[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00428.1

[Show Plain Result]


## Summary of Sequence Search
    1::231
   17::233     2e-59  54%  234 aa  TCYB_BACSU RecName: Full=L-cystine transport system permease
    1::210     2e-57  50%  210 aa  Y1079_HAEIN RecName: Full=Probable amino-acid ABC transporter
   47::216     6e-42  51%  222 aa  YECS_SHIFL RecName: Full=Inner membrane amino-acid ABC transporter
   47::216     6e-42  51%  222 aa  YECS_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter
   47::216     6e-42  51%  222 aa  YECS_ECOL6 RecName: Full=Inner membrane amino-acid ABC transporter
   17::226     2e-41  40%  226 aa  YCKA_BACSU RecName: Full=Probable amino-acid ABC transporter
    6::220     4e-35  38%  224 aa  YXEN_BACSU RecName: Full=Probable amino-acid permease protein yxeN;
    8::230     2e-33  35%  235 aa  TCYM_BACSU RecName: Full=L-cystine transport system permease
    8::220     3e-32  38%  245 aa  OCCM_RHIME RecName: Full=Octopine transport system permease protein
   15::213     3e-32  35%  218 aa  GLNP_RICPR RecName: Full=Putative glutamine transport system
    1::213     3e-32  34%  218 aa  GLNP_RICFE RecName: Full=Putative glutamine transport system
   15::213     4e-32  36%  218 aa  GLNP_RICTY RecName: Full=Putative glutamine transport system
    1::213     4e-32  34%  218 aa  GLNP_RICCN RecName: Full=Putative glutamine transport system
    1::213     4e-32  35%  218 aa  GLNP_RICBR RecName: Full=Putative glutamine transport system
   26::214     4e-30  36%  241 aa  NOCM_AGRT5 RecName: Full=Nopaline transport system permease protein
   16::210     9e-30  34%  216 aa  GLNM_BACSU RecName: Full=Probable glutamine ABC transporter
   18::233     1e-28  33%  238 aa  Y4TF_RHISN RecName: Full=Probable amino-acid ABC transporter
    8::220     8e-28  36%  245 aa  OCCM_RHIRD RecName: Full=Octopine transport system permease protein
   17::236     6e-27  36%  236 aa  NOCQ_AGRT5 RecName: Full=Nopaline transport system permease protein
   10::222     7e-27  34%  223 aa  PATM_VIBHA RecName: Full=Probable amino-acid ABC transporter
    6::224     2e-26  33%  224 aa  GLTK_ECOLI RecName: Full=Glutamate/aspartate transport system
    6::224     2e-26  33%  224 aa  GLTK_ECOL6 RecName: Full=Glutamate/aspartate transport system
    6::224     2e-26  33%  224 aa  GLTK_ECO57 RecName: Full=Glutamate/aspartate transport system
   58::214     1e-23  34%  219 aa  GLNP_SHIFL RecName: Full=Glutamine transport system permease
   58::214     1e-23  34%  219 aa  GLNP_ECOLI RecName: Full=Glutamine transport system permease
   58::214     1e-23  34%  219 aa  GLNP_ECOL6 RecName: Full=Glutamine transport system permease
   58::214     1e-23  34%  219 aa  GLNP_ECO57 RecName: Full=Glutamine transport system permease
   50::195     2e-23  35%  221 aa  ARTQ_HAEIN RecName: Full=Arginine ABC transporter permease protein
   18::215     8e-23  33%  231 aa  Y4TG_RHISN RecName: Full=Probable amino-acid ABC transporter
   22::203     8e-23  36%  235 aa  HISM_SALTY RecName: Full=Histidine transport system permease
   22::203     8e-23  36%  235 aa  HISM_SALTI RecName: Full=Histidine transport system permease
   43::213     1e-22  33%  222 aa  ARTM_SHIFL RecName: Full=Arginine ABC transporter permease protein
   43::213     1e-22  33%  222 aa  ARTM_ECOLI RecName: Full=Arginine ABC transporter permease protein
   43::213     1e-22  33%  222 aa  ARTM_ECOL6 RecName: Full=Arginine ABC transporter permease protein
   43::213     1e-22  33%  222 aa  ARTM_ECO57 RecName: Full=Arginine ABC transporter permease protein
   25::235     2e-22  31%  246 aa  GLTJ_ECOLI RecName: Full=Glutamate/aspartate transport system
   25::235     2e-22  31%  246 aa  GLTJ_ECOL6 RecName: Full=Glutamate/aspartate transport system
