEIM0      ESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAH
GPMA_NEIMB      ESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAH
GPMA_NEIG2      ESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAH
GPMA_NEIG1      ESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAH
GPMA_HAEDU      ESNQLWIPQVKHWRLNERHYGELQGLDKKATAEKYGDEQVHIWRRSYDTLPPLLAPSDPNSAHNDRRYAH
GPMA_NEIMA      ESDQLFVPQIKTWRLNERHYGRLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAH
GPMA_NEIMF      ESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLPPLLDKDDEFSAHKDRRYAH
GPMA_HAEIE      ESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYAN
GPMA_HAEI8      ESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYAN
GPMA_HAEIG      ESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYAN
GPMA_HAES2      ESNQLWIPQVKHWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDVSPPDLDPQDPNSAHNDRRYAL
GPMA_HAES1      ESNQLWIPQVKHWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDVSPPDLDPQDPNSAHNDRRYAL
GPMA_STACT      RSNQLFVPLYKSWRLNERHYGGLQGLNKDAAREEFGEEQVHIWRRSYDIAPPDATAEQREADLADRKYQG
GPMA_STAAR      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAW      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAT      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAS      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAN      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAM      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAE      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAC      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAAB      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAA9      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAA8      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAA3      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAA2      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAA1      ESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH
GPMA_STAHJ      ESDQEWIPVHKSWRLNERHYGKLQGLNKDEARKEFGEEQVHQWRRSYDVKPPAQTEEQRESYLKDRRYRH
GPMA_HALHL      ELDRMWIPEIKDWRLNERHYGALTGLNKAETAEQYGDEQVHIWRRSYDTPPPALDAEDERHPRHDPRYAG
GPMA_ALTMD      EMGQHYLPVERHWRLNERHYGALTGLDKAETAAKHGEEQVKIWRRSFDIPPPAVEDDSEHFPGHDPRYNN
GPMA_FUSNN      EMDELYIPVYKSWRLNERHYGALQGLNKAETAKKYGDEQVHIWRRSFDVAPPSIDKNSEYYPKSDRRYAD
GPMA_TERTT      EMGQMWLPVERHWRLNERHYGALTGLDKAETAAKHGDEQVKIWRRSFDVPPPDVDESSEHFPAHDPRYRG
PMGY_CANAL      AADQLYVPVKRSWRLNERHYGALQGKDKAQTLEAYGQEKFQIWRRSFDVPPPKIDPKDEYSQVGDRRYAD
GPMA_STAS1      ESNQLFIPIIKSWRLNERHYGGLQGLNKDDARKKFGEDQVHIWRRSYDVAPPKQDEAQRESYLNDRKYEH
GPMA_CHLP8      QMDLMWIPVTKSWRLNERHYGALQGLNKTETAQRHGDEQVLIWRRSYDTPPPALDADDERHPSKDRRYAA
GPMA_POLNS      TMDLMWLPVVHSWRLNERHYGALTGLNKAETAEKYGDEQVHIWRRSYDVRPPLLEHEDERHPKNDPRYSK
GPMA_CHLT3      EMDLQWIPVNKTWRLNERHYGALQGLNKSETAEKFGEEQVLIWRRSYDTPPPALEKSDERYPGHDPRYKD
GPMA_THETN      ELDLMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKLWRRSAEVRPPALTKDDPRYPGNDPRYAD
GPMA_ALHEH      ELDQMWIPVTKAWQLNERHYGALTGLNKAETAEEYGAEQVHIWRRSYDTPPPPLDETSPYHPRHDPRYAS
GPMA_POLSQ      AMDLMWLPVVHSWRLNERHYGALTGLNKAETAAQYGDEQVHIWRRSYDIRPPLLEADDERNPKNDSRYAK
GPMA_GEOSL      EMDQMWIPEHRHWRLNERHYGALQGLNKAETAERHGMEQVHVWRRSYDIPPPPLAAGDPRNPARDPRYAE
GPMA_STAES      GSDQQWIPVYKSWRLNERHYGGLQGLNKDDARKKWGEDQVHQWRRSYDVRPPRESEEQREAYLKNRRYQH
GPMA_CHLTE      EMNLMWIPVTKNWRLNERHYGALQGLNKAETAQRHGDEQVLIWRRSYDTPPPALTESDEFWPGKDPRYAS
GPMA_STAEQ      GSDQQWIPVYKSWRLNERHYGGLQGLNKDDARKKWGEDQVHQWRRSYDVRPPRESEEQREAYLKNRRYQH
GPMA_ZYMMO      AGKTLWVPTEKDWRLNERHYGGLTGLNKAETAAKHGEEQVHIWRRSYDVPPPPMEKGSKFDLSGDRRY--
GPMA_PROVI      EMNLMWIPVIRNWRLNERHYGALQGLNKAETAQKYGDEQVLVWRRSYDTPPPPLERTDERWPGSDRRYAA
GPMA_XANOP      ELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVDDPGHPCHDRRYAT
GPMA_ERYLH      EADRLWIPETKDWRLNERHYGGLTGLDKQEMRDKHGDEQVHIWRRSFDVPPPDMEPGHQYDPGADPRYDG
