[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00312.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    4::222     9e-33  34%  237 aa  GMUR_BACSU RecName: Full=HTH-type transcriptional regulator
   11::225     4e-30  31%  243 aa  YVOA_BACSU RecName: Full=HTH-type transcriptional repressor yvoA;
    9::233     3e-24  28%  238 aa  TRER_BACSU RecName: Full=Trehalose operon transcriptional
    1::217     4e-21  26%  238 aa  YIDP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    6::230     9e-20  26%  240 aa  MNGR_ECOLI RecName: Full=Mannosyl-D-glycerate transport/metabolism
    4::218     2e-18  29%  235 aa  YBGA_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   47::233     3e-17  28%  248 aa  YEGW_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
   47::233     3e-17  28%  248 aa  YEGW_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   47::233     3e-17  28%  248 aa  YEGW_ECOL6 RecName: Full=Uncharacterized HTH-type transcriptional
   47::233     3e-17  28%  248 aa  YEGW_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
   25::227     4e-17  26%  236 aa  YYDK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   18::154     6e-16  31%  242 aa  YURK_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   10::227     4e-15  23%  243 aa  FRLR_SHIFL RecName: Full=HTH-type transcriptional regulator frlR;
   10::227     4e-15  24%  243 aa  FRLR_ECO57 RecName: Full=HTH-type transcriptional regulator frlR;
   10::227     5e-15  23%  243 aa  FRLR_ECOLI RecName: Full=HTH-type transcriptional regulator frlR;
   44::233     2e-13  27%  254 aa  DASR_STRAW RecName: Full=HTH-type transcriptional repressor dasR;
   43::232     5e-13  27%  253 aa  DASR_STRGR RecName: Full=HTH-type transcriptional repressor dasR;
   10::164     6e-13  30%  241 aa  YMFC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   44::233     1e-12  27%  254 aa  DASR_STRCO RecName: Full=HTH-type transcriptional repressor dasR;
   11::217     2e-12  24%  239 aa  PHNR_SALCH RecName: Full=Putative transcriptional regulator of
   11::217     1e-11  24%  239 aa  PHNR_SALTY RecName: Full=Putative transcriptional regulator of
   11::217     1e-11  24%  239 aa  PHNR_SALTI RecName: Full=Putative transcriptional regulator of
   11::217     2e-11  24%  239 aa  PHNR_SALPA RecName: Full=Putative transcriptional regulator of
   29::71      7e-09  56%  258 aa  LLDR_SHIFL RecName: Full=Putative L-lactate dehydrogenase operon
   29::71      7e-09  56%  258 aa  LLDR_ECOLI RecName: Full=Putative L-lactate dehydrogenase operon
    2::66      2e-08  38%  375 aa  ARAR_BACHD RecName: Full=Arabinose metabolism transcriptional
    1::54      3e-08  44%  442 aa  NORG_STAAB RecName: Full=HTH-type transcriptional regulator norG;
    1::54      3e-08  44%  442 aa  NORG_STAAN RecName: Full=HTH-type transcriptional regulator norG;
    1::54      3e-08  44%  442 aa  NORG_STAAM RecName: Full=HTH-type transcriptional regulator norG;
    1::54      5e-08  44%  442 aa  NORG_STAAC RecName: Full=HTH-type transcriptional regulator norG;
    1::54      5e-08  44%  442 aa  NORG_STAA8 RecName: Full=HTH-type transcriptional regulator norG;
    1::54      5e-08  44%  442 aa  NORG_STAA3 RecName: Full=HTH-type transcriptional regulator norG;
    9::72      8e-08  35%  364 aa  ARAR_BACST RecName: Full=Arabinose metabolism transcriptional
   33::74      1e-07  43%  254 aa  PDHR_SALTY RecName: Full=Pyruvate dehydrogenase complex
   33::74      1e-07  43%  254 aa  PDHR_SALTI RecName: Full=Pyruvate dehydrogenase complex
   33::74      1e-07  43%  254 aa  PDHR_ECOLI RecName: Full=Pyruvate dehydrogenase complex
   33::74      1e-07  43%  254 aa  PDHR_ECOL6 RecName: Full=Pyruvate dehydrogenase complex
   33::74      1e-07  43%  254 aa  PDHR_ECO57 RecName: Full=Pyruvate dehydrogenase complex
   44::215     2e-07  26%  250 aa  HUTC_PSEAE RecName: Full=Histidine utilization repressor;
   10::106     3e-07  32%  456 aa  Y3073_RHOS4 RecName: Full=Uncharacterized HTH-type transcriptional
    9::72      3e-07  38%  258 aa  EXUR_SHIFL RecName: Full=Exu regulon transcriptional regulator;
    9::72      3e-07  38%  258 aa  EXUR_ECOLI RecName: Full=Exu regulon transcriptional regulator;
    9::72      3e-07  38%  258 aa  EXUR_ECO57 RecName: Full=Exu regulon transcriptional regulator;
    5::67      3e-07  31%  362 aa  ARAR_BACSU RecName: Full=Arabinose metabolism transcriptional
   42::213     5e-07  24%  248 aa  HUTC_PSEPU RecName: Full=Histidine utilization repressor;
   16::77      7e-07  31%  484 aa  YISV_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   14::76      7e-07  32%  241 aa  HUTC_KLEAE RecName: Full=Histidine utilization repressor;
   15::77      9e-07  37%  482 aa  YDFD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    9::72      9e-07  35%  259 aa  EXUR_ERWCH RecName: Full=Exu regulon transcriptional regulator;
   40::82      1e-06  51%  453 aa  PDXR_CORGL RecName: Full=HTH-type pyridoxine biosynthesis
   13::100     2e-05  30%  479 aa  GABR_BACSU RecName: Full=HTH-type transcriptional regulatory
   12::62      3e-05  37%  219 aa  LUTR_BACSU RecName: Full=HTH-type transcriptional regulator
   12::78      4e-05  32%  493 aa  MOCR_RHIME RecName: Full=Probable rhizopine catabolism regulatory
   12::76      8e-05  36%  130 aa  YTRA_BACSU RecName: Full=HTH-type transcriptional repressor ytrA;
   19::82      8e-05  33%  242 aa  Y505_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
   19::82      8e-05  33%  242 aa  Y494_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
    9::72      8e-05  32%  241 aa  KORA_STRLI RecName: Full=Protein korA;
   29::172     1e-04  26%  236 aa  YIHL_SHIFL RecName: Full=Uncharacterized HTH-type transcriptional
   29::172     1e-04  26%  236 aa  YIHL_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   29::172     1e-04  26%  236 aa  YIHL_ECO57 RecName: Full=Uncharacterized HTH-type transcriptional
   33::74      1e-04  40%  121 aa  YHCF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   24::94      1e-04  30%  462 aa  YDEF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   13::81      2e-04  29%  224 aa  YDHC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   37::162     2e-04  20%  244 aa  Y6150_RHIME RecName: Full=Uncharacterized HTH-type transcriptional
   32::73      2e-04  36%  257 aa  UXUR_ECOLI RecName: Full=Uxu operon transcriptional regulator;
   34::74      5e-04  41%  240 aa  Y601_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
   34::74      5e-04  41%  240 aa  Y586_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
   22::79      7e-04  32%  230 aa  YIEP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
GMUR_BACSU      -----YEIIANEMRNRIKNNVYPDQPIPDEVSLAKEFNSSRMTMKRALDNLVAEGLLFRKRGHGTFIIQS
YVOA_BACSU      ----IYYQIMEQLKTQIKNGELQDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVSKP
TRER_BACSU      --------IYKDIAQQIEGGRWAEEILPSEHELTAQYGTSRETVRKALHMLAQNGYIQKIRGKGSVV---
YIDP_ECOLI      ---MIYKSIAERLRIRLNSADFTNSLLPGEKKLAEEFAVSRMTIRKAIDLLVAWGLVVRRHGSGT-----
MNGR_ECOLI      ----LYRQIADRIREQIARGELKPGDLPTESALQTEFGVSRVTVRQALRQLVEQQILESIQGSGT-----
YBGA_BACSU      ----LYSVIKFKIIELIKSGKYANDQLPTESEFCEQYDVSRTTVRLALQQLELEGYIKRIQGKGTFVSAA
YEGW_SHIFL      --------------------------LPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQIN--
YEGW_ECOLI      --------------------------LPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQIN--
YEGW_ECOL6      --------------------------LPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQIN--
YEGW_ECO57      --------------------------LPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQIN--
YYDK_BACSU      -------------------------KLPVLETLMAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKH
YURK_BACSU      --------ITDDIKKGVYS---PTAKLPTENELCTKYNVSRITVRKAILDLVEEGYLIRQQGKGTFVKSP
FRLR_SHIFL      --QLLYATVRQRLLDDIAQGVYAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKGTFVQSQ
FRLR_ECO57      --QLLYATVRQRLLDDIAQGVYAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKGTFVQSQ
FRLR_ECOLI      --QLLYATVRQRLLDDIAQGVYAGQQIPTENELCTQYNVSRITIRKAISDLVADGVLIRWQGKGTFVQSQ
DASR_STRAW      --------------------------VPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVKPK
DASR_STRGR      --------------------------VPPERTLAAEFDTSRTTVPQALQELVVEGRLERIQGKGTFVKPK
YMFC_BACSU      ----LYLKVIERIKEDIKNGIYTEKKLPSEFELSKKLGVSRATLREALRILEEEHVIIRRHGVGTFVHPL
DASR_STRCO      --------------------------VPPERTLAAEFDTSRTTVRQALQELVVEGRLERIQGKGTFVKPK
PHNR_SALCH      -----YLLIKAQLQERIQSGALSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRGWFVTPE
PHNR_SALTY      -----YLLIKAQLQARIQSGALSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRGWFVTPE
PHNR_SALTI      -----YLLIKAQLQARIQSGALSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRGWFVTPE
PHNR_SALPA      -----YLLIKAQLQARIQSGALSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRGWFVTPE
LLDR_SHIFL      ------------------------MKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGGTFI---
LLDR_ECOLI      ------------------------MKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGGTFI---
ARAR_BACHD      --ETKYNFVKQQIKSKILEGVLPHGKIGSENELMKEYNVSRHTVRKAIDELVNEGWVYRKQGAGTF----
NORG_STAAB      ------------------------MKIPSQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
NORG_STAAN      ------------------------MKIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
NORG_STAAM      ------------------------MKIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
NORG_STAAC      ------------------------MKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
NORG_STAA8      ------------------------MKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
NORG_STAA3      ------------------------MKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND-
ARAR_BACST      -----YLQLKQEILSWIISGQMKDEKIPTEHEIANQFQLSRHTVRQALGELEKEGWLYKIQGSGTFVS--
PDHR_SALTY      -------------------------KLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFV---
PDHR_SALTI      -------------------------KLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFV---
PDHR_ECOLI      -------------------------KLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFV---
PDHR_ECOL6      -------------------------KLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFV---
PDHR_ECO57      -------------------------KLPPERELAKQFDVSRPSLREAIQRLEAKGLLLRRQGGGTFV---
HUTC_PSEAE      -------------------------RVPSESELVSQLGFSRMTINRALRELTSDGLLVRMQGVGTFV--A
Y3073_RHOS4     -ARLKYLGIVDALEADIRAGRVTPERLPPQRAIAEALGVDLTTVTRALNEAQRRGLVSAQVGRGTFV---
EXUR_SHIFL      ----LYQQLAADLKERIEQGVYVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSGIHV---
EXUR_ECOLI      ----LYQQLAADLKERIEQGVYVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSGIHV---
EXUR_ECO57      ----LYQQLAADLKERIEQGVYVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSGIHV---
ARAR_BACSU      -----YAQVKEEISSWINQGKILDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFV---
HUTC_PSEPU      -------------------------RVPSESELVNELGFSRMTINRALRELTADGLLVRMQGVGTFVAEP
YISV_BACSU      ----LHRQIEQYMKDKILHGEWAGTKIPSQRTLADMFQVNRSTVTAAIDELTSQGLLEGRKGGGT-----
HUTC_KLEAE      -----YEKVKQAISEKIHSGVWRPHRIPSEAELVAQFGFSRMTINRALRELTDEGLLVRLQGVGTFV---
YDFD_BACSU      -----YRQIVHFIKEKIGNGEWPGSKIPSQRTLAKDFQVNRSTVITALEELMADGLIEGTMGKGTVV---
EXUR_ERWCH      ----LYQQLAAELKQRIENGVYVGDKLPAERNISEEMNVSRTVVREAIIMLEVEGYVEVRKGSGIHV---
PDXR_CORGL      --------------------------LPSSRSLSTQLGVSRGSVVTAYDQLAGEGYLSTARGSGTTINP-
GABR_BACSU      -ADYIYQQIYQKLKKEILSRNLLPSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEEL
LUTR_BACSU      -------------------------KLDSVQALAESFQVSRSAVREALSALKAMGLVEMKQGEGTYLKEF
MOCR_RHIME      ----MHRQLYEKLRAEILAGHLADTRLPPTRMMAEDLGVSRNTVITTYDALLAEGYLESRSGSGTWVATL
YTRA_BACSU      ----IYEQIIQQMKELCLKGIMKPGKLPSVRELATIIIANPNTVSKAYKELEREGIIETLRGRGTYIS--
Y505_MYCBO      ----VDERIATTIADAILDGVFPPSTLPPERDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVV---
Y494_MYCTU      ----VDERIATTIADAILDGVFPPSTLPPERDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVV---
KORA_STRLI      -----YLQVVAALKAKIVSGELKHGDLPSVRDLAAQYEISTATAQKVHRTLKAEGLAEAKQGSATTVS--
YIHL_SHIFL      -------------------------KLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKGWFV---
YIHL_ECOLI      -------------------------KLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKGWFV---
YIHL_ECO57      -------------------------KLPSERELGELLGIKRMTLRQALLNLEAESKIFRKDRKGWFV---
YHCF_BACSU      -------------------------KLPSVREMAIQTKVNPNTIQRTYSEMERLGIVETRRGQGTFI---
YDEF_BACSU      ----IYKALAGQLEQDILNGVLLPTKLPPQRELADYLDLNVSTISKAFKVCELKGLLSATVGSGTFVSYD
YDHC_BACSU      -----YLQFYNQLKKMIFNGTFKPGERINETQLAKSFGVSRSPIREAMRLLEKDGLLKADDRNGFSITSL
Y6150_RHIME     --------------------------VPPETALAAEFGVNRHTVRSALAALAEEGLVRAVQGRGTMI---
UXUR_ECOLI      -------------------------RLPPEREIAEMLDVTRTVVREALIMLEIKGLVEVRRGAGIYV---
Y601_MYCBO      --------------------------LPSERRLAELLGVSRPAVREALKRLSAAGLVEVRQGDVTTV---
Y586_MYCTU      --------------------------LPSERRLAELLGVSRPAVREALKRLSAAGLVEVRQGDVTTV---
YIEP_ECOLI      ------------LAQRILKGEYEPGTLPGEIELGEQFGVSRTAVREAVKTLTAKGMVLPRPRIGTRVMP-


                         .         .         *         .         .         .         .:140
query           YLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
GMUR_BACSU      AIQDDHV-HVVSNEILGLTN--LLKDKKIKSKVIQFEVQFPTEEVAAHLSIDQKTPVYYVVRLRIVEGEP
YVOA_BACSU      KMEQAL-----QGLT-SFTEDMKSRGMTPGSRLIDYQLIDSTEELAAILGCGHPSSIHKITRVRLANDIP
TRER_BACSU      --LNREKMQFPVSGLVSFKELAQTLGKETKTTVHKFGLEPPSELIQKQLRANLDDDIWEVIRSRKIDGEH
YIDP_ECOLI      YLVRKDVL-HQTASLTGLVEVLKRQGKTVTSQVLIFEIMPAPPAIASQLRIQINEQIYFSRRVRFVEGKP
MNGR_ECOLI      YVKEERV-NYDIFQLTSFDEKLSDRHVDTHSEVLIFEVIPADDFLQQQLQITPQDRVWHVKRVRYRKQKP
YBGA_BACSU      KIQTHKITSFAE----------QMRGLRSESKVLELVVIPADHSIAELLKMKENEPVNKLVRVRYAEGEP
YEGW_SHIFL      -----NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECOLI      -----NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECOL6      -----NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YEGW_ECO57      -----NIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEA
YYDK_BACSU      KRKGYISLLSNQGFKKDLED-FNV-----TSKVIELDVRKPTPEAAENLNIGMDEDIYYVKRVRYINGQT
YURK_BACSU      KLKRELI------AVNGYSEFMESTGKKPKHHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
FRLR_SHIFL      KVEN-ALLTVSGFTDFGVS-----QGKSTKEKVIEQERVSAAPFCEK-LNIPGNSEVFHLCRVMYLDKEP
FRLR_ECO57      KVEN-ALLTVSGFTDFGVS-----QGKATKEKVIEQERISAAPFCEK-LNIPGNSEVFHLCRVMYLDKEP
FRLR_ECOLI      KVEN-ALLTVSGFTDFGVS-----QGKATKEKVIEQERVSAAPFCEK-LNIPGNSEVFHLCRVMYLDKEP
DASR_STRAW      VSQALQLTSYTE--------DMRAQGLEPTSQLLDIGYITADDTLAGLLDITAGGRVLRIERLRLASGEP
DASR_STRGR      VSQALQLTSYTE--------DMRAQGLEPTSQLLDIGYVTADDTLAGLLDISTGGRVLRIERLRLASGEP
YMFC_BACSU      FLSGIEQLN-------SVTKMIEQANMTPGTIFLSSQVLMPSEDDTKRFHLAEGQELFYLERVRTADGQP
DASR_STRCO      VSQALQLTSYTE--------DMRAQGLEPTSQLLDIGYITADDRLAGLLDITAGGRVLRIERLRMANGEP
PHNR_SALCH      RLW------LDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMESLQLQPFDQIYLLTRLRYADGRA
PHNR_SALTY      RLW------LDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
PHNR_SALTI      RLW------LDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
PHNR_SALPA      RLW------LDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRA
LLDR_SHIFL      ----------------------------------------------------------------------
LLDR_ECOLI      ----------------------------------------------------------------------
ARAR_BACHD      ----------------------------------------------------------------------
NORG_STAAB      YLNEAHITN-------------------------------------------------------------
NORG_STAAN      YLNEAHITN-------------------------------------------------------------
NORG_STAAM      YLNEAHITN-------------------------------------------------------------
NORG_STAAC      YLNEAHITN-------------------------------------------------------------
NORG_STAA8      YLNEAHITN-------------------------------------------------------------
NORG_STAA3      YLNEAHITN-------------------------------------------------------------
ARAR_BACST      ----------------------------------------------------------------------
PDHR_SALTY      ----------------------------------------------------------------------
PDHR_SALTI      ----------------------------------------------------------------------
PDHR_ECOLI      ----------------------------------------------------------------------
PDHR_ECOL6      ----------------------------------------------------------------------
PDHR_ECO57      ----------------------------------------------------------------------
HUTC_PSEAE      EPKGQSLFEVH-----NIADEIAARGHRHRCQVITLEVAGPERALALDVREGQRVFHSLIVHYE--NDIP
Y3073_RHOS4     --RDEPAGDEGGGTPLDLSMNIPPQPAEPDLR--------------------------------------
EXUR_SHIFL      ----------------------------------------------------------------------
EXUR_ECOLI      ----------------------------------------------------------------------
EXUR_ECO57      ----------------------------------------------------------------------
ARAR_BACSU      ----------------------------------------------------------------------
HUTC_PSEPU      KGRS-ALFEVN-----NIADEIAARGHQHSCQVITLTEEAAGSERALALDMREGQRVFHSLIVHFENGVP
YISV_BACSU      ----------------------------------------------------------------------
HUTC_KLEAE      ----------------------------------------------------------------------
YDFD_BACSU      ----------------------------------------------------------------------
EXUR_ERWCH      ----------------------------------------------------------------------
PDXR_CORGL      ----------------------------------------------------------------------
GABR_BACSU      -----DMFSAEEHPPFALPDDLK-----------------------------------------------
LUTR_BACSU      ELNQIS----------------------------------------------------------------
MOCR_RHIME      ----------------------------------------------------------------------