  174::376     7e-22  33%  384 aa  AAPM_RHIL3 RecName: Full=General L-amino acid transport system
   48::207     1e-21  32%  228 aa  HISQ_SALTY RecName: Full=Histidine transport system permease
   48::207     1e-21  32%  228 aa  HISQ_SALTI RecName: Full=Histidine transport system permease
   52::221     3e-21  33%  239 aa  TCYL_BACSU RecName: Full=L-cystine transport system permease
   48::217     3e-21  31%  228 aa  HISQ_ECOLI RecName: Full=Histidine transport system permease
   14::233     2e-20  26%  238 aa  ARTQ_SHIFL RecName: Full=Arginine ABC transporter permease protein
   14::233     2e-20  26%  238 aa  ARTQ_ECOLI RecName: Full=Arginine ABC transporter permease protein
   14::233     2e-20  26%  238 aa  ARTQ_ECOL6 RecName: Full=Arginine ABC transporter permease protein
   57::213     1e-19  32%  219 aa  ARTQ_BACSU RecName: Full=Arginine transport system permease protein
  158::358     4e-19  31%  367 aa  YHDY_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter
   62::203     4e-18  36%  238 aa  HISM_SHIFL RecName: Full=Histidine transport system permease
   62::203     4e-18  36%  238 aa  HISM_ECOLI RecName: Full=Histidine transport system permease
   62::203     4e-18  36%  238 aa  HISM_ECOL6 RecName: Full=Histidine transport system permease
   62::203     4e-18  36%  238 aa  HISM_ECO57 RecName: Full=Histidine transport system permease
   26::226     6e-18  29%  273 aa  GLUD_CORGL RecName: Full=Glutamate transport system permease
   19::209     8e-18  32%  228 aa  GLUC_COREF RecName: Full=Glutamate transport system permease
  229::431     3e-17  27%  434 aa  BZTC_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine
   19::209     7e-17  31%  228 aa  GLUC_CORGL RecName: Full=Glutamate transport system permease
  214::390     9e-17  28%  400 aa  AAPQ_RHIL3 RecName: Full=General L-amino acid transport system
  183::380     2e-16  30%  393 aa  YHDX_ECOLI RecName: Full=Putative amino-acid ABC transporter
   45::186     3e-16  32%  227 aa  ARTM_HAEIN RecName: Full=Arginine ABC transporter permease protein
   82::182     4e-15  41%  218 aa  GLNP_BACSU RecName: Full=Probable glutamine ABC transporter
   61::200     2e-12  28%  237 aa  OCCQ_RHIRD RecName: Full=Octopine transport system permease protein
   61::200     2e-12  28%  237 aa  OCCQ_AGRT4 RecName: Full=Octopine transport system permease protein
   32::199     3e-12  29%  277 aa  GLUD_COREF RecName: Full=Glutamate transport system permease
  103::200     2e-11  32%  237 aa  OCCQ_RHIME RecName: Full=Octopine transport system permease protein
  311::377     6e-11  39%  426 aa  BZTB_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine
    8::157     3e-07  24%  217 aa  METI_ECOLI RecName: Full=D-methionine transport system permease
    8::157     4e-07  26%  217 aa  METI_SALTY RecName: Full=D-methionine transport system permease
    8::157     4e-07  26%  217 aa  METI_SALTI RecName: Full=D-methionine transport system permease
    9::193     1e-05  24%  225 aa  METI_VIBCH RecName: Full=Probable D-methionine transport system
   62::157     6e-05  28%  217 aa  METI_YERPE RecName: Full=D-methionine transport system permease
   62::157     1e-04  27%  217 aa  METI_ECO57 RecName: Full=D-methionine transport system permease
  292::443     4e-04  27%  523 aa  MALF_VIBVY RecName: Full=Maltose transport system permease protein
  292::443     4e-04  27%  523 aa  MALF_VIBVU RecName: Full=Maltose transport system permease protein
  367::427     9e-04  33% 1203 aa  AT2B4_RAT RecName: Full=Plasma membrane calcium-transporting ATPase
    1::231

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MWHTVISSLPELISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFYVWLFRSTPLL
TCYB_BACSU      -WDLVQQSFWPILSGGIYYTIPLTILSFIFGMILALITALARMSKVRP----LRWVFSVYVSAIRGTPLL