GPMA_XANOR      ELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVDDPGHPCHDRRYAT
GPMA_XANOM      ELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVDDPGHPCHDRRYAT
GPMA_CLOPH      EMDRVWLPVVKSWKLNERHYGTLQGLNKSETAERYGEEQVKIWRRSYDIAPPLLKEEDERNPRFQEQYRQ
GPMA_CHLL2      VLDLMWIPVVKSWRLNERHYGALQGLNKSETSRKYGEEQVLVWRRSYDTPPPVLDKDDERYPGTDRRYAE
GPMA_XANAC      ELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVNDPGHPCHDRRYAT
GPMA_XANCP      ELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVTDPGHPGHDRRYAT
GPMA_XANCB      ELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVTDPGHPGHDRRYAT
GPMA_XANC8      ELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVTDPGHPGHDRRYAT
GPMA2_BACC1     EMDLMWIPVYKTWKLNERHYGALQGLNKEETARKYGDEQVTLWRRSTNVRPPALTKDDERYEAAHPKYRD
GPMA_THEP3      ELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSVDVRPPALEKDDPRYPGFDPRYAD
GPMA_XANC5      ELDQDWLPVSKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDIPPPAMDVNDPGHPCHDRRYAT
GPMA_THEPX      ELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSADVRPPALEKDDPRYPGFDPRYAD
GPMA_VARPS      ELDRTWLPVVHSWRLNERHYGALQGLNKAETAKKYGDEQVLVWRRSYGTPPPPLEADDPRSERSDVRYAK
GPMA_POLNA      EMDQTWLPVEHSWRLNERHYGDLQGLNKAETAKKFGDEQVLVWRRSYDTPPPPLAANDPRSERSDRRYAN
GPMA_LEPCP      QMDRTWLPVAHSWRLNERHYGALQGLNKGDMAKQYGDAQVLIWRRSYDTPPPALEADDPRGQRQDVRYAK
GPMA_BDEBA      EVDQVWLPVHKDWRLNERHYGALQGLNKAETAARHGEEQVKIWRRSYDTPPPPMEVSDPRHPSHDPRYKN
GPMA_GEOSM      QMDLMWIPERKEWRLNERHYGALQGLNKAQTAEQYGDEQVKLWRRSYKVRPPALAEGDRRHPSFDPRYHS
GPMA_ACIAC      EMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTPPPALEAGDPRSERGDIRYAG
GPMA2_NITEU     EMDQMWTPIELNWRLNERHYGALQGLNKAETAKQYGDEQVLVWRRSYDIRPPSITINDERYPGFDLRYRN
GPMA_SALTY      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALTI      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALSV      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALPC      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALPB      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALNS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALHS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALG2      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALEP      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALCH      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALA4      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_PELPB      AMDLMWIPVFKSWRLNERHYGALQGLNKSETSQKYGEEQVLVWRRSYDTPPPALEKSDERYPGSEPRYAD
GPMA_SALPK      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALPA      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SALDC      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SHISS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SHIFL      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SHIF8      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SHIBS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_SHIB3      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ESCF3      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOSM      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOSE      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOLU      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOLI      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOLC      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOL6      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOL5      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOK1      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOHS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECODH      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECOBW      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO8A      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO81      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO7I      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO5E      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO57      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO55      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO45      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO27      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
