[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00433.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    1::122     2e-35  52%  123 aa  DHAM_LACLA RecName: Full=PTS-dependent dihydroxyacetone kinase,
    1::121     1e-07  32%  473 aa  DHAM_ECOLI RecName: Full=PTS-dependent dihydroxyacetone kinase,
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLGITIVSHVYEVANGLPRLLTQVAKDVPITTAGGTEDNDVGTSMEKIMNAFEENDADEILAFYDLGSA
DHAM_LACLA      MTYGIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSA
DHAM_ECOLI      MMVNLVIVSHSSRLGEGVGELARQMSDSCKIAIAAGIDDNPIGTDAVKVMEAIESADADHVLVMMDMGSX


                         .         .         *         .         .         .         .:140
query           KMNLEMAIEMTDKKVHLYDVALIEGAYTAATLLEAGVDLQEVEKQLEPLKIK
DHAM_LACLA      RMNLDLVSEMTDKELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEKMLIE
DHAM_ECOLI      XXXXXXXXXXXXXKVRLCAAPLVEGTLAATVSAASGADIDKV----------