Y1079_HAEIN     -----------MLEAAILYTLPLAVISFFCGLLIAVIVAVIRTLPSPNPLKLLQALCRVYISIIRGTPML
YECS_SHIFL      ------------------------------------------------PIWPVRWLARFYISIFRGTPLI
YECS_ECOLI      ------------------------------------------------PIWPVRWLARFYISIFRGTPLI
YECS_ECOL6      ------------------------------------------------PIWPVRWLARFYISIFRGTPLI
YCKA_BACSU      -----IESFPYVIK-GIGYTLLISFVSMFAGTVIGLFISLARMSK----LALLRWPAKLYISFMRGVPIL
YXEN_BACSU      -WEFMISAFPTLIQA-----LPXXXXXXXXXXXXXXXXXXXXXXXXKNKIPVLHQLSKLYISFFRGVPTL
TCYM_BACSU      ----IVSAMKEMVKT-IPLTLMMAVLPIVFGFLVALGNIIVRIFRIKG----LVACSRFYVSFFRSTPAI
OCCM_RHIME      LWETFIALL-----AGIPLALKLAVFSIAVGTVLAFSLALMRVSRRW--WLDFPA--RFYIFAFRGTPLL
GLNP_RICPR      ------------IIEGTLVTLKYSVIAVILGLVIGMLLAICKVNKNR----VLRLFANFYTSIFRGTPLL
GLNP_RICFE      MFEYLIKFYPKIIVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRA----LRLFANFYTSIFRGTPLL
GLNP_RICTY      ------------IIEGTLVTLKYSIIAVILGLVIGMLLAICKVNKN----CVLRLFANFYTSIFRGTPLL
GLNP_RICCN      MFEYLIKFYPKIIVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRA----LRLFANFYTSIFRGTPLL
GLNP_RICBR      MFEYLIKFSPKIIVEGTLITLKYSVIAVIFGLVIGVLLALCKVNKNRA----LRLFADFYTSIFRGTPLL
NOCM_AGRT5      -------------------------ISLLIGFVVSVPVALMRLSKNR----IVSSLAYGYVYIIRSTPLL
GLNM_BACSU      ---------------GFYHTLLASVIALAGSFVLGVAVAVMRITV----FKPLQWLGTAYVEFIRNIPLL
Y4TF_RHISN      -WHDYLGPL----GRGAWVTIQFTLYSMFFGAVCSFAFGIGKLS--KNPF--VKGFSILYIEIFRGTSLL
OCCM_RHIRD      LWQTFVALL-----SGIPLALQLAVFSVALGTVLAFGLALMRVSRLW--WLDLPA--RFYIFAFRGTPLL
NOCQ_AGRT5      ------------LARGAMMTVVVAACSYFFGIIFGSLFAAAKLSR----FWSLRLLGDVYTTVVRGVPEL
PATM_VIBHA      ----------ELLPILLKYTMEMATWGLVFSLILSVILANIRVFKLP----VLDQLSQLYISFFRGTPXX
GLTK_ECOLI      -WSSIVPSLPYLLD-GLVITLKITVTAVVIGILWGTMLAVMRLSS----FAPVAWFAKAYVNVFRSIPLV
GLTK_ECOL6      -WSSIVPSLPYLLD-GLVITLKITVTAVVIGILWGTMLAVMRLSS----FAPVAWFAKAYVNVFRSIPLV
GLTK_ECO57      -WSSIVPSLPYLLD-GLVITLKITVTAVVIGILWGTMLAVMRLSS----FAPVAWFAKAYVNVFRSIPLV
GLNP_SHIFL      -----------------------------------------------------------FIEVIRGTPIV
GLNP_ECOLI      -----------------------------------------------------------FIEVIRGTPIV
GLNP_ECOL6      -----------------------------------------------------------FIEVIRGTPIV
GLNP_ECO57      -----------------------------------------------------------FIEVIRGTPIV
ARTQ_HAEIN      -----------------------------------------------------------FVALLRGLPEI
Y4TG_RHISN      -----ISILPMLLM-GLITTLQAAFLGFFVACVLGMVFAVLRGMRTRWVAWPAAVLIEF----IRDTPLI
HISM_SALTY      ---------------GVAITLWLLISSVVMGGLLAVILAVGRVSSNK--------FIRFPIWLFRGTPLY
HISM_SALTI      ---------------GVAITLWLLISSVVMGGLLAVILAVGRVSSNK--------FIRFPIWLFRGTPLY
ARTM_SHIFL      ---------------------------------------------------VLVWLVRGYITLFTGTPLL
ARTM_ECOLI      ---------------------------------------------------VLVWLVRGYITLFTGTPLL
ARTM_ECOL6      ---------------------------------------------------VLVWLVRGYITLFTGTPLL
ARTM_ECO57      ---------------------------------------------------VLVWLVRGYITLFTGTPLL
GLTJ_ECOLI      ------------IWSGFQVTIALSICAWIIAFLVGSFFGILRTV----PNRFLSGLGTLYVELFRNVPLI
GLTJ_ECOL6      ------------IWSGFQVTIALSICAWIIAFLVGSFFGILRTV----PNRFLSGLGTLYVELFRNVPLI
AAPM_RHIL3      ---------------GLMVTLVLSFVGIAVSLPVGILLALGRRSRMP----VIRMLCVTFIEVIRGVPLI
HISQ_SALTY      -------------------------------------------------------IFEGYTTLIRGVPDL
HISQ_SALTI      -------------------------------------------------------IFEGYTTLIRGVPDL
TCYL_BACSU      ---------------------------------------------------IVNQLAKVYISFFRGTPIM
HISQ_ECOLI      -------------------------------------------------------IFEGYTTLIRGVPDL
ARTQ_SHIFL      -------------------TVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSAL----VTILRGLPEI
ARTQ_ECOLI      -------------------TVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSAL----VTILRGLPEI
ARTQ_ECOL6      -------------------TVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSAL----VTILRGLPEI
ARTQ_BACSU      ----------------------------------------------------------FYTSVFRGTPLV
YHDY_ECOLI      ---------------GLTLTLIIASVGIAGALPWGILLALGRRSHMP----IVRILSVIFIEFWRGVPLI
HISM_SHIFL      -----------------------------------------------------------FTYIFRGTPLY
HISM_ECOLI      -----------------------------------------------------------FTYIFRGTPLY
HISM_ECOL6      -----------------------------------------------------------FTYIFRGTPLY
HISM_ECO57      -----------------------------------------------------------FTYIFRGTPLY
GLUD_CORGL      ------------ILPGLWGTLKSAVFSVILALVMGTALGLGRISEIR----ILRWFCAVIIETFRAIPVL
GLUC_COREF      -------------------TIQLTVYSAIGSMILGTILTAMRVSPVK----ILRSISTAYINTVRNTPLT
BZTC_RHOCA      ----------------------LALVIGVTAIVVSLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPXX
GLUC_CORGL      -------------------TIKLTIYSAIGAMIFGTILTTMRVSPVK----ILRTLSTAYINTVRNTPLT
AAPQ_RHIL3      -----------------------------------------RQAATGQPFHTVWTAIALIVGL----PLL
YHDX_ECOLI      -------------------------IAFILAVVMAIVLSLFRFNKT----YQIKTGQLRRTWLIIGLPLL
ARTM_HAEIN      ----------------------------------------------------IKSAVNLYLTLFTGTPLL
GLNP_BACSU      ----------------------------------------------------------------------
OCCQ_RHIRD      -----------------------------------------------------------YTTALRGIPDL
OCCQ_AGRT4      -----------------------------------------------------------YTTALRGIPDL
GLUD_COREF      ---------------GLWGTLKAAVASIXXXXXXXXXXXXXRISEIR----LLRWFCGIIIETFRAIPVL
OCCQ_RHIME      ----------------------------------------------------------------------
BZTB_RHOCA      ----------------------------------------------------------------------
METI_ECOLI      -----------LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVVNIFRSIPFI
METI_SALTY      -----------LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENARLYRSLVNIFRSIPFI
METI_SALTI      -----------LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIMENARLYRSLVNIFRSIPFI
METI_VIBCH      -WFALNSDLLLTATWQTLYMVAIAAVGFALGIPLGVI---LHTTKKEGLLLPLNRALGAVVNIGRSVPFL
METI_YERPE      --------------------------------------------------------------IFRSIPFI
METI_ECO57      --------------------------------------------------------------IFRSIPFI
MALF_VIBVY      ------------------WTVVFSILTVLLTLMIGLVLAVVQWEELKG-----RAIYRVLLILPYAVPAF
MALF_VIBVU      ------------------WTVVFSILTVLLTLMIGLVLAVVQWEELKG-----RAIYRVLLILPYAVPAF
AT2B4_RAT       ------------------------------GLIMSILTVLILILY----FVVDNFVIQRRAWLPECTPVY


                         .         .         *         .         .         .         .:140
query           VQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAAITSIPKGQWEAAASIGMTHK
TCYB_BACSU      VQLFIIFYLFPAFNVT--------LDPFPSAVIAFSLNVGAYASEIIRASILSVPKGQWEAGYTIGMTHQ
Y1079_HAEIN     VQIFIIFYGLPEV--------GITLEPFPTAIIAFSINIGAYAAETVRASIIAIPKGQWEASYAIGMNYR
YECS_SHIFL      AQLFMIYYGLPQF--------GIELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPW
YECS_ECOLI      AQLFMIYYGLPQF--------GIELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPW
YECS_ECOL6      AQLFMIYYGLPQF--------GIELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPW
YCKA_BACSU      VILFILYFGFPYI--------GIEFSAVTAALIGFSLNSAAYIAEINRSAISSVEKGQWEAASSLGLSYW
YXEN_BACSU      VQLFLIYYGLPQL-----FPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDDGQLEACLSVGMTKF
TCYM_BACSU      LHIMLIYLGIPPVADQGWSANEIPVSMFV--IMALSLTAGAYLTEIIRSGILAMDTGQVEAAYSIGLTYS
OCCM_RHIME      VQIYIIYYGLPGLRHSLLWP--FLREAYWCALGALALNTAAYSAEIMRGGLLSVPAGQIEAARACGMARV
GLNP_RICPR      VQLSIIYFAAPYII-------NIKFNVFMAGVISFALNSGAYVSEVIRAGINTVDKGQFEAAEALAIPKF
GLNP_RICFE      IQLSIIYFASPYII-------GVKFSVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQFEAAVALAIPKF
GLNP_RICTY      VQLSIIYFAAPYII-------SIKFSVFMAGVISFALNSGAYVSEVIRAGINTIDKGQFEAAEALAIPKF
GLNP_RICCN      IQLSIIYFASPYII-------GIKFSVFMAGAIAFSLNSGAYVSEVIRAGINAVDKGQFEAAEALAIPKF
GLNP_RICBR      IQLSIIYFASPYLI-------GIKFTVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQFEAAEALAIPKF
NOCM_AGRT5      VQMFLIYYGSA--QFRGVLSESSFREPWFCAILALALNTAAYTSEIIRGGIQSVSLGQIEAARAVGMSTF
GLNM_BACSU      LITFVFYFGLPNA--------GLRLDGFQAGTVALTIYTSAFIAEAIRAGIQSVSKGQMEAARSSGFTYS
Y4TF_RHISN      VQLFWLFFALPIADMMGI---DLRLSPVVAGVLALSLNLGAYGAEIVRGAIQAVSPSQYEAATALNFSSS
OCCM_RHIRD      VQIYIIYYGLPDVRHSFIWP--FLRDAYWCXXXXXXXXXXXXXXEIMRGGLLSVPAGQIEAAKACGMGRV
NOCQ_AGRT5      LIIFLVFFGLLRTIANGLFGYEGYIEPFVIGVLCISVSAGAYATEVIRAAVLAVPPGQIEAAKSIGMGPW
PATM_VIBHA      XXXXXXXXXXPQI-----FPFMVGIDAFSAAVIGLTLHFAAYMAESIRAAIIGIDRSQMEASLSVGMTTT
GLTK_ECOLI      MVLLWFYLIVPGFNVLGLSPKNIRL---ISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHW
GLTK_ECOL6      MVLLWFYLIVPGFNVLGLSPKNIRL---ISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHW
GLTK_ECO57      MVLLWFYLIVPGFNVLGLSPKNIRL---ISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHW
GLNP_SHIFL      VQVMFIYFALP------MAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRW
GLNP_ECOLI      VQVMFIYFALP------MAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRW
GLNP_ECOL6      VQVMFIYFALP------MAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRW
GLNP_ECO57      VQVMFIYFALP------MAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRW
ARTQ_HAEIN      IVVLLVYFGSTEL-VEMLTGEYIEFGAFGCGVLALSLIFAAYASQTLRGAIQAIPKGQWESGAALGLSKS
Y4TG_RHISN      AQLFFLYYVLPEY--------GIIFPAFLTGALALGIQYSAYISEVYRGGIQAVDHGQREAAKSLDLPPA
HISM_SALTY      VQLLVFYSGMYTLEI--VKGTDLLNAFFRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSF
HISM_SALTI      VQLLVFYSGMYTLEI--VKGTDLLNAFFRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSF
ARTM_SHIFL      VQIFLIYYGFPTLQ-EYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKK
ARTM_ECOLI      VQIFLIYYGFPTLQ-EYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKK
ARTM_ECOL6      VQIFLIYYGFPTLQ-EYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKK
ARTM_ECO57      VQIFLIYYGFPTLQ-EYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKK
GLTJ_ECOLI      VQFFTWYLVIPEL-----LPEKIELDPFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLP
GLTJ_ECOL6      VQFFTWYLVIPEL-----LPEKIELDPFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLP
AAPM_RHIL3      TVLFMASVMLPLF-----LPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYW
HISQ_SALTY      VLMLLIFYGLQIVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTHG
HISQ_SALTI      VLMLLIFYGLQIVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTHG
TCYL_BACSU      VQLFIVFYGIPALT--GLIGDTSKMDPFYXXXXXXXXXXXXXXXXXXXXGVGSVDKGQTEAAYSIGLSGS
HISQ_ECOLI      VLMLLIFYGLQIALTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRG
ARTQ_SHIFL      LVVLFIYFGSSQLLLTGFVQIPVQMDPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKS
ARTQ_ECOLI      LVVLFIYFGSSQLLLTGFVQIPVQMDPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKS
ARTQ_ECOL6      LVVLFIYFGSSQLLLTGFVQIPVQMDPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKS
ARTQ_BACSU      LQLMIVYFGLPQLL-------GFQIDQFWXXXXXXXXXXXXXXXEIIRAGINAIDKGQKEAAVALGVPYG
YHDY_ECOLI      TVLFMSSVMLPLFMAEGTSID--KLIRALVGVILFQ---SAYVAEVVRGGLQALPKGQYEAAESLALGYW
HISM_SHIFL      VQLLVFYSGMYTLEIKGT--EFLNAF-FRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTF
HISM_ECOLI      VQLLVFYSGMYTLEIKGT--EFLNAF-FRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTF
HISM_ECOL6      VQLLVFYSGMYTLEIKGT--EFLNAF-FRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTF
HISM_ECO57      VQLLVFYSGMYTLEIKGT--EFLNAF-FRSGVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTF
GLUD_CORGL      ILMIFAYQMFAQYNI-------VPSSQLAFAAVVFGLTNGSVIAEILRSGIASLPKGQKEAAIALGMSSR
GLUC_COREF      LVILFCSFGLYQLTLAGRDSSTFLADNFRLAVLGFILYTSAFVAESLRSGINTVHFGQAEAARSLGLGFS
BZTC_RHOCA      XXXXXXXXXXXXXX-----PPGTNFDLILRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYW
GLUC_CORGL      LVVLFCSFGLYQLTLAGRESSTFLVDNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAARSLGLGFG
AAPQ_RHIL3      VFVFPLTFDVPVAGKFNLTGGSVVGPEFMSLFLALSFYTASFIAEIVRGGIRGVPKGQSEAAGALGLHPS
YHDX_ECOLI      AQWLFLHWDVPALRGFNFRGGMVLIPELAALTLALSVYTSAFIAEIIRAGIQAVPYGQHEAARSLGLPNP
ARTM_HAEIN      VQFFLIYAGPGQFQWIIDSPLWYVLNAWFCXXXXXXXXXXXYSTQLFHGAVKAIPKGQWESCGALGLNRI
GLNP_BACSU      ---------------------GIKLEXXXXXXXXXXXFESAMLSEIIRSGLKSIDKGQIEAARSSGLSYT
OCCQ_RHIRD      LVIYLFYFGSSSVISNVASLFGVGASTFLIGALAIGVVSGAYQTQVLRGAVLALNKGEIEAGRAYGMGAL
OCCQ_AGRT4      LVIYLFYFGSSSVISNVASLFGVGASTFLIGALAIGVVSGAYQTQVLRGAVLALNKGEIEAGRAYGMGAL
GLUD_COREF      IQLFARYQLVPSRQLA-----------FAAVVFGLTMYNGSVIAEILRSGIASLPKGQREAAIALGMSTR
OCCQ_RHIME      ---------------------------FLTGALAIGLVSAAYQTQVLRGAVLALNKGEIEAGRAYGMGYF
BZTB_RHOCA      --------------------------------------------EIVRAGIQAISRGQTEAAYALGLRPG
METI_ECOLI      I---LLVWMIPFTRVIVGTSIGLQ-----AAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPM
METI_SALTY      I---LLVWMIPFTRIIVGTSIGLQ-----AAIVPLTVGAAPFIARMVENALLEIPAGLIEASRAMGATPL
METI_SALTI      I---LLVWMIPFTRIIVGTSIGLQ-----AAIVPLTVGAAPFIARIVENALLEIPAGLIEASRAMGATPL
METI_VIBCH      V-LMVAIIPVTKLIVGTFIGTTAAIVPLTIGAIPF-------VARLIESALLEVPTGLVEAAQSMGATPL
METI_YERPE      I---LLVWMIPFTRMIVGTSIGLQ-----AAIVPLTVGAAPFIARMVENALLEIPSGLVEAARAMGATPM
METI_ECO57      I---LLVWMIPFTRVIVGTSIGLQ-----AAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPM
MALF_VIBVY      ISILIFLFNQSFGEINGISPSWFS-DPIMAKSMVLIVNTWLYMMILCMGLLKAIPEDLYEASAIDGANFV
MALF_VIBVU      ISILIFLFNQSFGEINGISPSWFS-DPIMAKSMVLIVNTWLYMMILCMGLLKAIPEDLYEASAIDGANFV
AT2B4_RAT       IQYFVKFFIIGVTVLVVAVPEGLPL---------------------------------------------


                         +         .         .         .         .         *         .:210
query           QALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVEMFEVSQQIAAENYEPLVMYCTVAVLYAILC
TCYB_BACSU      KTLFRVILPQAFRVSIPPLSNTFISLIKDTSLASQILVAELFRKAQEIGARNLDQLVIYIEAAFIYWIIC
Y1079_HAEIN     QAFIRTIMPQALRISVPSLSNTFISTVKDTSLASLVLVTELFRVAQNITAANYEFILIYSEAALIYWIFC
YECS_SHIFL      QTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMA
YECS_ECOLI      QTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMA
YECS_ECOL6      QTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMA
YCKA_BACSU      QTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAIC
YXEN_BACSU      QAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGKMYASGNLKYFETYLAVAIVYWVLT
TCYM_BACSU      QTFRRVILPQALKVSIPNFTNLGIGFLHTTSIAAIVAVPEITGTATIVASDNYAFLEAFIGAAIIYWVLT
OCCM_RHIME      LLFRRIIIPQAIRQMLPGYSNEVVLMVKSTSLASTITLMEITGIAAKLISETYRPVEVFACAGAIYLTMN
GLNP_RICPR      LIMKDIILPQAINNIFPSLVNELVNLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILV
GLNP_RICFE      LIMKDIILPQAVKNIFPSLVNELVNLVKESAIISMLGEMDLMRRAQIVSIETYNYFFPMFIAACCYYILV
GLNP_RICTY      LIMKDIILPQAINNIFPSLVNELINLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILV
GLNP_RICCN      LITKDIILPQAVKNIFPSLVNELVNLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILV
GLNP_RICBR      LIMKDIILPQAIKNIFPSLTNELINLIKESAIISMFGEMDLMKRAQIVSLETYNYFFPMIVAACCYYILV
NOCM_AGRT5      LQFRRIVFPIAIRQALPAYGNEVMLIIKSTSLASTITIVEVTGLAKQIISATYSPVEVFIVAGAIYLFIT
GLNM_BACSU      QAMLHIILPQAIKIVIPPLGNQFLNLVKNSSILGVVAGLDLMYQADLVSSSTLVVFDVYIFVALFYLVLT
Y4TF_RHISN      QALWRVALPQAIPEMMPSFSNLAIAALKDTSLVSLITLHDLTFAAEQLRNFYQDSTTVYTMVLLMYFGIA
OCCM_RHIRD      KLFRRIVIPQAIRQMLPGYSNEVILMVKSTSLASTITIMEITGIAAKLISESYRTVEVFSCAGAIYLILN