PGAM_DICDI      ELNLYWIPVSRQWRLNERMYGSLQGLNKSETAAKYGEDQVLIWRRSYDIPPPALEESDERYPGNDPRYAK
GPMA_METI4      KMDRMWIPVEKSWRLNERHYGALQGLNKSEMAKKYGEEQVLLWRRSYDIVPPRLENDDPRHPRFDPRYRS
GPMA_PROA2      TMDLLWVPVEKTWRLNERHYGSLQGLNKTETAQLHGEEQVLVWRRSYDTPPPPLEKTDERYPGNDPRYAS
GPMA_SHIDS      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_ECO24      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_DELAS      EMDRTWLPVQHSWRLNERHYGGLQGLNKADMAKQYGDAQVLVWRRSYDTPPPALEPQDPRSERSDVRYAQ
GPMA_CHLPD      SMDLMWISVFKSWRLNERHYGALQGLNKSETSRKYGEEQVLVWRRSYDTPPPLLEKSDARYPGTDPRYGD
GPMA_CITK8      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAQ
GPMA_CHLPB      GMDLMWIPVFKNWRLNERHYGALQGMNKAETAQQHGDEQVLVWRRSYDTPPPPLEKNDPRFPGNDPRYAT
GPMA_GEOBB      QMDLMWIPEHKEWRLNERHYGALQGLNKAQTAQEYGDEQVKLWRRSYKVRPPALAEGDQRHPSFDPRYHS
GPMA_TREDE      QMDREWLPVIKTWKLNERHYGGLQGLNKAETAEKYGEDQVKIWRRSFDIAPPVLEEGDKRCPYLQEQYRG
GPMA_RALEH      EMDLMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYAN
GPMA_ENTS8      GLDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPALTKDDERYPGHDPRYAK
GPMA_RHOFD      EMDRTWLPVVNSWRLNERHYGALQGLNKAETAKQYGDAQVLAWRRSYDTPPPALEPTDPRSERADRRYAR
GPMA_RALEJ      EMDEMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYAN
GPMA_ERWCT      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAITPPELTRDDERFPGHDPRYAS
GPMA_RALSO      EMDLMWIPTRTEWRLNERHYGGLSGLNKAETAAQYGDQQVLVWRRSYDTPPPALEAGDERDAYGNPRYAG
GPMA_CUPTR      EMDLMWIPVRNEWRLNERHYGALAGLNKSETAAKFGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYAN
GPMA_GEOMG      EMDLMWIPEYRHWRLNERHYGALQGLNKAETAERHGMEQVMIWRRSYDIPPPPLTPDDQRFPGSDPRYAX
GPMA_METHJ      EMDLMWIPVIRTWRLNERHYGALTGLNKIETVEKYGEQQVHIWRRSYDIPPPAYTPDNLDNPSYHRRYQE
GPMA_BORBZ      ELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKH
GPMA_BORBU      ELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKH
GPMA_SERP5      ELDQAWLPTEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYSA
GPMA_PELLD      EMDQMWLPVHKSWRLNERHYGALQGLNKTETSQKYGEEQVLVWRRSYDTPPPALGRDDERWPGADPRYRG
GPMA_BORAP      ELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKY
GPMA_PECCP      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAITPPELTRDDERFPGHDPRYAS
GPMA_DIAST      EMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTPPPALETTDPRSERGDLRYAG
GPMA_THEFY      EAGLHWIPVKRSWRLNERHYGALQGKNKAQTRAEFGDEQFMIWRRSYDTPPPPLAEDSEFSQHNDPRYAT
GPMA_MARMM      GLDRLWIPVDKSWRLNERHYGALAGLDKNETRAKHGDEQVKIWRRSFDTPPPPVATDHAYHPLNDHRYAD
GPMA_ACISJ      EMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTPPPALEPTDPRCERGDIRYAG
GPMA_PHOLL      QVDQQWLPVEKSWKLNERHYGALQGLDKAETAAKYGDDQVKLWRRGFAITPPDLTKDDERFPGHDPRYAN
GPMA_AZOSE      ELDSLWLPVEHSWRLNERHYGDLQGLNKAETAAKFGDDQVLVWRRSYDTPPPPLPEGDERLTSGDPRYAS
GPMA_SOLUE      GMDLMWIPVHRSWRLNERHYGALQGLNKAETAAKFGEDQVKIWRRSYDIPPPVLTADDPRFPGHDPRYQS
PMG1_YEAST      KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
GPMA_STRGG      SADRLWIPVRRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRSYDTPPPPLARDDEFSQFDDPRYAT
GPMA_BORGA      ELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEGKVLIWRRSYDVPPMSLDESEDRHPIKDPRYKY
GPMA_SPHWW      AMGRLWLPVEKDWRLNERHYGGLTGLNKAETAARHGDAQVKVWRRSFDIPPPVLEPGGEFDLSKDRRYAG
GPMA_COPPD      QMNLDWIPVYKHWRLNERHYGALQGLNKAEMTERYGEQQVLLWRRSYDVPPPPLEKTDPRWPGNDPRYAL
GPMA_CHLCH      EMDLMWLPVTKSWRLNERHYGALQGLNKAETAQKYGEEQVLVWRRSYDTPPPALEKSDARYPGSQARYAS
GPMA_BORHD      ELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDQVLMWRRSYDIPPMPLEESDKRHPIHDLRYKG