YTRA_BACSU      ----------------------------------------------------------------------
Y505_MYCBO      ----------------------------------------------------------------------
Y494_MYCTU      ----------------------------------------------------------------------
KORA_STRLI      ----------------------------------------------------------------------
YIHL_SHIFL      ---TQPRFNYSPELSASFQRAAIEQGREPS---WGFTEKNRTSDIPETLAVTPSTELYRITGWGALEGHK
YIHL_ECOLI      ---TQPRFNYSPELSASFQRAAIEQGREPS---WGFTEKNRTSDIPETLAVTPSTELYRITGWGALEGHK
YIHL_ECO57      ---TQPRFNYSPELSASFQRAAIEQGREPS---WGFTEKNRTSDIPETLAVTPSTELYRITGWGALEGHK
YHCF_BACSU      ----------------------------------------------------------------------
YDEF_BACSU      ALSN------------------------------------------------------------------
YDHC_BACSU      TAKD------------------------------------------------------------------
Y6150_RHIME     --ERKDRVSYPISRRTRFSQGLGRQVREIGTELLGHAQVPASGEIATALGVPPGTPLIELSTVSSGDGRP
UXUR_ECOLI      ----------------------------------------------------------------------
Y601_MYCBO      ----------------------------------------------------------------------
Y586_MYCTU      ----------------------------------------------------------------------
YIEP_ECOLI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
GMUR_BACSU      YVLEKTYMPTHLIPGINDDVLHDSIYNHITNVLQLKIAGTHRKIRACKSDHIDQQHLGCKQDDPILEVEH
YVOA_BACSU      MAIESSHIPFELAGELNESHFQSSIYDHIERYNSIPISRAKQELEPSAATTEEANILGIQKGAPVLLIKR
TRER_BACSU      VILDKDYFFRKHVPHLTKEICENSIYEYIEGELGLSISYAQKEIVAEPCTDEDRELLDLRGYDHMVVVRN
YIDP_ECOLI      LMLEDSYMPVKLFRNLSLQHLEGSKFEYIEQECGILIGGNYESLTPVLADRLLARQMKVAEHTPLLRITS
MNGR_ECOLI      MALEETWMPLALFPDLTWQVMENSKYHFIEEVKKMVIDRSEQEIIPLMPTEEMSRLLNISQTKPILEKVS
YBGA_BACSU      LQYHTSYIPWKAAPGLAQEECTGSLFELLRTKYNIEISRGTESI--EPILTDESGHLLTNVGAPAFLSES
YEGW_SHIFL      VSIEESWVPAHLIHDVDAIGI--SLYDYFRSQ-HIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQ
YEGW_ECOLI      VSIEESWVPAHLIHDVDAIGI--SLYDYFRSQ-HIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQ
YEGW_ECOL6      VSIEESWVPAHLIHDVDAIGI--SLYDYFRSQ-HIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQ
YEGW_ECO57      VSIEESWVPAHLIHDVDAIGI--SLYDYFRSQ-HIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQ
YYDK_BACSU      LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQXXXXXXXXXXXXXXXPKLYIES
YURK_BACSU      LTFEVTHYPLDLFP--------------------------------------------------------
FRLR_SHIFL      LFIDSSWIPLSRYPDFDEIYVESSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRISK
FRLR_ECO57      LFIDSSWIPLSRYPDFDEIYVESSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRISK
FRLR_ECOLI      LFIDSSWIPLSRYPDFDEIYVESSTYQLFQERFDTRVVSDKKTIDIFAATRPQAKWLKCELGEPLFRISK
DASR_STRAW      MAIETTHLSAKRFPALRRSLVKTSLYTALAEVYDVRLAEAEETIETSLATPREAGLLGTDVGLPMLMLSR
DASR_STRGR      MAIETTHLSAKRFPALRRSLVKTSLYTALAEVYDVRLAEAEETIETSLATPREAGLLGTDVGLPMLMLSR
YMFC_BACSU      IVYCIDKIPMNILPNSFSHQQES-----------------------------------------------
DASR_STRCO      MAIETTHLSAKRFPALRRSLVKTSLYTALAEVYDVHLAEAEETIETSLATPREAGLLGTDVGLPMLMLSR
PHNR_SALCH      VYCENHCLPARV-PELLQYDLNGSLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRR
PHNR_SALTY      VYCENHCLPARV-PELLQYDLNGSLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRR
PHNR_SALTI      VYCENHCLPARV-PELLQYDLNGSLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRR
PHNR_SALPA      VYCENHCLPARV-PELLQYDLNGSLTEVYESYYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRR
LLDR_SHIFL      ----------------------------------------------------------------------
LLDR_ECOLI      ----------------------------------------------------------------------
ARAR_BACHD      ----------------------------------------------------------------------
NORG_STAAB      ----------------------------------------------------------------------
NORG_STAAN      ----------------------------------------------------------------------
NORG_STAAM      ----------------------------------------------------------------------
NORG_STAAC      ----------------------------------------------------------------------
NORG_STAA8      ----------------------------------------------------------------------
NORG_STAA3      ----------------------------------------------------------------------
ARAR_BACST      ----------------------------------------------------------------------
PDHR_SALTY      ----------------------------------------------------------------------
PDHR_SALTI      ----------------------------------------------------------------------
PDHR_ECOLI      ----------------------------------------------------------------------
PDHR_ECOL6      ----------------------------------------------------------------------
PDHR_ECO57      ----------------------------------------------------------------------
HUTC_PSEAE      VQIEDRYVNAAVAPDLKQDFTRQTPYAYLTQVAPLTEGEHVVAILAEPA---ECKLLQIERGEP------
Y3073_RHOS4     ----------------------------------------------------------------------
EXUR_SHIFL      ----------------------------------------------------------------------
EXUR_ECOLI      ----------------------------------------------------------------------
EXUR_ECO57      ----------------------------------------------------------------------
ARAR_BACSU      ----------------------------------------------------------------------
HUTC_PSEPU      VQIEDRYVNAAIAPDLKQDFTRQTPYAYLSQVAPLTEGEHVVAILAEP---EECRLLQIERGEP------
YISV_BACSU      ----------------------------------------------------------------------
HUTC_KLEAE      ----------------------------------------------------------------------
YDFD_BACSU      ----------------------------------------------------------------------
EXUR_ERWCH      ----------------------------------------------------------------------
PDXR_CORGL      ----------------------------------------------------------------------
GABR_BACSU      ----------------------------------------------------------------------
LUTR_BACSU      ----------------------------------------------------------------------
MOCR_RHIME      ----------------------------------------------------------------------
YTRA_BACSU      ----------------------------------------------------------------------
Y505_MYCBO      ----------------------------------------------------------------------
Y494_MYCTU      ----------------------------------------------------------------------
KORA_STRLI      ----------------------------------------------------------------------
YIHL_SHIFL      VFYHETYINPEVAPGFIE-QLENHSFSAVWEKCYQ-----------------------------------
YIHL_ECOLI      VFYHETYINPEVAPGFIE-QLENHSFSAVWEKCYQ-----------------------------------
YIHL_ECO57      VFYHETYINPEVAPGFIE-QLENHSFSAVWEKCYQ-----------------------------------
YHCF_BACSU      ----------------------------------------------------------------------
YDEF_BACSU      ----------------------------------------------------------------------
YDHC_BACSU      ----------------------------------------------------------------------
Y6150_RHIME     LSTAVSYYPAERFARMA-----------------------------------------------------
UXUR_ECOLI      ----------------------------------------------------------------------
Y601_MYCBO      ----------------------------------------------------------------------
Y586_MYCTU      ----------------------------------------------------------------------
YIEP_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IFFLDNGTPFEFSQMRLHFKYLKFNTFxxxx
GMUR_BACSU      VGFLDTGIPFEYSFSR---------------
YVOA_BACSU      TTYLQNGTAFEHAK-----------------
TRER_BACSU      YVFLEDTSLFQYTESRHRLDKFRFVDF----
YIDP_ECOLI      LSYSESGEFLNYSVM----------------
MNGR_ECOLI      RGYLVDGRVFEYSRNAFNTDDYKF-------
YBGA_BACSU      LTYDKNEEVVEYAQI----------------
YEGW_SHIFL      VALDQQQRPIEYS------------------
YEGW_ECOLI      VALDQQQRPIEYS------------------
YEGW_ECOL6      VALDQQQRPIEYS------------------
YEGW_ECO57      VALDQQQRPIEYS------------------
YYDK_BACSU      IFHLTNGQPFDYSKISYNYEQSQF-------
YURK_BACSU      -------------------------------
FRLR_SHIFL      IAFDQNDKPVHVSEL----------------
FRLR_ECO57      IAFDQNDKPVHVSEL----------------
FRLR_ECOLI      IAFDQNDKPVHVSEL----------------
DASR_STRAW      HSLDKDGRPVEW-------------------
DASR_STRGR      HSVDGQGEPVEW-------------------
YMFC_BACSU      -------------------------------
DASR_STRCO      HSQDRTGQPVEW-------------------
PHNR_SALCH      LNYDQHG------------------------
PHNR_SALTY      LNYDQHG------------------------
PHNR_SALTI      LNYDQHG------------------------
PHNR_SALPA      LNYDQHG------------------------
LLDR_SHIFL      -------------------------------
LLDR_ECOLI      -------------------------------
ARAR_BACHD      -------------------------------
NORG_STAAB      -------------------------------
NORG_STAAN      -------------------------------
NORG_STAAM      -------------------------------
NORG_STAAC      -------------------------------
NORG_STAA8      -------------------------------
NORG_STAA3      -------------------------------
ARAR_BACST      -------------------------------
PDHR_SALTY      -------------------------------
PDHR_SALTI      -------------------------------
PDHR_ECOLI      -------------------------------
PDHR_ECOL6      -------------------------------
PDHR_ECO57      -------------------------------
HUTC_PSEAE      -------------------------------
Y3073_RHOS4     -------------------------------
EXUR_SHIFL      -------------------------------
EXUR_ECOLI      -------------------------------
EXUR_ECO57      -------------------------------
ARAR_BACSU      -------------------------------
HUTC_PSEPU      -------------------------------
YISV_BACSU      -------------------------------
HUTC_KLEAE      -------------------------------
YDFD_BACSU      -------------------------------
EXUR_ERWCH      -------------------------------
PDXR_CORGL      -------------------------------
GABR_BACSU      -------------------------------
LUTR_BACSU      -------------------------------
MOCR_RHIME      -------------------------------
YTRA_BACSU      -------------------------------
Y505_MYCBO      -------------------------------
Y494_MYCTU      -------------------------------
KORA_STRLI      -------------------------------
YIHL_SHIFL      -------------------------------
YIHL_ECOLI      -------------------------------
YIHL_ECO57      -------------------------------
YHCF_BACSU      -------------------------------
YDEF_BACSU      -------------------------------
YDHC_BACSU      -------------------------------
Y6150_RHIME     -------------------------------
UXUR_ECOLI      -------------------------------
Y601_MYCBO      -------------------------------
Y586_MYCTU      -------------------------------
YIEP_ECOLI      -------------------------------