NOCQ_AGRT5      LRLRRVLIPQAARFALPGLGNVWQFTLKDTSLISVVGLVEIMRTAAMGAGSTKQPFTFYITAFVIFLLLS
PATM_VIBHA      QAMRRVILPQATRVALPSLMNYFIDMIKSTSLAFTLGVAEIMAKAQMXXXXXXXXXXXXLAVALIYWGVV
GLTK_ECOLI      QSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVIS
GLTK_ECOL6      QSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVIS
GLTK_ECO57      QSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVIS
GLNP_SHIFL      ETIRYVIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIIT
GLNP_ECOLI      ETIRYVIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIIT
GLNP_ECOL6      ETIRYVIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIIT
GLNP_ECO57      ETIRYVIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIIT
ARTQ_HAEIN      YTFIHIVMPQVWRHALPGLSTQWLVLLKDTALVSLIGVDDLMHQADLINTNTHQPFTWYGIAALIY----
Y4TG_RHISN      RTFTHVILPQAIPRVIPALGNYLVSIMKDVPVLSVVTIVEMLNAAKIIGDQTFNYLVPLSMVGGIYLILT
HISM_SALTY      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAF-----------
HISM_SALTI      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAF-----------
ARTM_SHIFL      DTL-AILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMV-FGAAGIIYLVVN
ARTM_ECOLI      DTL-AILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMV-FGAAGIIYLVVN
ARTM_ECOL6      DTL-AILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMV-FGAAGIIYLVVN
ARTM_ECO57      DTL-AILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMV-FGAAGIIYLVVN
GLTJ_ECOLI      QAYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLIN
GLTJ_ECOL6      QAYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLIN
AAPM_RHIL3      QKTRLIIMPQAIKLVIPSIVNTFIGTFKDTSL---VTIIGMFDLSDANWASAVTPITGLIFAGFIFWLFC
HISQ_SALTY      QTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFT
HISQ_SALTI      QTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFT
TCYL_BACSU      QAFRRIVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDMSGRGQTLITSSNHSLEVYIALSIVYYAVA
HISQ_ECOLI      QVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFT
ARTQ_SHIFL      AIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVIT
ARTQ_ECOLI      AIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVIT
ARTQ_ECOL6      AIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVIT
ARTQ_BACSU      KMMKDLLLPQAFKNISPAIVNELITLTKESAIVTVIGLGDVMRRAYQAGAATYNYLEPLIIAGLIYYVLV
YHDY_ECOLI      KTQGLVILPQALKLVIPGLVNTIIALFKDTSL---VIIIGLFDLFSSVQQATVDPAWLYVFAALIYWIFC
HISM_SHIFL      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAF-----------
HISM_ECOLI      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAF-----------
HISM_ECOL6      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAF-----------
HISM_ECO57      KMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPFTAF-----------
GLUD_CORGL      QTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVVALIMIVLN
GLUC_COREF      DIFRSIIFPQAVRAAIIPLGNTLIALTKNTTIASVIGVGEA-SLLMKSTIENHANMVVFAIFAVGFMIL-
BZTC_RHOCA      QAQRLIIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLFDPLKGISNVVRSDWEP---YIFVALIFFLFN
GLUC_CORGL      ATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEA-SLLMKATIENHANMVVFAIFAVGFMIL-
AAPQ_RHIL3      SVTRLVVVPQALRIIIPPLTSQYLNLTKNSSLAIAIGFSDLVAVGGTILNQSGQAIEIVCIWGIVYLSLS
YHDX_ECOLI      VTLRQVIIPQALRVIIPPLTSQYLNIVKNSSLAAAIGYPDMVSLAGTVLNQTGQAIETIAMTMSVYLIIS
ARTM_HAEIN      QTL-KILIPYALKRALPSYSNEIILVFKGTALASTITIMDIMGYARQLYGTEYD----------------
GLNP_BACSU      QTLFFIVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIINGQS------------------
OCCQ_RHIRD      LLFRRIVLPQAARYALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQP---------------
OCCQ_AGRT4      LLFRRIVLPQAARYALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQP---------------
GLUD_COREF      QTTWSILLPQAVAAMLPALIAQMVIALKDSALGYQIGYIEVVRSGIQSASVN------------------
OCCQ_RHIME      LLFRRIILPQAARHALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQP---------------
BZTB_RHOCA      RTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSYMDL-----------------------------
METI_ECOLI      QIVRKVLLPEA----LPGLVN-----------AATITLITL-----------------------------
METI_SALTY      QIVRKILLPEA----LPGLVN-----------AATITLITL-----------------------------
METI_SALTI      QIVRKILLPEA----LPGLVN-----------AATITLITL-----------------------------
METI_VIBCH      QIIRKVLLPEALPTILNSVTITLVTLVSYSAMAXXXXXXXXXDVAIRYGFHRYD----------------
METI_YERPE      QIIKKVLLPEA----LPGLVN-----------AATITLITL-----------------------------
METI_ECO57      QIVRKVLLPEA----LPGLVN-----------AATITLITL-----------------------------
MALF_VIBVY      QNFTRVTLPLMIKPLTPLLIASF-----------------------------------------------
MALF_VIBVU      QNFTRVTLPLMIKPLTPLLIASF-----------------------------------------------
AT2B4_RAT       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TVLSFLQGWLEKVTSRYVATQ
TCYB_BACSU      FLLSLVQHVIERRLDRYVA--
Y1079_HAEIN     FVLSFLQDRLEIRLSRHL---
YECS_SHIFL      TVLSTLQNHFENQLNR-----
YECS_ECOLI      TVLSTLQNHFENQLNR-----
YECS_ECOL6      TVLSTLQNHFENQLNR-----
YCKA_BACSU      SIAAVFQNILEKKYAHYV---
YXEN_BACSU      IIYSILQDLFERAMSK-----
TCYM_BACSU      LILESANGVLERKAARF----
OCCM_RHIME      FIAARLFALIE----------
GLNP_RICPR      ILISFIAKIIEK---------
GLNP_RICFE      MLISFIAKIIEK---------
GLNP_RICTY      MLISFIAKIIEK---------
GLNP_RICCN      MLISFIAKIIEK---------
GLNP_RICBR      MLISFIARIIEK---------
NOCM_AGRT5      FVVSRL---------------
GLNM_BACSU      IPLSIGVNYLEK---------
Y4TF_RHISN      LVLSFFMRLIESSVTRW----
OCCM_RHIRD      FIVARLFTLLE----------
NOCQ_AGRT5      SVSN--RGFLEKWANRGVRSQ
PATM_VIBHA      VILTRVQIWAEKLNKAYV---
GLTK_ECOLI      LSASLLVSYLKRRTA------
GLTK_ECOL6      LSASLLVSYLKRRTA------
GLTK_ECO57      LSASLLVSYLKRRTA------
GLNP_SHIFL      LVLSFILRRLER---------
GLNP_ECOLI      LVLSFILRRLER---------
GLNP_ECOL6      LVLSFILRRLER---------
GLNP_ECO57      LVLSFILRRLER---------
ARTQ_HAEIN      ---------------------
Y4TG_RHISN      IVASAL---------------
HISM_SALTY      ---------------------
HISM_SALTI      ---------------------
ARTM_SHIFL      GLLTLMMRLIER---------
ARTM_ECOLI      GLLTLMMRLIER---------
ARTM_ECOL6      GLLTLMMRLIER---------
ARTM_ECO57      GLLTLMMRLIER---------
GLTJ_ECOLI      AFIMLVMTLVER---------
GLTJ_ECOL6      AFIMLVMTLVER---------
AAPM_RHIL3      FGMSRYSGFMER---------
HISQ_SALTY      TV-------------------
HISQ_SALTI      TV-------------------
TCYL_BACSU      VLFEWFFRVAEK---------
HISQ_ECOLI      TVSNGVLLFLER---------
ARTQ_SHIFL      LLSQYILKRIDLRATRF----
ARTQ_ECOLI      LLSQYILKRIDLRATRF----
ARTQ_ECOL6      LLSQYILKRIDLRATRF----
ARTQ_BACSU      LILTFIGKAVER---------
YHDY_ECOLI      FSMSRYSQYLEK---------
HISM_SHIFL      ---------------------
HISM_ECOLI      ---------------------
HISM_ECOL6      ---------------------
HISM_ECO57      ---------------------
GLUD_CORGL      FSLTALASRIER---------
GLUC_COREF      ---------------------
BZTC_RHOCA      FSMSRYSMYLERKLKR-----
GLUC_CORGL      ---------------------
AAPQ_RHIL3      ILTSLFMNW------------
YHDX_ECOLI      LTISLL---------------
ARTM_HAEIN      ---------------------
GLNP_BACSU      ---------------------
OCCQ_RHIRD      ---------------------
OCCQ_AGRT4      ---------------------
GLUD_COREF      ---------------------
OCCQ_RHIME      ---------------------
BZTB_RHOCA      ---------------------
METI_ECOLI      ---------------------
METI_SALTY      ---------------------
METI_SALTI      ---------------------
METI_VIBCH      ---------------------
METI_YERPE      ---------------------
METI_ECO57      ---------------------
MALF_VIBVY      ---------------------
MALF_VIBVU      ---------------------
AT2B4_RAT       ---------------------