GPMA_BORDL      ELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVPPMPLDESDKRHPIHDSRYKN
GPMA_LEIXX      AADRLWIPVVRSWRLNERHYGALQGLDKAETLEKYGPEQFQLWRRSFDVPPPPLADDSEWSQADDPRYAD
GPMA_CLOAB      EMDLLWIPVYKSWKLNERHYGALQGLNKDETRDKYGEDQVHLWRRSVEVRPPALEKSDKRYPGNEKKYAS
GPMA_BORT9      ELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLMWRRSYDIPPMPLEESDKRHPIHDLRYRG
GPMA_EDWI9      KLDQPWLPVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFAITPPALTPDDPRYPGHDPRYAA
GPMA_BORRA      ELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVPPMPLDESDKRHPIHDSRYKN
GPMA_PROMH      EVDQQWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDDRFPGKDPRYAS
GPMA_PARD8      RMDQDWIPVEKSWRLNEKHYGSLQGLNKSETAQKYGDEQVLIWRRSYDIAPLPLSEDDPRNPRFDIRYKD
GPMA_BORPD      AMDAMYTPVGISWRLNERHYGNLQGLNKAETAAKYGDEQVLIWRRAYAIAPEPLPLDDERHPRFDSRYAK
GPMA2_NITMU     EMDQMWIPVESSWRLNERHYGALQGLNKLETAVAYGEEQVLIWRRSYDIRPPALTPDDPRYPGCDPRYRN
GPMA_ERWT9      EVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFAVTPPELDRADERFPGHDPRYAS
GPMA_CAUSK      AAGQSFVPVTKDWRLNERHYGGLTGLNKAETAQKHGEEQVTIWRRSYDIPPPPLAPGGEYDFGKDRRYAG
GPMA_BURS3      KMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTPPPALEATDERAPFNDPRYAK
GPMA_BURPS      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURP6      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURP1      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURP0      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURMS      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURMA      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURM9      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_BURM7      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPGDERAPYADPRYAK
GPMA_NITOC      MMDLVWLPVEKRWELNERHYGNLQGLNKAEMAKQYGAELVHQWRRGYGIEPPPLDNSDPRHPRFDRRYAG
GPMA_FRAAA      AAGRTWVPVRRSWRLNERHYGGLQGLNKAETLEKFGEEQFQLWRRSYDTPPPEIGPEQVSGV--DERYAD
GPMA_CLOB8      EMDLAWIPVFKSWRLNERHYGALQGLNKAETAKKYGEEQVHKWRRFVNVKPPELTKEDTRYPGNEYKYKD
GPMA_AZOSB      ELDALWLPVEHSWRLNERHYGALQGLNKAETAAKFGDDQVLVWRRSYDIPPPALEEGDERLNYDDPRYGS
GPMA_STRAW      SADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRSYDTPPPPLADGSEFSQSDDPRYAS
GPMA_BURCJ      KMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDEQVLVWRRSYDTPPPALEPTDERAPFNDPRYAK
GPMA_BURCC      KMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDEQVLVWRRSYDTPPPALEPTDERAPFNDPRYAK
GPMA_BORPA      ALDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIAPEPLDLEDPRHPRFDGRYAK
GPMA_METPP      GMDRTWLPVIKDWRLNERHYGGLQGLNKADMAKQFGDEQVLLWRRSYDVPPPPLEANDPRSERSDVRYAK
GPMA_RHOSR      TADRHWIPVIRDWRLNERHYGALQGRNKAQVKEKYGDEQFMLWRRSYDTPPPPIEAGSEYSQDTDPRYAN
GPMA_RHOOB      TADRHWIPVIRDWRLNERHYGALQGRNKAQVKDKYGDEQFMLWRRSYDTPPPTIEPGSEYSQDTDPRYAN
GPMA_BORPE      AMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIAPEPLDLEDPRHPRFDGRYAK
GPMA_BORBR      AMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIAPEPLDLEDPRHPRFDGRYAK
GPMA_XYLFM      ALDQDWLPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYXXXXXXXXXXXXSHPMRDRRYAA
GPMA_XYLFA      ALDQDWLPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYXXXXXXXXXXXXSHPMRDRRYAA
GPMA_BURTA      QMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEPTDERAPYGDPRYAK
PGAM2_RAT       VTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDTPPPPMDEKHNASISKDRRYAG
GPMA_ENT38      ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
GPMA_BACC3      EMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVRPPALTEDDPRYEMNDPRYKE
GPMA_BACAH      EMNLSWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVRPPALTEDDPRYEMNDPRYKE
GPMA_NOCFA      AADRHWIPVVRDWRLNERHYGELQGKNKAQIRDKYGEEQFMLWRRSYDTPPPPIEAGNEYSQEGDARYAG
GPMA1_BACC1     EMDLAWIPVHKCWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVRPPALTEDDPRYEMNDPRYKA