[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00338.1

[Show Plain Result]


## Summary of Sequence Search
    1::801
    1::801       0.0 100%  801 aa  PEPX_LACS1 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::807       0.0  52%  811 aa  PEPX_LACBA RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::810       0.0  51%  813 aa  PEPX_LACPL RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::805       0.0  47%  812 aa  PEPX_PEDPA RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::794       0.0  46%  797 aa  PEPX_LACRH RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::794     e-180  46%  797 aa  PEPX_LACCB RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::794     e-180  46%  797 aa  PEPX_LACC3 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::782     e-165  42%  793 aa  PEPX_LACH4 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::782     e-164  41%  793 aa  PEPX_LACHE RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-145  39%  758 aa  PEPX_STRMU RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::789     e-143  39%  792 aa  PEPX_LACDL RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-142  38%  761 aa  PEPX_STRS7 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::789     e-141  39%  792 aa  PEPX_LACDB RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::789     e-141  39%  792 aa  PEPX_LACDA RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-140  39%  760 aa  PEPX_STRPD RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-140  39%  760 aa  PEPX_STRP6 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-139  38%  761 aa  PEPX_STREM RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-139  39%  760 aa  PEPX_STRPF RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-139  38%  760 aa  PEPX_STRP8 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-139  37%  761 aa  PEPX_STRE4 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRPC RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRPB RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRP1 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRPM RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::755     e-138  39%  759 aa  PEPX_STRGN RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-138  38%  761 aa  PEPX_STRA5 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRPG RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-138  38%  761 aa  PEPX_STRA1 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-138  38%  761 aa  PEPX_STRA3 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-138  38%  760 aa  PEPX_STRP3 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-137  38%  760 aa  PEPX_STRPZ RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::783     e-137  38%  786 aa  PEPX_LACDE RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-137  39%  762 aa  PEPX_STRSV RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::755     e-137  39%  759 aa  PEPX_STRGC RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::757     e-137  37%  758 aa  PEPX_STRU0 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::758     e-136  38%  763 aa  PEPX_STRMC RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-135  39%  757 aa  PEPX_STRZP RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::754     e-135  38%  755 aa  PEPX_STRT1 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-135  39%  757 aa  PEPX_STRPJ RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-135  39%  757 aa  PEPX_STRPI RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::754     e-134  38%  755 aa  PEPX_STRT2 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::754     e-134  38%  755 aa  PEPX_STRTR RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::754     e-133  37%  755 aa  PEPX_STRTD RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRR6 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRP2 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRZT RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRZJ RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRPN RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRP7 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-133  38%  757 aa  PEPX_STRP4 RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::756     e-132  38%  757 aa  PEPX_STRPS RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-131  36%  763 aa  PEPX_LACLA RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-128  35%  763 aa  PEPX_LACLS RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-126  34%  763 aa  PEPX_LACLM RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
    1::759     e-126  34%  763 aa  PEPX_LACLC RecName: Full=Xaa-Pro dipeptidyl-peptidase;       
   44::560     1e-78  38%  580 aa  PEPX_BACCR RecName: Full=Putative Xaa-Pro dipeptidyl-peptidase;    
   61::577     2e-78  37%  597 aa  PEPX_BACAN RecName: Full=Putative Xaa-Pro dipeptidyl-peptidase;    
   44::615     4e-63  33%  626 aa  PEPX_RHOBA RecName: Full=Putative Xaa-Pro dipeptidyl-peptidase;    
   63::636     3e-41  28%  676 aa  PEPX_STRAW RecName: Full=Putative Xaa-Pro dipeptidyl-peptidase;    
  198::287     4e-04  34%  435 aa  RIMO_PETMO RecName: Full=Ribosomal protein S12
  111::160     8e-04  40%  185 aa  EFP_DECAR RecName: Full=Elongation factor P;         Short=EF-P;
  111::160     8e-04  38%  185 aa  EFP_AZOSE RecName: Full=Elongation factor P;         Short=EF-P;
    1::801

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
PEPX_LACS1      MKFNQFAHVKVPFEQKLAELNRIAFLHAGDEDLASNHIYRLFLERAFPNFKTEAAKNHALSNLAATENAD
PEPX_LACBA      MRNQQFAIRPTTLDQARVELQQIHFLDDTNLSFTTSDLLRDFYDRSWPEYTTSSVVAQQLSNLMATPETD
PEPX_LACPL      MKNNQFAIVPTDSETAIAELTKIHFITPDMDALTTPAVYQALLAKSLPEVHTASGLTHKFNNIMATSQHT
PEPX_PEDPA      MKNNQFGRIRLDRTTELEELKNIHFI---DADLLADPKAQLFLKRSCLVSNSEATFQQKLSNLLATPDQT
PEPX_LACRH      MKLNQFARLTPDIDQQLKELARIGL--PADPQXXXXXXXXXXXXXXXXXXYQPAAQQDKFAQVAVNSHQN
PEPX_LACCB      MKLNQFARLTPDFKVQVAELKQIG-LQADPDDAFSQSATDLF-NAFFPEAYTLAAKEDKLAQVAVNMDQT
PEPX_LACC3      MKLNQFARLTPDFKVQVAELKQIG-LQADPDDTFSQSTTDLF-NAFFPEAYTLAAKKDKLAQVAVNMDQT
PEPX_LACH4      MKYNQYAYVETDFQQQVKELIDINFLPKNYQVWDFSSLLAKLVKNAIAEAKTDAAKNAKLAEFAVSDHQT
PEPX_LACHE      MKYNQYAYVETDFQQQVKELIDINFLPKNYQVWDFSSLLAKLVKNAIAEAKTDAAKNAKLAEFAVSDHQT
PEPX_STRMU      MKYNQYSYIGTSVSQAEKELKELGFQISSQKTNKAN--LATFVSQVYFH---NPDKDDVFKSIIADSQTD
PEPX_LACDL      MKYNQYAYVETSPEKATEELLAINFLPENYSSLSFSELLAVLTGNVLAEATTRQAKDAKLAEFAVDDQTD
PEPX_STRS7      MRYNQLSYIPTSLETAVAELQALGF--AVQQEQAPKESFAIFLRKLFFHFQDT---DYPLSHMIATKELD
PEPX_LACDB      MKYNQYAYVETSPEKATEELLAINFLPENYSSLSFSELLAVLTGNVLAEATTRQAKDAKLAEFAVDDQTD
PEPX_LACDA      MKYNQYAYVETSPEKATEELLAINFLPENYSSLSFSELLAVLTGNVLAEATTRQAKDAKLAEFAVDDQTD
PEPX_STRPD      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRP6      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STREM      MRYNQLSYIPTSLETAVAELQALGF--AVQQEQAPKESFAIFLRKLFFHFQDT---DYPLSHMIATKELD
PEPX_STRPF      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRP8      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRE4      MRYNQLSYIPTSLETAVAELQALGF--AVQQEQAPKENFAIFLRKLFFHFQDT---DYPLSHMIASKDLD
PEPX_STRPC      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRPB      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRP1      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKASLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRPM      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKIFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRGN      MRYNQYSYTKASEEVMLDELARLGFTIQTTNSPKENLHH--FLQKILFRYQDV---NYVLSSWVADQKTD
PEPX_STRA5      MRYNQFSYIPTKPNEAFEELKGLGFLNKKNSDKAN---LEAFLRHSFLN---QTDTDYALSLLIVDAKTD
PEPX_STRPG      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKVNLFLRKLFFHYPDS---DYPLSHLITKNDMD
PEPX_STRA1      MRYNQFSYIPTKPNEAFEELKGLGFLNKKNSDKAN---LEAFLRHSFLN---QTDTDYALSLLIVDAKTD
PEPX_STRA3      MRYNQFSYIPTKPNEAFEELKGLGFLNKKNSDKAN---LEAFLRHSFLN---QTDTDYALSLLIVDAKTD
PEPX_STRP3      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDS---DYPLSHLIAKNDMD
PEPX_STRPZ      MRYNQFSYIPTSLERAAEELKELGF----DLDLQKTAKANLFLRKLFFHYPDSV---YPLSHLIAKNDMD
PEPX_LACDE      ------AYVETSPEKATEELLAINFLPENYSSLSFSELLAVLTGNVLAEATTRQAKDAKLAEFAVDDQTD
PEPX_STRSV      MRFNQYSYAKTKRENMLIELAELGFFY--DSNRSDKENLEDFLRTSFFTYKNT---DYPLKSWAADSQTD
PEPX_STRGC      MRYNQYSYTKASEEVMLDELARLGFTIQTTNSPKENLHH--FLQKILFRYQDV---NYVLSSWVADQKTD
PEPX_STRU0      MRYNQFSYIKTDGQVAKKELENLGFHFPISNK--PKEIFRSFLNTYF--FQS-SDKDYQIASFIADFETD
PEPX_STRMC      MKYNQFSFIPRPIAIAEQELQALGFDITHQQ--ADKKALENFCRKIFFNYKDT---DYPLHQLIADFETD
PEPX_STRZP      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRT1      MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKAN--FESFVRKYFLFFEDT---DLALKNWIADPETD
PEPX_STRPJ      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRPI      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRT2      MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKAN--FESFVRKYFLFFEDT---DLALKNWIADPETD
PEPX_STRTR      MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKAN--FESFVRKYFLFFEDT---DLALKNWIADPETD
PEPX_STRTD      MKFNQFSYIPVSPETAYQELRSLGFEVSLDASAKAN--FESFVRKYFLFFEDT---DLALKNWIADPETD
PEPX_STRR6      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRP2      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRZT      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRZJ      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRPN      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRP7      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRP4      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_STRPS      MRFNQYSYINFPKENVLSELKKCGF----DLQNTANHKDSLFLRRFFFTYQDT---NYPLSILAADKKTD
PEPX_LACLA      MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWD--EKKILKDFLIQSPTD----------MTVLQANTELD
PEPX_LACLS      MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWDE----------KKILKDFLIQSPSD--MTDLQATAELD
PEPX_LACLM      MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWDE----------KKILKDFLIQSPSD--MTALQATAELD
PEPX_LACLC      MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWDE----------KKILKDFLIQSPSD--MTALQATAELD
PEPX_BACCR      ----------------------------------------------------------------------
PEPX_BACAN      ----------------------------------------------------------------------
PEPX_RHOBA      ----------------------------------------------------------------------
PEPX_STRAW      ----------------------------------------------------------------------
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
PEPX_LACS1      ILTYLNSSKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEIHHRDDVINAWYDLLCTSTK
PEPX_LACBA      GLTYLTTEQVPVDVFYNLALQRLGFAVDLDFQLTDPLAAMTKIQLPHEGTTFTLNELMNAWYVLLTTHNK
PEPX_LACPL      LSEWLDATIVNNQVFYNVGLQLLGFLPGQDFELADPLLAMRDIHLPMVGDAFDREALYYAWYLLLNTRGN
PEPX_PEDPA      MAAFFESDQLTXXXXXXXXXXXXXXEADTDYQIEDPLSAISKIQLPELKNFETSADVAHAWYNLLTTHTK
PEPX_LACRH      LAEWLATKPTHMKRFYNVALQLLGFEAFSDFDLSDPISFMTVTKLPVAHDLLHTADLLQASYLLLTTRTK
PEPX_LACCB      LAAWLKPSKMTRRDFYNVALQLLGFEAFTDFDLNDPFKMMTATKLPLDHDLTSTADLLKAVYLLLNTRTK
PEPX_LACC3      LAAWLKPSKMTRRDFYNVALQLLGFEAFTDFDLNDPFKMMTATKLPLDHDLTSTADLLKAVYLLLNTRTK
PEPX_LACH4      LADFLKETEIGTEQFYNVALQLLGYHVHYDYDFADPTGFMQRNALPFVQDISDNQKLISAFYRLLNTRAK
PEPX_LACHE      LADFLKETEIGTKQFYNVALQLLGYHVHYDYDFADPTGFMQRNALPFLQDISDNQKLISAFYRLLNTRAK
PEPX_STRMU      LATFLHSDRLTEEIFYTIALQLLEFTPYIDFDEAKTFIKHSHFPIIFQPK-----HFLLNFYQLLGTRTK
PEPX_LACDL      LAAFLTPTAITASQFANVALQLLGYHPNYDYSLTDPLTCGKKHALPAFKDLTSKEELIFTFYRLLNTRSK
PEPX_STRS7      LLSFLASDELTKEVFDLVALQVLGFIPAVDFTDTQDF--IQKIGFPI---VFDSXXXXXXXXXXXATRQK
PEPX_LACDB      LAAFLTPTAITASQFANVALQLLGYHPNYDYSLTDPLTCGEKHALPAFKDLTSKEELIFAFYRLLNTRSK
PEPX_LACDA      LAAFLTPTAITASQFANVALQLLGYHPNYDYSLTDPLTCGEKHALPAFKDLTSKEELIFAFYRLLNTRSK
PEPX_STRPD      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRP6      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STREM      LLSFLASDELTKEVFDLVALQVLGFIPAVDFTDTQDF--IQKIGFPI---VFDSXXXXXXXXXXXATRQK
PEPX_STRPF      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRP8      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRE4      LLTFLTSATLTKEVFDLVALQVLGFIPAVDFTDAQDF--IQKIGFPI---VFDSXXXXXXXXXXXATRQK
PEPX_STRPC      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRPB      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRP1      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRPM      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRGN      LLTFFQSDKLTEEVFYTVALQVLGFAPFVDFDDVTAFC----------KEIHFPGNILENLYQLLNTRTK
PEPX_STRA5      ALTFFKSSDLTLENLQWIYLQLLGFIPFVDF--KDPKAFLQDINFPVSY-----DNIFQSLHHLLACRGK
PEPX_STRPG      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHILATRCK
PEPX_STRA1      ALTFFKSSDLTLENLQWIYLQLLGFVPFVDF--KDPKAFLQDINFPVSY-----DNIFQSLHHLLACRGK
PEPX_STRA3      ALTFFKSSDLTLENLQWIYLQLLGFVPFVDF--KDPKAFLQDINFPVSY-----DNIFQSLHHLLACRGK
PEPX_STRP3      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_STRPZ      ALSFFQSEQLSKEVFDLLALQVLGFIPGVDFTEADAF--LDKLAFP----IHFDEEIIKHIHHLLATRCK
PEPX_LACDE      LAAFLTPTAITASQFANVALQLLGYHPNYDYSLTDPLTCGEKHALPAFKDLTSKEELIFAFYRLLNTRSK
PEPX_STRSV      LLSFFQSDRLTASVFYTVAFQLLEFSPFIDFTDVEAFRQETDFPITF-------GDLLENLYQLLNTRTK
PEPX_STRGC      LLTFFQSDKLTEEVFYTVALQVLGFAPFVDFDDVTAFC----------KEIHFPGNILENLYQLLNTRTK
PEPX_STRU0      LLSFFNADKLTKEIFDMVSLQLLGFIPGFDFENLKEFTSQIAFPVPFNE-----NDLFASIHHLLGTRHK
PEPX_STRMC      LLTFFNSERLTADIFYTISLQLLGFIPHVDFTNTTDF--LEKIAFPINYQKGH---ILEALYHLLVSRQK
PEPX_STRZP      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRT1      LLSFFQSDRLTAEVFGLVALQLLGFVPNVDFT--DSVAFLEKMAFPIAF-----DGSLNNLHQLLATRTQ
PEPX_STRPJ      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRPI      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRT2      LLSFFQSDRLTAEVFGLVALQLLGFVPNVDFT--DSVAFLEKMAFPIAF-----DGSLNNLHQLLATRTQ
PEPX_STRTR      LLSFFQSDRLTAEVFGLVALQLLGFVPNVDFT--DSVAFLEKMAFPIAF-----DGSLNNLHQLLATRTQ
PEPX_STRTD      LLSFFQSDRLTAEVFGLVALQLLGFVPNVDFT--DSVAFLEKMAFPIAF-----DGSLNNLHQLLATRTQ
PEPX_STRR6      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRP2      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRZT      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRZJ      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRPN      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRP7      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRP4      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_STRPS      LLTFFQSEELTADIFYTVAFQLLGFSYLVDFEDSDVFRKETGFPIIY-------GDLIENLYQLLNTRTK
PEPX_LACLA      VIEFLKSSELDWEIFWNITLQLLDFVPNFDFEIGKATEFAKKLNLPQRDVEMTTETIISAFYYLLCSRRK
PEPX_LACLS      VIEFLKSSELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRK
PEPX_LACLM      VIEFLKSSELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRK
PEPX_LACLC      VIEFLKSSELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRK
PEPX_BACCR      ----------------------------------------------------------------------
PEPX_BACAN      ----------------------------------------------------------------------
PEPX_RHOBA      ----------------------------------------------------------------------
PEPX_STRAW      ----------------------------------------------------------------------
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGQNLLDILANRGYFTQFYQLNLTEPIFFNGKAQPVFDTNKLIHEVVYVESELDTDQDGKRDLLKVIITR
PEPX_LACS1      KGQNLLDILANRGYFTQFYQLNLTEPIFFNGKAQPVFDTNKLIHEVVYVESELDTDQDGKRDLLKVIITR
PEPX_LACBA      TGQTFLDQLTTHGYFAPLIHDNVPKPLIFNGKAQAVFDTTQLIHEVVYVESPQDTDHDGHRDLLKAEIIR
PEPX_LACPL      NGQTLIESLTTRGYFVPFYQLNDQKPLFFNGKAQAVFDTNALIRDVVYVEAPLDTDHDGQRDLLKVEILR
PEPX_PEDPA      NGEVYLDRLTQQGYFVSFYPTT-TKPLFFNGKAQAVFDPHQLIREVVYVEAPLDTDHDGQRDLLKAEILR
PEPX_LACRH      HLVSFLDDLANRGFFKDF-QAQSSQPLLFNGKVQQVFDARQAVREVVWIESDVDSDHDGQRDLLEATIYR
PEPX_LACCB      HLVSYLDDLANRGFLKDF-QKKQKKPLLFNGKVQQVFDARQAVREVVWIESDMDTDHDGQRDLLEATIYR
PEPX_LACC3      HLVSYLDDLANRGFLKDF-QKKQKKPLLFNGKVQQVFDARQAVREVVWIESDMDTDHDGQRDLLEATIYR
PEPX_LACH4      NGQILLDVMAGKGYFTQFWGQNKFK--FFNGKSIPVFDTNKVIREVVYVETDLDTDHDGKSDLIQVTVFR
PEPX_LACHE      NGQILLDVMAGKGYFTQFWGQNKFK--FFNGKSIPVFDTNKVIREVVYVETDLDTDHDGKSDLIQVTVFR
PEPX_STRMU      NGMTLIDKLVSQGFLPADNHYR-----YFNGKSLATFDTNALIREIVYVEAPLDTDKDGQLDLIKVNIIR
PEPX_LACDL      NGQILLDVMAGKGYFTQFWGEG--KFMFFNGKSLPVFDTSQVIREVVYVQSXXXXXXXXXXXXXPVTVFR
PEPX_STRS7      SGVTLIDSLVSQGLLPMDNCYH-----YFNGKALATFDTTSLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_LACDB      NGQILLDVMAGKGYFTQFWGEG--KFMLFNGKSLPVFDTSQVIREVVYVQSXXXXXXXXXXXXXPVTIFR
PEPX_LACDA      NGQILLDVMAGKGYFTQFWGEG--KFMLFNGKSLPVFDTSQVIREVVYVQSXXXXXXXXXXXXXPVTVFR
PEPX_STRPD      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRP6      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STREM      SGVTLIDSLVSQGLLPMDNCYH-----YFNGKALATFDTTSLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRPF      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRP8      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRE4      SGVTLIDSLVSQGLLPMDNCYH-----YFNGKALATFDTTSLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRPC      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRPB      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRP1      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRPM      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQFDLIKVNIIR
PEPX_STRGN      LGNTLIDQLVSEGFIPESNDYH-----FFNGKSLATFSSHEAIREVVYVESRVDTDGDGKPDLVKVSIIR
PEPX_STRA5      SGNTLIDQLVADGLLHADNHYH-----FFNGKSLATFNTNQLIREVVYVETSLDTMSSGEHDLVKVNIIR
PEPX_STRPG      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRA1      SGNTLIDQLVADGLLHADNHYH-----FFNGKSLATFNTNQLIREVVYVETSLDTMSSGEHDLVKVNIIR
PEPX_STRA3      SGNTLIDQLVADGLLHADNHYH-----FFNGKSLATFNTNQLIREVVYVEISLDTMSSGEHDLVKVNIIR
PEPX_STRP3      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_STRPZ      SGMTLIDDLVSQGMLTMDNDYH-----FFNGKSLATFDTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIR
PEPX_LACDE      NGQILLDVMAGKGYFTQFWGEG--KFMLFNGKSLPVFDTSQVIREVVYVQSXXXXXXXXXXXXXPVTVFR
PEPX_STRSV      NGNLLIDKLVSEGLIPEDNTHHC-----FNGKSLATFSSHDAIREVVYVESRVDTDQDGRPDLIKVSIIR
PEPX_STRGC      LGNTLIDQLVSEGFIPESNDYH-----FFNGKSLATFSSHEAIREVVYVESRVDTDGDGKPDLVKVSIIR
PEPX_STRU0      NGMLLIDDLISKGFLGPDNTYH-----FFNGKTLATFDTSQLIKEVVYVEAPIDSDNDGKSDLIKVMILR
PEPX_STRMC      SGMTLLDDLISKGLIPVDNNYH-----FFNGKSLATFDTTDLIREVVYVQSPLDTDQDGQLDLIKVNIIR
PEPX_STRZP      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRT1      SGNTLIDQLVAQDLIPIS-----NDYVFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILR
PEPX_STRPJ      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRPI      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRT2      SGNTLIDQLVAQDLIPIS-----NDYVFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILR
PEPX_STRTR      SGNTLIDQLVAQDLIPIS-----NDYVFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILR
PEPX_STRTD      SGNTLIDQLVAQDLIPIS-----NDYVFFNGKSLATFDTNQLHREVVYVETPVDTDKDGLLDLVKVTILR
PEPX_STRR6      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRP2      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRZT      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRZJ      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRPN      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRP7      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRP4      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_STRPS      KGNTLIDQLVSDGLIPEDNDYH-----YFNGKSLATFSNQDVIREVVYVESRVDTDQKGLSDLVKVSIIR
PEPX_LACLA      SGMILVEHWVSEGLLPLDNHYH-----FFNDKSLATFDSSLLEREVVWVESPVDTEQKGKNDLIKIQIIR
PEPX_LACLS      NGMILVEHWVSEGLLPLDNHYH-----FFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIR
PEPX_LACLM      TGMILVEHWVSEGLLPLDNHYH-----FFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIR
PEPX_LACLC      TGMILVEHWVSEGLLPLDNHYH-----FFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIR
PEPX_BACCR      ------------------------------GMTKPIYSLDEAIDENLYVETEVDSDQDGKKDRVSIKVMR
PEPX_BACAN      -----------------------------NGMTKPIYSLDEAIIENLFVETEVDSDRDGKKDRVSVKVMR
PEPX_RHOBA      -------------------------PVIKDGEAQVIKDSDYWIRHDLWVETEFDLDGDGKLDRMHVSVTR
PEPX_STRAW      -------------------------------ESAPVYSYENAIRESVWVDTRLDGDGDGKTDRVAVDVVR
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ------------------------EVVFYNGKAISVELPNSVVREVVYTEPAVKGDTSGK-------VMK
EFP_AZOSE       ------------------------EVVFYNGKAISVDLPNSVVREVIYTEPAVKGDTSGK-------VMK


                         .         .         .         +         .         .         .:280
query           PAMTDNGMKVPTIFTASPYYLGTNDASAEKMMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
PEPX_LACS1      PAMTDNGMKVPTIFTASPYYLGTNDASAEKMMHSVDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
PEPX_LACBA      PAETANGLKVPVLYTASPYNQGTNDEAGEALTHNVNVPLTAKQPAATTLADVTAESVTTPLPDARPVXXX
PEPX_LACPL      PAETETGLKVPVLYTASPYNQGINDQAGDAQMHNVDVPLTAKEPDENTYADVEFQPXXXXXXXXXXXXXX
PEPX_PEDPA      PAQTAHGYQAPVLYTASPYNQGTNDSYGEAITHNVDVPLTEKAVQKISKSDVTAEPFSQTLPAERKVAGM
PEPX_LACRH      PKATDRGLKVPVLFTANPYFHGTNDVTA-----ATHVPETVLAVKPHGASKAEVTAAPASKPKARPVTGE
PEPX_LACCB      PKATDQGLKVPVLFTANPYFHGTNDVTAVTHVPETTLAV---KTHGASKAEVTANPEEPANLPHHPVNGE
PEPX_LACC3      PKATDQGLKVPVLFTANPYFHGTNDVTAVTHVPETTLAV---KTHGASKAEVTANPEEPANLPHHPVNGE
PEPX_LACH4      PEETNKGLKVPALYTASPYFGGI--IANEKRNHNVDENLSDST----EWNDPQYHSPIVKAEKPDG---S
PEPX_LACHE      PEETNKGLKVPALYTASPYFGGI--IANEKRNHNVDENLSDST----EWNDPQYHSPIVKAEKPDG---S
PEPX_STRMU      P---QTKAKLPVVMTASPYHQGTNDKGADKKLHQMEGELTVKKAATITVTDSHFQAPSSNLP--------
PEPX_LACDL      PVESQDQLKVPALYTASPYFGGIIDNV--KTNHNVDENLT----DATTWTNPKYAKPLVKSPAPSDQDVP
PEPX_STRS7      PKAST---AIPSMMTASPYHQGINETANDKKLHRMEGELSPKAPRRITVEPTDFQPLATK-PSRLPV---
PEPX_LACDB      PVESQDQLKVPALYTASPYFGGIIDNV--KTNHNVDENLT----DATTWTNPKYAKPLVKSPAPSGQDVP
PEPX_LACDA      PVESQDQLKVPALYTASPYFGGIIDNV--KTNHNVDENLT----DATTWTNPKYAKPLVKSPAPSGQDVP
PEPX_STRPD      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRP6      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STREM      PKAST---AIPSMMTASPYHQGINETANDKKLHRMEGELSPKAPRRITVEPTDFQPLATK-PSRLPV---
PEPX_STRPF      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRP8      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRE4      PKAST---AIPSMMTASPYHQGINETANDKKLHRMEGELSPKAPRRITVEPTDFQPLATK-PSRLPV---
PEPX_STRPC      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRPB      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRP1      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRPM      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRGN      PSYEG---QVPAVMTASPYHQGTNDKASDKALHNMNVDLSCKNPRTITVQESSIQTIE---PQGQASLV-
PEPX_STRA5      PTTEHT---IPTMMTASPYHQGINDPAADQKTYQMEGALAVKQPKHIQV-DTKPFKEEVKHPSKLPISPA
PEPX_STRPG      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRA1      PTTEHT---IPTMMTASPYHQGINDPAADQKTYQMEGALAVKQPKHIQV-DTKPFKEEVKHPSKLPISPA
PEPX_STRA3      PTTEHT---IPTMMTASPYHQGINDPAADQKTYQMEGALAVKQPKHIQV-DTKPFKEEVKHPSKLPISPA
PEPX_STRP3      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_STRPZ      P---QSQKPLPTLMTPSPYHQGINEVANDKKLYRMEKELVVKKRRQITVEDRDFIPLETQ-PCKLPIGQN
PEPX_LACDE      PVESQDQLKVPALYTASPYFGGIIDNV--KTNHNVDENLT----DATTWTNPKYAKPLVKSPAPSGQDVP
PEPX_STRSV      PRYQG---PVPAVMTASPYHQGTNDPASDKALHDMNVDLAKKEPHQITVQDPELKLLQLDSPVPAQEVSE
PEPX_STRGC      PSYEG---QVPAVMTASPYHQGTNDKASDKALHNMNVDLSCKNPRTITVQESSIQTIE---PQGQASLV-
PEPX_STRU0      PR---SQKQIPTVMTASPYHQGINEVANDKKLHSMQTDLPLKEAHKIHVADASI----STLVCENADLPI
PEPX_STRMC      PKTSH---QLPTMMTASPYHQGTNVVANDKKLYKMEGDLAVKPARTINVETRDFEPPDVDLP--------
PEPX_STRZP      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGQAEL
PEPX_STRT1      PNVD---FPVPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEADLTPINPVT--
PEPX_STRPJ      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEVEL---EVK-LPHK-IELEEPQLNLVQPQGQAEL
PEPX_STRPI      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKME-----GELKVKLPHKIELEKPQLNLVQPQGQAEL
PEPX_STRT2      PNVD---FPVPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEADLTPINPVT--
PEPX_STRTR      PNVD---FPVPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEADLTPINPVT--
PEPX_STRTD      PNVD---FPVPAMMTASPYQQGTNEPSSDKLTHKMEGDLLVKPAGKISLSRPEIKAPEADLTPINPVT--
PEPX_STRR6      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRP2      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRZT      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRZJ      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRPN      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRP7      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRP4      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_STRPS      PRFDG---KIPAIMTASPYHQGTNDKASDKALYKMEGEL---EVK-LPHK-IELEKPQLNLVQPQGXXXX
PEPX_LACLA      PKSTE---KLPVVITASPYHLGINEKANDLALHEMNVDLEKKDSHKIHVQG--------KLPQKRPSETK
PEPX_LACLS      PKSTE---KLPVVMTASPYHLGINDKANDLALHDMNVELEEKASHEIH---VEQKLPQKLSAKAKELPIV
PEPX_LACLM      PKSTE---KLPVVMTASPYHLGINDKANDLALHDMNVELEEKTSHEIH---VEQKLPQKLSAKAKELPIV
PEPX_LACLC      PKSTE---KLPVVMTASPYHLGINDKANDLALHDMNVELEEKTSHEIH---VEQKLPQKLSAKAKELPIV
PEPX_BACCR      PK-TDPNVKVPVIYEMSPYRSGLKDVP----VYNVDEELYAYEGKPYGAINLG-----------------
PEPX_BACAN      PK-TDSNVKVPVIYEMSPYRAGLKDVP----VYNVDEELYAYEGKPYGAVNLG-----------------
PEPX_RHOBA      PTQTDTSLKLPVIYNSSPYFAGTTGGDEDARQELGDEPPKRSAA------------PAIEREGTRPII--
PEPX_STRAW      PRLARQGRKIPVIMDASPYYCGRGNES-QKKTYDANGDVVRM---PLFY---------------------
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       PAKLATGFELP-----------------------------------------------------------
EFP_AZOSE       PAKIASGFELP-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
PEPX_LACS1      TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
PEPX_LACBA      XXXXXXXXXREQSYTLNDYFLARGFAVVYAAGIGTKDSDGLRTTGDPEETTSTIAIIEWLAGNRTAFTTR
PEPX_LACPL      XXXXXXXFSREKSYTLNDYFLARGFAVVYAAGIGSIDSDGLAPTGDVDETTSTVAIIEWLTGKRQAFTNR
PEPX_PEDPA      ATKASETFAREQPYTLNNYFLSRGFAVVYAAGIGTRDSDGLRDTGSVEETISTTAIIEWLAGNRRAFTNK
PEPX_LACRH      TKQAAAYAEENSPYAFNDYFLARGFAVVYSAGVGTRYSDGFRTIGGPEETDGAVAVIEWLTGKRRAFTNR
PEPX_LACCB      ATQAEAYAEENSMYAFNDYFLARGFAVVYSAGVGTRYSDGFRTTGGPEETDGAVAVIEWLTGKRRAFTNR
PEPX_LACC3      ATQAEAYAEENGMYAFNDYFLARGFAVVYSAGVGTRYSDGFRTTGGPEETDGAVAVIEWLTGKRRAFTNR
PEPX_LACH4      SRPATEEAVHKSSYPLNEYMLARGFASVFAGAIGTRGSDGVRITGAPEETESAAAVIEWLHGDRVAYTDR
PEPX_LACHE      SRPATEEAVHKSSYPLNEYMLARGFASVFAGAIGTRGSDGVRITGAPEETESAAAVIEWLHGDRVAYTDR
PEPX_STRMU      ISPAQESFSYIDSYTLNDYFLARGFANIYVSGVGTKDSDGFMTSGDYAQIESFKAVIDWLNGRTTAYTSH
PEPX_LACDL      ---ATELATGQSSYGLNEYLLARGFASVFSGAIGNRHGDGIRITGSPEETISQKEVIEWLTGDRVAYTDR
PEPX_STRS7      -NECQETFSHISSYTLNDYFLARGFANLYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_LACDB      ---ATELATGQSSYGLNEYLLARGFASVFSGAIGNRHGDGIRITGSPEETISQKEVIEWLTGDRVAYTDR
PEPX_LACDA      ---ATELATGQSSYGLNEYLLARGFASVFSGAIGNRHGDGIRITGSPEETISQKEVIEWLTGDRVAYTDR
PEPX_STRPD      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRP6      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STREM      -NECQETFSHISSYTLNDYFLARGFANLYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRPF      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRP8      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNRRATAYTSH
PEPX_STRE4      -NECQETFSHISSYTLNDYFLARGFANLYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRPC      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRPB      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRP1      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGNYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRPM      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRGN      -EKAEEKLGHIGSYTLNDYLLPRGFANLYVSGVGTKDSEGMMTSGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRA5      T----ESFTHIDSYSLNDYFLSRGFANIYVSGVGTAGSTGFMTSGDYQQIQSFKAVIDWLNGKVTAFTSH
PEPX_STRPG      L----EIFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRA1      T----ESFTHIDSYSLNDYFLSRGFANIYVSGVGTAGSTGFMTSGDYQQIQSFKAVIDWLNGKVTAFTSH
PEPX_STRA3      T----ESFTHIDSYSLNDYFLSRGFANIYVSGVGTAGSTGFMTSGDYQQIQSFKAVIDWLNGKVTAFTSH
PEPX_STRP3      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_STRPZ      L----ESFSYINSYSLNDYFLARGFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSH
PEPX_LACDE      ---ATELATGQSSYGLNEYLLARGFASVFSGAIGNRHGDGIRITGSPEETISQKEVIEWLTGDRVAYTDR
PEPX_STRSV      T---EEKLGHIGTYTLNDYLLPRGFANLYVSGVGTKDSEGLMTSGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRGC      -EKAEEKLGHIGSYTLNDYLLPRGFANLYVSGVGTKDSEGMMTSGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRU0      TENTEQ-FSYIDSYTLNDYFLSRGFANIYVSGVGTADSDGFMTSGDYVQIESFKAIIDWLNGRAKAFTSH
PEPX_STRMC      IGESEERFNFIDPYTLNDYFLARGFANIYVSGVGTAGSDGFMTSGDYAQVESFKAVIDWLNGKSIAFSSH
PEPX_STRZP      IAEAEEKLTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRT1      --KAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMTSGDYQQVLAYKAVIDWLNGRARAFTSR
PEPX_STRPJ      VAEAEEKLTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRPI      IAEAEEKLTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRT2      --KAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMTSGDYQQVLAYKAVIDWLNGRARAFTSR
PEPX_STRTR      --KAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMTSGDYQQVLAYKAVIDWLNGRARAFTSR
PEPX_STRTD      --KAEERFAHTDTYTLNDYMLARGVASIYVSGVGTFNSEGFMTSGDYQQVLAYKAVIDWLNGRARAFTSR
PEPX_STRR6      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRP2      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRZT      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRZJ      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRPN      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRP7      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRP4      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_STRPS      XXXXXXXXTHISSYTLNDYFLPRGFANLYVSGVGTKDSTGFMTNGDYQQIEAYKNVIDWLNGRCRAFTDH
PEPX_LACLA      VDKAPYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRGSNGFQTSGDYQQIYSMTAVIDWLNGRTRAYTSR
PEPX_LACLS      DK-APYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSR
PEPX_LACLM      DK-APYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSR
PEPX_LACLC      DK-APYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSR
PEPX_BACCR      --------------SYGNYYVPRGYAVILGESIGTGKSDGCPTTGDEQEILGTKSVIDWVNGRAKAFT--
PEPX_BACAN      --------------SYGNYYVPRGYAVILGESIGTGKSEGCPTTGDEQEILGTKSVIDWVNGRAKAY--K
PEPX_RHOBA      SKRHVKDW------------LPRGFVVVHSSAPGTGLSQGCPTVGDDPEALAPKAVIDWLCGRAKGFTEP
PEPX_STRAW      ----------------DNYFVPRGYAFVGVDLAGTNRSDGCVDVGGRSDIQSAKAVIDWLNGRAHGYTSR
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANKAIPAWWSNGKVAMTGKSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYREGGLVIAPGGFPGED
PEPX_LACS1      EANKAIPAWWSNGKVAMTGKSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYREGGLVIAPGGFPGED
PEPX_LACBA      NATQAIPAWWSNHQVAMTGRSYXXXXXXXXXXXXXXXXXXXISEAAISNWYDYYRDGGLVVAPGGFPGED
PEPX_LACPL      DGNIAIKAWWCNGAVAMTGRSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYRDNGLVVAPDTFQGED
PEPX_PEDPA      TDNLEIKASWSNHKIAMTGRSYXXXXXXXXXXXXVEGLETIISEAAISSWYDYYRDGGLVAAPDTFQGED
PEPX_LACRH      TDGVAIKAWWSSGKVAMTGKSYXXXXXXXXXXXXVEGLKTIVADAGISSWYDYYRENGLVVAPGGYQGED
PEPX_LACCB      TDGITIKAWWSTGLVAMTGKSYXXXXXXXXXXXGVDGLKTIVADAGISSWYDYYRENGLVVAPGGFQGED
PEPX_LACC3      TDGITIKAWWSTGLVAMTGKSYXXXXXXXXXXXGVDGLKTIVADAGISSWYDYYRENGLVVAPGGFQGED
PEPX_LACH4      TRTVQTTADWCNGNIGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVIAPEACQGED
PEPX_LACHE      TRTVQTTADWCNGNIGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVIAPEACQGED
PEPX_STRMU      KRDKRVMADWTNGLVATTGKSYLGTMSTGLATTGIKELKVIIAESAISSWYDYYRENGLVCSPGGYPGED
PEPX_LACDL      TRRFETKASWCSGNVGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVVAPSECQGED
PEPX_STRS7      KRDYQIKADWSNGLVATTGKSYLGTMSTGLATTGVDGLAVIIAEAAISSWYDYYRENGLVCSPGGYPGED
PEPX_LACDB      TRRFETKASWCSGNVGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVIAPSECQGED
PEPX_LACDA      TRRFETKAGWCSGNVGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVIAPSECQGED
PEPX_STRPD      SKNHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRP6      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STREM      KRDYQIKADWSNGLVATTGKSYLGTMSTGLATTGVDGLAVIIAEAAISSWYDYYRENGLVCSPGGYPGED
PEPX_STRPF      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRP8      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRE4      KRDYQIKADWSNGLVATTGKSYLGTMSTGLATTGVDGLAVIIAEAAISSWYDYYRENGLVCSPGGYPGED
PEPX_STRPC      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRPB      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRP1      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRPM      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRGN      TRQREIKATWSNGKVATTGISYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRA5      KRDKQVKANWSNGLVATTGKSYLGTMSTGLATTGVEGLKVIIAEAAISTWYDYYRENGLVCSPGGYPGED
PEPX_STRPG      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRA1      KRDKQVKADWSNGLVATTGKSYLGTMSTGLATTGVEGLKVIIAEAAISTWYDYYRENGLVCSPGGYPGED
PEPX_STRA3      KRDKQVKADWSNGLVATTGKSYLGTMSTGLATTGVEGLKVIIAEAAISTWYDYYRENGLVCSPGGYPGED
PEPX_STRP3      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_STRPZ      SKTHQVRADWANGLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGED
PEPX_LACDE      TRRFETKASWCSGNVGMTGRSYLGTLQIAIATTGVKGLKTVVSEAAISSWYDYYREHGLVIAPSECQGED
PEPX_STRSV      TRQREIKATWSNGKVATTGISYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRGC      TRQREIKATWSNGKVATTGISYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRU0      KREAYVLANWSNGKVATTGKSYLGTMSNGLATTGVEGLEVIIAEAAISSWYDYYRENGLICSPGGYPGED
PEPX_STRMC      RRDQKVVADWASGLVCTTGKSYLGTMSTALATTGVEGLKVIIAESAISSWYDYYRENGLVCSPGGYPGED
PEPX_STRZP      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRT1      SRQHTITADWASGKVTTTGLSYLGTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGED
PEPX_STRPJ      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRPI      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRT2      SRQHTITADWASGKVTTTGLSYLGTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGED
PEPX_STRTR      SRQHTITADWASGKVTTTGLSYLGTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGED
PEPX_STRTD      SRQHTITADWASGKVTTTGLSYLGTMSNALATTGVDGLEMVIAEAGISSWYDYYRENGLLVSPGGYPGED
PEPX_STRR6      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRP2      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRZT      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRZJ      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRPN      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRP7      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRP4      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_STRPS      TRQRQVKADWSNGKVATTGLSYLGTMSNGLATTGVDGLEVIIAEAGISSWYNYYRENGLVTSPGGYPGED
PEPX_LACLA      KKTHEIKATWANGKVAMTGKSYLGTMAYGAATTGVDGLEVILAEAGISSWYNYYRENGLVRSPGGFPGED
PEPX_LACLS      KKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLEVILAEAGISSWYNYYRENGLVRSPGGFPGED
PEPX_LACLM      KKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENGLVRSPGGFPGED
PEPX_LACLC      KKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLELILAEAGISSWYNYYRENGLVRSPGGFPGED
PEPX_BACCR      EQGEEVQANWSTGNVGMTGVSYNGTLPNAVATTGVEGLKTIIPIAAISSWYDYYRANGAVIAPGGYQGED
PEPX_BACAN      ENGEEVKADWSTGNVGMTGVSYNGTLPNAVATTGVEGLKTIIPIAAISSWYDYYRANGAVIAPGGYQGED
PEPX_RHOBA      FGGEPVEAYWSSGKVGMTGTSYNGTIPLAAATTGVEGLEVIIPVAPNTSYYHYYRSNGLVRHPGGYLGED
PEPX_STRAW      TGTARAKATWTNGRTGMIGKSWDGTVANGVAATGVKGLKTIVPISAISSWYDYYFAKGAPLYDSG-----
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
PEPX_LACS1      ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
PEPX_LACBA      ADVLAEETFSRQLLAGDYHRIQEKWQHQLAAITQNQDRVTGNYNRFWDARNYLKNAKNIKADLLLVHGLN
PEPX_LACPL      TDVLAAEVFSRSLKAGDAHQIQPAFDQKLAELTADQDRASGNYNRFWDERNYLKNVDKIKADIIMVHGLN
PEPX_PEDPA      MDVLAAEVLSRKHDAGDYLGIKAHFDQILKRIEKDQDRDSGNYSKYWDSKNYLNNVKNIKADIIMVHGLN
PEPX_LACRH      ADVLAVDTFSRQKSGGDMIRLKKAWEQHLAQMTRDQDRTTGAYTAWWDARNYRKNAANVKADVVLIHGLN
PEPX_LACCB      ADVLAVDTFSRQKSGGDLINIKQAWEKHLATITHDQDRTTGAYNTWWDARNYRKNANKVKADVVLIHGLN
PEPX_LACC3      ADVLAVDTFSRQKSGGDLINIKQAWEKHLATITHDQDRTTGAYNTWWDARNYRKNANKVKADVVLIHGLN
PEPX_LACH4      LDLLAETCQSNLWDAGSYLKIKPEYDKMQKQLREKEDRNTGQYSDFWEARNYRHHADGIKCSWISVHGLN
PEPX_LACHE      LDLLAETCQSNLWDAGSYLKIKPEYDKMQKQLREKEDRNTGQYSDFWEARNYRHHADGIKCSWISVHGLN
PEPX_STRMU      IDVLTELTYSRNLAAGDYLRNNAQYQKMLAEQVKQIDRTSGDYNQFWQDRNYLPHAHKIKAHVVYTHGLQ
PEPX_LACDL      MDKLAEVCQSNLWDGGNFTXXXXXXXXXXXXXXXX-DRATGQYSDFWESRNYRHHTDGIKCSWISVHGLN
PEPX_STRS7      LDVLTELTYSRNLLPGDYLRHNDHYQELLSQQSQALDRQSGDYNQFWHDRNYLPQADRIKCEVVYTHGLQ
PEPX_LACDB      MDKLAEVCQSNLWDGGNFTXXXXXXXXXXXXXXXX-DRATGQYSDFWESRNYRHHADGIKCSWISVHGLN
PEPX_LACDA      MDKLAEVCQSNLWDGGNFTXXXXXXXXXXXXXXXX-DRATGQYSDFWESRNYRHHADGIKCSWISVHGLN
PEPX_STRPD      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRP6      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STREM      LDVLTELTYSRNLLPGDYLRHNDHYXXXXXXXXXXXXXXXGNYNQFWHDRNYLPQADHIKCEVVYTHGLQ
PEPX_STRPF      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRP8      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRE4      LDVLTELTYSRNLLPGDYLRHNDHYXXXXXXXXXXXXXXXGNYNQFWHDRNYLPQADRIKCEVVYTHGLQ
PEPX_STRPC      LDVLTELTYSRNLLAGDYLRHNDHYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRPB      LDVLTELTYSRNLLAGDYLRHNDHYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRP1      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRPM      LDVLTELTYSRNLLAGDYLRHNDHYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYSHGLQ
PEPX_STRGN      FESLTELTYSRNLLAGEYLRHNQAYQAYLDQQRKDLERETGDYNQFWHDRNYLIHADKVKAEVVFTHGSQ
PEPX_STRA5      LDVLTELTYSRNLLAGDYIKNNDCYQALLNEQSKAIDRQSGDYNQYWHDRNYLTHVNNVKSRVVYTHGLQ
PEPX_STRPG      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRA1      LDVLTELTYSRNLLAGDYIKNNDCYQALLNEQSKAIDRQSGDYNQYWHDRNYLTHVNNVKSRVVYTHGLQ
PEPX_STRA3      LDVLTELTYSRNLLAGDYIKNNDCYQALLNEQSKAIDRQSGDYNQYWHDRNYLTHVNNVKSRVVYTHGLQ
PEPX_STRP3      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_STRPZ      LDVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIKCDVVYTHGLQ
PEPX_LACDE      MDKLAEVCQSNLWDGGNFTXXXXXXXXXXXXXXXX-DRATGQYSDFWESRNYRHHADGIKCSWISVHGLN
PEPX_STRSV      FESLTELTYSRNLRAGDYLRNNDAYQQNLEQQRKDLDRQTGDYNQFWHDRNYLLHADKVKAEVVFTHGSQ
PEPX_STRGC      FESLTELTYSRNLLAGEYLRHNQAYQAYLDQQRKDLERETGDYNQFWHDRNYLIHADKVKAEVVFTHGSQ
PEPX_STRU0      LDVLTELTYSRSLHAGDFLRQKEKYYQLLNQQSQAIDRDSGDYNQFWHDRNYLPNAKNVTCEVVFTHGLQ
PEPX_STRMC      LDVLTELTYSRNLLPGDYLRNNAHYQEFLDEQSAQLDRASGDYNQFWHDRNYLPHADKVKATCVFTHGLQ
PEPX_STRZP      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRT1      LDTLTEFTYSRALLAGEYLRHQKDYEAYLNELSTDIDRKHGDYNQFWHDRNYVQFADRVKATVVFTHGSQ
PEPX_STRPJ      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRPI      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRT2      LDTLTEFTYSRALLAGEYLRHQKDYEAYLNELSTAIDRKHGDYNQFWHDRNYVQFADRVKATVVFTHGSQ
PEPX_STRTR      LDTLTEFTYSRALLAGEYLRHQKDYEAYLNELSTAIDRKHGDYNQFWHDRNYVQFADRVKATVVFTHGSQ
PEPX_STRTD      LDTLTEFTYSRALLAGEYLRHQKDYEAYLNELSTAIDRKHGDYNQFWHDRNYVQFADRVKATVVFTHGSQ
PEPX_STRR6      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRP2      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRZT      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRZJ      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRPN      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRP7      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRP4      FDSLAELTYSRNLLAGDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_STRPS      FDSLAELTYSRNLLASDYIRGNEAHQADLEKVKAQLDRKTGDYNQFWHDRNYLLNAHKVKAEVVFTHGSQ
PEPX_LACLA      LDVLAALTYSRNLDGADYLKGNDEYEKRLAEMTTALDRKSGDYNQFWHDRNYLINSDQVRADVLIVHGLQ
PEPX_LACLS      LDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQ
PEPX_LACLM      LDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQ
PEPX_LACLC      LDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQ
PEPX_BACCR      TDNMAEAVLTRE--------NPEVCGQVIKELTAGQDRKTGNYNDFWDKRNYVKDAKNVKASVFVVHGLN
PEPX_BACAN      TDNMAEAVLTRE--------NPEVCGQVIKELTAGQDRKTGNYNDFWDKRNYVKDAKNVKASVFVVHGLN
PEPX_RHOBA      IDILYDFIHSEETRAYCDCHIRD------EQMMANQDRATGDYNDFWYSRDYLNRVDGVKAAVLMAHAFN
PEPX_STRAW      PDWLS-----------DYVDSPDARTKCAAVQRKDEAPRTGDWTSLWTERDYVKDASKVRASVFLVHGMQ
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
PEPX_LACS1      DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
PEPX_LACBA      DWNVKPRNVNNLWRAVRDLPVTKKLILHQGQHIYINAFRSIDYTDIVNLWLTHELLGVDNHAETLLPNVI
PEPX_LACPL      DWNVKPRNVANLWDKLQAVPVTKKLILHQGQHIYINNLQSLDFTDMMNLWLSHKLYGLDNHAETLLPNVL
PEPX_PEDPA      DWNVKPRNVGKLWNAVRDLPINKKIILHQGQHIYINAFRSIDFTDMMNLWLSYKLFDVQNGANEVLPNVI
PEPX_LACRH      DWNVKPKNAIRFWQAIADLPIQKKLILHQGQHVYVHNVRSLDFLDMMNLWLTHELLGVANQAEQVLPNVL
PEPX_LACCB      DWNVKPTNAIKFWEAIADLPIQKKLVLHQGQHVYVHNVRSLDFLDMMNLWLTHELLGEANGAEDVLPNVV
PEPX_LACC3      DWNVKPTNAIKFWEAIADLPIQKKLVLHQGQHVYVHNVRSLDFLDMMNLWLTHELLGEANGAEDVLPNVV
PEPX_LACH4      DWNVKPKNVYKIWQLVKKMPMKHHLFLHQGPHYNMNNFVSIDFTDFMNLWFVHELLGIENNAYNQWPTVM
PEPX_LACHE      DWNVKPKNVYKIWQLVKKMPMKHHLFLHQGPHYNMNNLVSIDFTDLMNLWFVHELLGIENNAYNQWPTVM
PEPX_STRMU      DWNVKPNQVYYIFNALPE-EIQKHIFLHQGQHVYMHNWQSIDFRESMNALLSEELLGLQNHFQ--LPTII
PEPX_LACDL      DWNVKPKNVYKIWQKVKQLPVKSHLFLHQGPHYNMNNLVSIDFTDLMNLWFVHELLEVENGAYEQWPKVM
PEPX_STRS7      DWNVKPRQVYNIFNALPD-SLGKHLFLHHGEHVYMHNWQSIDFREAMNALLCQKMLGQNNGF--TLPTII
PEPX_LACDB      DWNVKPKNVYKIWQKVKQLPVESHLFLHQGPHYNMNNLVSIDFTDLMNLWFVHELLEVENGAYEQWPKVM
PEPX_LACDA      DWNVKPKNVYKIWQKVKQLPVESHLFLHQGPHYNMNNLVSIDFTDLMNLWFVHELLEVENGAYEQWPKVM
PEPX_STRPD      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRP6      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STREM      DWNVKPRQVYNIFNALPD-GLGKHLFLHHGEHVYMHNWQSIDFREAMNALLCQKMLGQNNGF--TLPTII
PEPX_STRPF      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNRQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRP8      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRE4      DWNVKPRQVYNIFNALPD-SLGKHLFLHHGEHVYMHNWQSIDFREAMNALLCQKMLGQNNGF--TLPTII
PEPX_STRPC      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRPB      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRP1      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRPM      DWNVKPRQVYEIFNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRGN      DWNVKPLHVYNMFHAL-PAHIKKHLFFHNGAHVYINNWQSIDFRESMNALLSKKLLGHSSDFD--LPPVI
PEPX_STRA5      DWNVKPRHVYKVFNALPQT-IKKHLFLHQGQHVYMHNWQSIDFRESMNALLSQELLGIDNHFQ--LEEVI
PEPX_STRPG      DWNVKPRQVYEIVNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNVLLCQKLLGLANDFS--LPEMI
PEPX_STRA1      DWNVKPRHVYKIFNALPQT-IKKHLFLHQGQHVYMHNWQSIDFRESMNALLSQELLGIDNHFQ--LEEVI
PEPX_STRA3      DWNVKPRHVYKVFNALPQT-IKKHLFLHQGQHVYMHNWQSIDFRESMNALLSQELLGIDNHFQ--LEEVI
PEPX_STRP3      DWNVKPRQVYEIVNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_STRPZ      DWNVKPRQVYEIVNALPST-INKHLFLHQGEHVYMHNWQSIDFRESMNALLCQKLLGLANDFS--LPEMI
PEPX_LACDE      DWNVKPKNVYKIWQKVKQLPVESHLFLHQGPHYNMNNLVSIDFTDLMNLWFVHELLEVENGAYEQWPKVM
PEPX_STRSV      DWNVKPLHVYNMFRAL-PPHIKKHLFFHNGAHVYMNNWQSIDFRESINALLSKKLLGCESDF--VLPAVI
PEPX_STRGC      DWNVKPLHVYNMFHAL-PAHIKKHLFFHNGAHVYINNWQSIDFRESMNALLSKKLLGHSSDFD--LPPVI
PEPX_STRU0      DWNVKPRQVYNMFNALPG-SVAKHLFLHHGQHVYMHNWQSIDFKECMNALLCQKLLGIASNFQ--LPAIL
PEPX_STRMC      DWNVKPRHIFNIFNALPDT-VEKHAFLHHGEHVYMHNWQSIDFRESMNTLLSEKMLGQDNHF--VLPTLI
PEPX_STRZP      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRT1      DWNVKPINVYQMFRAL-PKSLEKHLFFHNGAHVYMNAWQSIDFRESMNALICQKLLGLDNG--YTLPTVI
PEPX_STRPJ      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRPI      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRT2      DWNVKPINVYQMFRAL-PKSLEKHLFFHNGAHVYMNAWQSIDFRESMNALICQKLLGLDNG--YTLPTVI
PEPX_STRTR      DWNVKPINVYQMFRAL-PKSLEKHLFFHNGAHVYMNAWQSIDFRESMNALICQKLLGLDNG--YTLPTVI
PEPX_STRTD      DWNVKPINVYQMFRAL-PKSLEKHLFFHNGAHVYMNAWQSIDFRESMNALICQKLLDLDNG--YTLPTVI
PEPX_STRR6      DWNVKPLHVYQMFHAL-PTHINKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRP2      DWNVKPLHVYQMFHAL-PTHINKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRZT      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRZJ      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRPN      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRP7      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRP4      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_STRPS      DWNVKPLHVYQMFHAL-PTHIHKHLFFHNGAHVYMNNWQSIDFRESINALLTKKLLGQETDFQ--LPTVI
PEPX_LACLA      DWNVTPEQAYNFWQALPEGH-AKHAFLHRGAHIYMNSWQSIDFSETINAYFSAK--XXXXXXXXXXXXVI
PEPX_LACLS      DWNVTPEQAYNFWKALPEGH-AKHAFLHRGAHIYMNSWQSIDFSETINAYFVAK--XXXXXXXXXXXXVI
PEPX_LACLM      DWNVTPEQAYNFWKALPEGH-AKHAFLHRGAHIYMNSWQSIDFSETINAYFVAK--XXXXXXXXXXXXVI
PEPX_LACLC      DWNVTPEQAYNFWKALPEGH-AKHAFLHRGAHIYMNSWQSIDFSETINAYFVAK--XXXXXXXXXXXXVI
PEPX_BACCR      DWNVKTKQFAQWWEALGENNVPRKMWLHQGGH---GGTSSNNWQQTQNKWLDYWLYGIENG---IMDEPM
PEPX_BACAN      DWNVKTKQFAQWWEALGENNVPRKMWLHQGGH---GGTSTNDWQRTQNKWFDYWLYGIENG---IMNEPM
PEPX_RHOBA      DWNVVPEHSIRIYEALKKNGVETQLFMHQGGH------GGPPPISMMNRWFTHYLYGEDNGVEKGSKSWI
PEPX_STRAW      DLNVRAKNFGQWWSALAKNGVERKIWLSQTGHVDPFDFRRTAWVDTLHRWFDHELLGYDNGVREPTADI-
RIMO_PETMO      ------------------------------------------------------LYGIDNYQKQALPDLL
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
PEPX_LACS1      VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
PEPX_LACBA      IQDNVTPETWQAYPDWDSNPVQHFNLQADELVAPSDHAAATSFNDQLPVDQFNHYTHHIDEWQADLLGDK
PEPX_LACPL      VQDNTQAQTWHGYDNWWQDTTDAL-----DFKVQYKEQRAAHFTDKLPDKLFDHYKHHLDSWQRDLLQED
PEPX_PEDPA      IQDNVEPETWNTYQDWQAADIREFTLQAKTLRASETKNEAASFRDSLDPEFFEMYKNDLKHWHTDLLTNG
PEPX_LACRH      VQDNVTPQTWSAYSDF--ANPAAEHVTTTANLKTDFESATDQFSDHATATFTAQHDTS-ASFEKAIITPN
PEPX_LACCB      VQDNVAVQTWSAYQNFASP-AAEHVTNTRNLKTD-FEAATDQFTDHATATFNAQHDTS-ASFETAIITPN
PEPX_LACC3      VQDNVAVQTWSAYQNFASP-AAEHVTNTRNLKTD-FEAATDQFTDHATATFDAQHDTS-ASFETAIITPN
PEPX_LACH4      IQDNLQADKWHEEPDWSNDGQEKIYYPTDEGELFQDGNGKAQFTD-VGGIEFKKAGISESDWQDEKWAKP
PEPX_LACHE      IQDNLQADKWHEEPDWSNDGQEKIYYPTDEGELFQDGNGKAQFTD-VGGIEFKKAGISESDWQYKFICG-
PEPX_STRMU      WQDNSQVQTWKNFGSHQTRQF--------SLGQEKK-----IIDNHYPSSDFKLYSDDYHAFKHDLF---
PEPX_LACDL      IQDNLEADEWHAESDWASDGQASLYLPTADGDLSTVENGTLTFTD-LGGTEFKKAGISETDWEYQFI-SG
PEPX_STRS7      WQDNQKEQTWKELTAFGGHSKRQIALGEDHVL----------IDNHYGEEDFKRYGKDFRAFKAELFEGK
PEPX_LACDB      IQDNLEADKWHAESDWANDGQASLYSPTADGYLSTVENGTLTFTD-LGGTEFKKAGISETDWEYQFI-SG
PEPX_LACDA      IQDNLEADKWHAESDWANDGQASLYSPTADGYLSTVENGTLTFTD-LGGTEFKKAGISETDWEYQFI-SG
PEPX_STRPD      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFEGK
PEPX_STRP6      WQDNTCLQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFEGK
PEPX_STREM      WQDNQKEQTWKELTAFGGHSKRQIALGEDHVL----------IDNHYGEEDFKRYSKDFRAFKAELFEGK
PEPX_STRPF      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFEGK
PEPX_STRP8      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFEGK
PEPX_STRE4      WQDNQKEQTWKELTAFGGHSKRQIALGDDHVL----------IDNHYGEEDFKRYSKDFRAFKAELFEGK
PEPX_STRPC      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRASKAALFKGK
PEPX_STRPB      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRASKAALFKGK
PEPX_STRP1      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFKGK
PEPX_STRPM      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRASKAALFKGK
PEPX_STRGN      WQDNSQAQNWMSLDDFNQEDYSHFHLGKGSQEIRNR------YSDEDYNRFAKSYQV----FKNELFEGK
PEPX_STRA5      WQDNTTEQTWQVLDAFGGNHQEQI-----GLGDSKK-----LIDNHYDKEAFDTYCKDFNVFKNDLFKGN
PEPX_STRPG      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFKGK
PEPX_STRA1      WQDNTTEQTWQVLDAFGGNHQEQI-----GLGDSKK-----LIDNHYDKEAFDTYCKDFNVFKNDLFKGN
PEPX_STRA3      WQDNTTEQTWQVLDAFGGNHQEQI-----GLGDSKK-----LIDNHYDKEAFDTYCKDFNVFKNDLFKGN
PEPX_STRP3      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFKGK
PEPX_STRPZ      WQDNTCPQNWQERKVFGTSTIKELDLG----------QELLLIDNHYGEDEFKAYGKDFRAFKAALFKGK
PEPX_LACDE      IQDNLEADKWHAESDWANDGQASLYSPTADGYLSTVENGTLTFTD-LGGTEFKKAGISETDWEYQFI-SG
PEPX_STRSV      WQDNSQAQSWLTLEDFQEQNL-HLQLGQDCQSIQNQYS----------EEDYNRFAKNYQSFKTELFDG-
PEPX_STRGC      WQDNSQAQNWMSLDDFNQEDYSHFHLGKGSQEIRNR------YSDEDYNRFAKSYQV----FKNELFEGK
PEPX_STRU0      WQNNQEEQKWQSLEEFGTSNTFRIPLGEG----------FAKISNQYSTETFERYSKDFKSFKRDLFSG-
PEPX_STRMC      WQDNSQEQAWTSLAEFGSSNQATLALGTD----QK------IIDNHYAKAEFERYSKNFRTFKSELFTGK
PEPX_STRZP      WQDNTAPQTWLSLDNFGGQENCKTF----SLGQEEQAIQ-----NQYPDKDFERYSKTYQTFNTELYQGK
PEPX_STRT1      WQNNQSEQTWEVLDNFGHDNGKHIQLGKSEAS----------IANHYEEEIFAKYGKAYQSFKDDLF---
PEPX_STRPJ      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRPI      WQDNTAPQTWLSLDNFGGQENCKTF----SLGQEEQAIQ-----NQYPDKDFERYGKTYQAFNTELYQGK
PEPX_STRT2      WQNNQSEQTWEVLDNFGHDNGKHIQLGKSEAS----------IANHYEEEIFAKYGKAYQSFKDDLF---
PEPX_STRTR      WQNNQSEQTWEVLDNFGHDNGKHIQLGKSEAS----------IANHYEEEIFAKYGKAYQSFKDDLF---
PEPX_STRTD      WQNNQSEQTWEVLDNFGHDNGKHIQLGKAEAS----------IANHYEEEIFAKYGKAYQSFKDDLF---
PEPX_STRR6      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRP2      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRZT      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRZJ      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRPN      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRP7      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRP4      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_STRPS      WQDNTAPQTWLSLDNFGGQE------NCETFSLGQEEQ---AIQNQYPDKDFERYGKTYQTFNTELYQGK
PEPX_LACLA      LQENSKEQVWSAVSKFGGDDQLKLPLGKTAVS-------FAQFDNHYDDESFKKYSKDFNVFKKDLFEN-
PEPX_LACLS      LQENSKDQVWTMMNDFGANTQIKLPLGKTAVS-------FAQFDNHYDDETFKKYSKDFNVFKKDLFEN-
PEPX_LACLM      LQENSKDQVWTMMNDFGANTQIKLPLGKTAVS-------FAQFDNNYDDETFKKYSKDFNVFKKDLFEN-
PEPX_LACLC      LQENSKDQVWTMMNDFGANTQIKLPLGKTAVS-------FAQFDNNYDDETFKKYSKDFNVFKKDLFEN-
PEPX_BACCR      VDVQRENKTWQKIKNWPDPSKIRMYLSNKSVNLPLSMGSANKVFSFLDDAQIKSNQL-VAN---------
PEPX_BACAN      VDVQRENKTWDKMKNWPDPSAVRMYLSNKAVNLPLSMGSVNKMFSFVDDAKMKSNQL-VAN---------
PEPX_RHOBA      VREKDERTKPTEYPQYPHPEAKDVVVYPVPGAPQRGRLQTAPLTEPITETLVDNF-----SFAGETLAQA
PEPX_STRAW      ---ERHPDQWVTSTLWPPRGTDAVTLRPGTGTQAGVGTLGLRTGSG-TETFTDDPRLSETDWAAHIDEST
RIMO_PETMO      DKNNIKGKFW----------IRVMYLHPDFLSEEIIE------SIHRNEKVLNYFDVPIQHISDKILQSM
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
PEPX_LACS1      SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
PEPX_LACBA      HNAMFKHRLLFKSAVLTDDLVLDGRPTIDLQVAVNQPLGLLSFQLVDYGDAKRLGVSPTPLRIR-LDEGY
PEPX_LACPL      KNPLYDHRLLFKSWQAPEDQLLVGIPHVAGSVAVNKNFGMLSFMLIDFGAARRLTVSPQILAAKALDLGY
PEPX_PEDPA      KNQMRNNRLIFKTAQTKEDWLIDGTPEVSVNVAVNQPFGMLSFQLVDFGDAKRLNPSPSILQPRSLSGSF
PEPX_LACRH      SAYV-NSRLWLTQPVLEHDRVLEGIPHLELTLAVDAPTGILSVRLVDLGKAKRFEENAATVGASGLQLGF
PEPX_LACCB      S-AYANSRLWLTQPPLERDQTLEGIPHLELTLAIDAPTGILSVRLIDLGMAKRFGETAATVALNGLQLGF
PEPX_LACC3      S-AYANSRLWLTQPPLERDQTLEGIPHLELTLAIDAPTGILSVRLIDLGMAKRFGETAATVALNGLQLGF
PEPX_LACH4      SLRFETDEFI-------HPTTIVGRPEVKVRVSASLPKGEISVALVELGERQRLTATPKFLMRGGQELGY
PEPX_LACHE      DEKWAKPSLRFETDEFTHPTTIVGRPEVKVRVSASLPKGEISVALVELGERQRLTATPKFLMHGGQELGY
PEPX_STRMU      ---LKKANEIAIDLPIQEDMLVNGQIKLNLTLKSSSNKGLLSAQVLDYGQKKRFSDLPTILEHNSIDNGQ
PEPX_LACDL      EEKWAKASLRFESEEFLHPTTLVGRPKVRVRVAANKTVGQLSVALVDLGTRQRLTATPKIFARGNQPFGY
PEPX_STRS7      ANQAVIDIL------LEEDLPINGQACLKLKLKSSENKGILSAQLLDYGKKKRFGDLPAILELDSIDNGQ
PEPX_LACDB      EKKWAKASLRFESEEFLHPTTLVGRPKVQVRVAANKTVGQLSVALVDLGTRQRLTATPKIFARGNQPFGY
PEPX_LACDA      EKKWAKASLRFESEEFLHPTTLVGRPKVQVRVAANKTVGQLSVALVDLGTRQRLTATPKIFARGNQPFGY
PEPX_STRPD      ANQALVDILLEEDLPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRP6      ANQALVDILLEEDLPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STREM      ANQAVIDIL------LEEDLPINGQACLKLKLKSSENKGILSAQLLDYGKKKRFADIPAILELDSIDNGQ
PEPX_STRPF      ANQALVDILLEEDLPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRP8      ANQALVDILLEEDLPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRE4      ANQAVIDIL------LEEDLPINGQACLKLKLKSSENKGILAAQLLDYGKKKRFADIPAILELDSIDNGQ
PEPX_STRPC      ANQAXXXXXXXXXXPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRPB      ANQAXXXXXXXXXXPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRP1      ANQAXXXXXXXXXXPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRPM      ANQAXXXXXXXXXXPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRGN      TQQ------ITLDWTLEQDLFINGPAKLKLRLKSSTNKGLISAQLLDYGPAKRLTPIPSLLEPRVMDNGR
PEPX_STRA5      N---KTNQITI-NLPLKKNYLLNGQCKLHLRVKTSDKKAILSAQILDYGPKKRFKDTPTIKFLNSLDNGK
PEPX_STRPG      ANQALVDILLEEDLPINGEIVL------QLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRA1      N---KTNQITI-NLPLKKNYLLNGQCKLHLRVKTSDKKAILSAQILDYGPKKRFKDTPTIKFLNSLDNGK
PEPX_STRA3      N---KTNQITI-NLPLKKNYLLNGQCKLHLRVKTSDKKAILSAQILDYGPKKRFKDTPTIKFLNSLDNGK
PEPX_STRP3      ANQ------ALVXXXXXXXXXXNGEIVLQLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_STRPZ      ANQ------ALVXXXXXXXXXXNGEIVLQLKVKSSENKGLLSAQILDYGKKKRLGDLPIALTQSSIDNGQ
PEPX_LACDE      EKKWAKASLRFESEEFLHPTTLVGRPKVQVRVAANKTVGQLSVALVDLGTRQRLTATPKIFARGNQPFAY
PEPX_STRSV      ----KVNQITL-DWTLEKDLFLNGATQLNLRLKSSTDKGLISAQLLDFGLAKRHTPIPTPIEPRVMDNGR
PEPX_STRGC      TQQ------ITLDWTLEQDLFINGPAKLKLRLKSSTNKGLISAQLLDYWPAKRLTPIPSLLEPRVMDNGR
PEPX_STRU0      ----KANQLSL-EFPLDQDLQLNGEAILHLSLTSSVSKGLISAQXXXXXXXXXXXXTPTILDLKVMDNGQ
PEPX_STRMC      A------NAICLDLPIKNDYHINGQITLHLTVKSSENKGILSAQVLDYGEKKRFKDVPSVLDLYAIDNGC
PEPX_STRZP      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRT1      ---MDKANAITLDFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPA-PKRMSLDNGR
PEPX_STRPJ      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRPI      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRT2      ---MDKANAITLDFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPA-PKRMSLDNGR
PEPX_STRTR      ---MDKANAITLDFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPE-LKRMSLDNGR
PEPX_STRTD      ---MDKANAITLDFELDQDIQINGRVHLELRVKSSTNRGLISAQVLEMGDKKYLAPIPE-LKRMNVDNGR
PEPX_STRR6      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRP2      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRZT      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRZJ      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRPN      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRP7      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRP4      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_STRPS      ANQITIN------LPVTKDLHLNGRAQLNLRIKSSTNKGLLSAQLLEFGQKKYLQPYPAILSARTIDNGR
PEPX_LACLA      ----KANEAVIDLE-LPSELTINGPIELEIRLKLNDSKGLLSAQILDFGPKKRLEDKARVKDFKVLDRGR
PEPX_LACLS      ----KANEAVIDLE-LPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKARVKDFKVLDRGR
PEPX_LACLM      ----KANEAVIDLE-LPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKVRVKDFKVLDRGR
PEPX_LACLC      ----KANEAVIDLE-LPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKVRVKDFKVLDRGR
PEPX_BACCR      -PELEANRLVYTMPVLQKDTRISGTPKI--SITGNIDRSVLTALLVDYGGAKP-----------------
PEPX_BACAN      -PELEANRLVYTMPVLQKDTRISGTPKI--SITGNIDRSVLTALLVDYGGAKP-----------------
PEPX_RHOBA      --EYTEHRLIYTTPELSEAVHLSGTPRIKLRLACDRPAANLSVWLV----------------------SL
PEPX_STRAW      ASKAG-----FVTAPLAGDVRLSGXXXXXXXXXXXXXXXHLSAVLVDLGDYADGGEGITTLTDRTC----
RIMO_PETMO      GRHKKRNELIKLFEKIRKE---------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
PEPX_LACS1      HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
PEPX_LACBA      RWREDNLREFTVAATTPWKMITKGHRNLQNRTNAYQVDELKPNTFYDLSVTLQPTHYRLLAGHQLGLVIY
PEPX_LACPL      HWREDDLKDFKLAGETPFKMITKGHLNLQNRHHPWHAEAIQPNVFYDFSVDLQPLFHHLLKGHQLGLVIY
PEPX_PEDPA      DWRTDDLREFTLQNATPWKMISKGHINLQNRTNNYCVDEVKPHQFYDVKLELQPTFYRLLAGHQLGLVIY
PEPX_LACRH      DFKTTDIVEFKPAKETPSKLITLGHINLQNPKNAYEVQTITPGQFFHVSLDLQPTHYHLPAGRQLALIIH
PEPX_LACCB      DYKTTDILEFKTAKPTPSKLISLGHINLQNPKNAYEVQRITPGQPFHISLDLQPTHYHLPAGRQLALVIH
PEPX_LACC3      DYKTTDILEFKTAKPTPSKLISLGHINLQNPKNAYEVQRITPGQPFHISLDLQPTHYHLPAGRQLALVIH
PEPX_LACH4      RFGTDTLQEFVPDKKTKAKLITKAHMNLQNFKDMKKPEAIDADKFYDLDFLLQPTYYTIPSGSKLALIIY
PEPX_LACHE      RFGTDTLQEFVPDKKTKAKLITKAHMNLQNFKDMKKPEAIDADKFYDLDFLLQPTYYTIPSGSKLALIIY
PEPX_STRMU      NFSREALRELPF-KKAPYRIITKGVLNLQNRTDLLTIEDIFPNKWMTITFNLQASLYQLQKGDSLRIVLY
PEPX_LACDL      RFGADSLQEFVPDKATKAKLITKAHMNLQNYQDMKQPSKLEAGQFVDLEFELQPTYYTLPAGAKLGLIIY
PEPX_STRS7      QFAREALKELPF-KDSPYRVVTKGVLNLQHRSGLLTIEDIPNDQWISITFHLQPTIYHMAKGDTLRVVLY
PEPX_LACDB      RFEADSLQEFVPDKATKAKLITKAHMNLQNYQDMKQPSKLEAGQFVDLEFELQPTYYTLPAGAKLCLIIY
PEPX_LACDA      RFEADSLQEFVPDKATKAKLITKAHMNLQNYQDMKQPSKLEAGQFVDLEFELQPTYYTLPAGAKLCLIIY
PEPX_STRPD      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRP6      NFSRESLKEL-LFREDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STREM      QFAREALKELPF-KDSPYRVVTKGVLNLQHRSNLLTIEDIPNDQWMTITFHLQPTIYHMAKGDTLRVVLY
PEPX_STRPF      NFSRESLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRP8      NFSRESLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRE4      QFAREALKELPF-KDSPYRVVTKGVLNLQHRSDLLTIEDIPNDQWMTITFHLQPTIYHMAKGDTLRVVLY
PEPX_STRPC      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRPB      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRP1      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRPM      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRGN      YYMLDNLMELPFA-DTPHRVITKGFLNLQNRTDLLTVEEVVPNQWMELSFELQPTIYKLKKGDQLRLVLY
PEPX_STRA5      NFAREALRELPFTKD-HYRVISKGVLNLQNRTDLLTIEAIEPEQWFDIEFSLQPSIYQLSKGDNLRIILY
PEPX_STRPG      NFSREPLKELPF-REDSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRA1      NFAREALRELPFTKD-HYRVISKGVLNLQNRTDLLTIEAIDPEQWFDIEFSLQPSIYQLSKGDNLRIILY
PEPX_STRA3      NFAREALRELPFTKD-HYRVISKGVLNLQNRTDLLTIEAIEPEQWFDIEFSLQPSIYQLSKGDNLRIILY
PEPX_STRP3      NFSREPLKELPF-RENSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_STRPZ      NFSREPLKELPF-RENSYRVISKGFMNLQNRNNLSSIETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILY
PEPX_LACDE      RFEADSLQEFVPDKATKAKLITKAHMNLQNYQDMKQPSKLEAGQFVDLEFELQPTYYTLPAGAKLCLIIY
PEPX_STRSV      YYMLDNLVELPFA-ETPHRVITKGFLNLQNRTNLLSVEEVTPDQWLEFSFELQPTIYKMKKGDQLRLVLY
PEPX_STRGC      YYMLDNLMELPFA-DTPHRVITKGFLNLQNRTDLLTVEEVVPNQWMELSFELQPTIYKLKKGDQLRLVLY
PEPX_STRU0      NFSREDLKELPM-RESTERVISKGVLNLQNRDGLLEVQSVEADQWLSFDFKLQPSLYQLRKGDCLQVLLY
PEPX_STRMC      NFSREALKEFTKAKE---RVITKGVLNLQNRTDLLTIEDIPANEWMTFDFTLQPSIYKLEKGDTLRVLLY
PEPX_STRZP      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRT1      LFKEEALRELPF-KQAKYRVITKGHLNLQNRKDLLSIENVTPNEWMTIGLDLQPTIYKLNKGDKLRLVLY
PEPX_STRPJ      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRPI      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRSDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRT2      LFKEEALRELPF-KQAKYRVITKGHLNLQNRKDLLSIENVTPNEWMTIGLDLQPTIYKLNKGDKLRLVLY
PEPX_STRTR      LFKEEALRELPF-KQAKYRVITKGHLNLQNRKDLLSIENVTPNEWMTIGLDLQPTIYKPNKGDKLRLVLY
PEPX_STRTD      LFKEEALRELPF-KQAKYRVITKGHLNLQNRKDLLSIENVTPNEWMTIGLDLQPTIYKLNKGDKLRLVLY
PEPX_STRR6      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRP2      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRZT      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRZJ      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRPN      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRP7      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRP4      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_STRPS      YHMLENLCELPFRPEAQ-RVVTKGYLNLQNRNDLLLVEDITADEWMDVQFELQPTIYKLKEGDTLRLVLY
PEPX_LACLA      NFMLDDLVELPLV-ESPYQLVTKGFTNLQNK-DLLTVSDLKADEWFTLKFELQPTIYHLEKADKLRVILY
PEPX_LACLS      NFMLDDLVELPLV-ESPYQLITKGFTNLQNQ-NLLTVSDLKADEWFTIKFELQPTIYHLEKADKLRVILY
PEPX_LACLM      NFMLDDLVELPLV-ESPYQLVTKGFTNLQNQ-SLLTVSDLKADEWFTIKFELQPTIYHLEKADKLRVILY
PEPX_LACLC      NFMLDDLVELPLV-ESPYQLVTKGFTNLQNQ-SLLTVSDLKADEWFTIKFELQPTIYHLEKADKLRVILY
PEPX_BACCR      ------------------EIVTRGWMDPQNVKSIENSTAIQPGKDYTFTWDMQPDDYVFKAGHQIGVVLI
PEPX_BACAN      ------------------EIVTRGWMDPQNVKSIENSTAIQPGKDYTFTWDMQPDDYVFKAGHQIGVVLM
PEPX_RHOBA      PWNTQ-----KNSKITD-NIITRGWADPQNIESMRESKPLVPGQFYDIEFDLQPDDQVIAKGQQIGLMVF
PEPX_STRAW      -WGASTAGDSACFKNTDYTVLSRGWADLGNHASARKGVPLTPGKAYTITLDLAATDHVVPKGHRLALIVA
RIMO_PETMO      ----------------------------------------------------------------------
EFP_DECAR       ----------------------------------------------------------------------
EFP_AZOSE       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPIEE
PEPX_LACS1      ATDMEMTLQGNEENSYRIDTTGSYCLLPIEE
PEPX_LACBA      ATDFGMTVRGNQDLQYSIQLGQSALHVP---
PEPX_LACPL      ATDMKMTIRGNQDLQYSLNLNDIRLHVPMKK
PEPX_PEDPA      ATDFETTIRGNQELLYSLQLNQSH-------
PEPX_LACRH      GADMAQTIRPTKVTHYQLDLAKSTLTLP---
PEPX_LACCB      GADMAQTIRPIKTTHYQIDLANSSITLP---
PEPX_LACC3      GADMAQTIRPIKTTHYQIDLANSSITLP---
PEPX_LACH4      STDQGMTKRPLEDETYTID------------
PEPX_LACHE      STDQGMTKRPLEDETYTID------------
PEPX_STRMU      TTDFEQTVRDNSNYILVVDLAKSTIEIPI--
PEPX_LACDL      STDQGMTKRPLETEDYTVDLAGTALLL----
PEPX_STRS7      TTDFEHTIRDNSNYALTLDLEQSYLLIPTDE
PEPX_LACDB      STDQGMTKRPLETEDYTVDLAGTALLL----
PEPX_LACDA      STDQGMTKRPLETEDYTVDLAGTALLL----
PEPX_STRPD      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRP6      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STREM      TTDFEHTIRDNSNYALTLDLEQSYLLIPTDE
PEPX_STRPF      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRP8      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRE4      TTDFEHTIRDNSNYALTLDLEQSYLLIPTDE
PEPX_STRPC      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRPB      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRP1      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRPM      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRGN      TTDFEHTVRDKTDYHLSVDMEHSSLSLP---
PEPX_STRA5      TTDFEHTIRDNASYSITVDLSQSYLTIPTNQ
PEPX_STRPG      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRA1      TTDFEHTIRDNASYSITVDLSQSYLTIPTNQ
PEPX_STRA3      TTDFEHTIRDNASYSITVDLSQSYLTIPTNQ
PEPX_STRP3      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_STRPZ      TTDFEHTVRDNSNYALTIDLSQSQLIVPI--
PEPX_LACDE      STDQGMTKRPLETEDYTVDLAGTALLL----
PEPX_STRSV      TTDFEHTVRDKIDYQLTVDLEQSSLDLP---
PEPX_STRGC      TTDFEHTVRDKTDYHLSVDMEHSSLSLP---
PEPX_STRU0      TTDFEHTVRDNSDYELRINLEKSYLSLPI--
PEPX_STRMC      TTDFEHTIRDNSNYILTVDLDKSNLEIPIE-
PEPX_STRZP      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRT1      TTDFEHTIRDNSDYEVTVDLSQSKMTLP---
PEPX_STRPJ      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRPI      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRT2      TTDFEHTIRDNSDYEVTVDLSQSKMTLP---
PEPX_STRTR      TTDFEHTIRDNSDYEVTVDLSQSKMTLP---
PEPX_STRTD      TTDFEHTIRDNSDYEVTVDLSQSKMTLP---
PEPX_STRR6      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRP2      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRZT      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRZJ      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRPN      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRP7      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRP4      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_STRPS      TTDFEITIRDNTDYHLTVDLAQSMLTLP---
PEPX_LACLA      STDFEHTVRDNRKVTYEIDLSQSKLIIPIE-
PEPX_LACLS      STDFEHTVRDNRKVTYEIDLSQSKLIIPIE-
PEPX_LACLM      STDFEHTVRDNRKVTYEIDLSQSKLIIPIE-
PEPX_LACLC      STDFEHTVRDNRKVTYEIDLSQSKLIIPIE-
PEPX_BACCR      ASDYDYTIR----------------------
PEPX_BACAN      ASDYDYTIR----------------------
PEPX_RHOBA      SSDRDYTLHPTPGTKLTIDLQHTQLSLPV--
PEPX_STRAW      GTDKDLIDPPSSTPTLTLDLARTSARVPL--
RIMO_PETMO      -------------------------------
EFP_DECAR       -------------------------------
EFP_AZOSE       -------------------------------