[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00441.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
  151::721     e-165  52%  721 aa  ATZN_SYNY3 RecName: Full=Zinc-transporting ATPase;       
  131::702     e-160  51%  702 aa  CADA_BACSU RecName: Full=Cadmium, zinc and cobalt-transporting
  115::685     e-135  44%  686 aa  HMCT_HELPY RecName: Full=Cadmium, zinc and cobalt-transporting
  115::685     e-133  43%  686 aa  HMCT_HELPJ RecName: Full=Cadmium, zinc and cobalt-transporting
   51::681     e-122  41%  681 aa  HMCT_HELFE RecName: Full=Cadmium, zinc and cobalt-transporting
  144::723     e-112  37%  723 aa  CADA_BACPF RecName: Full=Probable cadmium-transporting ATPase;     
  145::727     e-107  36%  727 aa  CADA1_STAAU RecName: Full=Probable cadmium-transporting ATPase;    
  144::726     e-102  34%  726 aa  CADA_STAAR RecName: Full=Probable cadmium-transporting ATPase;     
  222::804     e-101  34%  804 aa  CADA2_STAAU RecName: Full=Probable cadmium-transporting ATPase;    
  128::707     7e-98  33%  707 aa  CADA1_LISMO RecName: Full=Probable cadmium-transporting ATPase;    
  128::711     1e-96  34%  711 aa  CADA2_LISMO RecName: Full=Probable cadmium-transporting ATPase;    
   70::637     3e-95  35%  637 aa  ZOSA_BACSU RecName: Full=Zinc-transporting ATPase;       
  123::681     2e-85  33%  951 aa  AHM3_ARATH RecName: Full=Putative cadmium/zinc-transporting ATPase
  129::706     3e-79  31%  760 aa  AHM4_ARATH RecName: Full=Cadmium/zinc-transporting ATPase 4;       
  205::702     6e-76  38%  804 aa  COPA_ARCFU RecName: Full=Probable copper-exporting P-type ATPase A;
  165::732     8e-76  33%  732 aa  ATZN_ECOLI RecName: Full=Lead, cadmium, zinc and
  278::802     1e-73  32%  802 aa  COPA_BACSU RecName: Full=Copper-exporting P-type ATPase A;       
  257::793     4e-72  32%  794 aa  COPA_STAES RecName: Full=Copper-exporting P-type ATPase A;       
  257::793     4e-72  32%  794 aa  COPA_STAEQ RecName: Full=Copper-exporting P-type ATPase A;       
  150::644     9e-72  36%  690 aa  COPB_ARCFU RecName: Full=Probable copper-exporting P-type ATPase B;
  265::794     3e-71  34%  795 aa  COPA_STAHJ RecName: Full=Copper-exporting P-type ATPase A;       
  385::950     6e-71  35% 1001 aa  AHM5_ARATH RecName: Full=Copper-transporting ATPase RAN1;       
  257::783     2e-70  32%  824 aa  SILP_SALTY RecName: Full=Putative cation-transporting P-type
  167::728     7e-69  30% 1172 aa  AHM2_ARATH RecName: Full=Putative cadmium/zinc-transporting ATPase
  278::787     5e-67  31%  827 aa  ATCU2_RHIME RecName: Full=Copper-transporting ATPase 2;       
  406::939     2e-66  32%  995 aa  AHM7_ARATH RecName: Full=Putative copper-transporting ATPase 3;    
  186::742     4e-66  31%  745 aa  ATCS_SYNY3 RecName: Full=Cation-transporting ATPase pacS;       
  284::830     2e-65  32%  833 aa  COPA_SALTI RecName: Full=Copper-exporting P-type ATPase A;       
  284::830     2e-65  32%  833 aa  COPA_SALTY RecName: Full=Copper-exporting P-type ATPase A;       
  278::787     4e-65  31%  827 aa  ATCU_SINMW RecName: Full=Copper-transporting P-type ATPase;        
  277::786     5e-65  31%  826 aa  ATCU1_RHIME RecName: Full=Copper-transporting ATPase 1;       
  190::696     3e-64  31%  727 aa  COPA_ENTHR RecName: Full=Probable copper-importing P-type ATPase A;
  265::799     5e-64  31%  802 aa  COPA_STAAT RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     5e-64  31%  802 aa  COPA_STAAE RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     5e-64  31%  802 aa  COPA_STAAC RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     5e-64  31%  802 aa  COPA_STAA8 RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     5e-64  31%  802 aa  COPA_STAA3 RecName: Full=Copper-exporting P-type ATPase A;       
  225::768     2e-63  30%  770 aa  CTPV_MYCTU RecName: Full=Probable cation-transporting ATPase V;    
  258::799     2e-63  30%  802 aa  COPA_STAAN RecName: Full=Copper-exporting P-type ATPase A;       
  258::799     2e-63  30%  802 aa  COPA_STAAM RecName: Full=Copper-exporting P-type ATPase A;       
  258::799     2e-63  30%  802 aa  COPA_STAA9 RecName: Full=Copper-exporting P-type ATPase A;       
  258::799     2e-63  30%  802 aa  COPA_STAA2 RecName: Full=Copper-exporting P-type ATPase A;       
  258::799     2e-63  30%  802 aa  COPA_STAA1 RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     6e-63  31%  802 aa  COPA_STAAW RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     6e-63  31%  802 aa  COPA_STAAS RecName: Full=Copper-exporting P-type ATPase A;       
  265::793     3e-62  29%  794 aa  COPA_STAS1 RecName: Full=Copper-exporting P-type ATPase A;       
  265::799     5e-62  31%  802 aa  COPA_STAAR RecName: Full=Copper-exporting P-type ATPase A;       
  187::721     1e-61  31%  722 aa  Y290_HAEIN RecName: Full=Probable cation-transporting ATPase
  265::799     1e-61  30%  802 aa  COPA_STAAB RecName: Full=Copper-exporting P-type ATPase A;       
  187::685     3e-61  33%  732 aa  COPA_HELFE RecName: Full=Copper-transporting ATPase;       
  285::831     5e-60  31%  834 aa  COPA_ECO57 RecName: Full=Copper-exporting P-type ATPase A;       
  285::831     2e-59  32%  834 aa  COPA_ECOLI RecName: Full=Copper-exporting P-type ATPase A;       
  412::958     3e-59  30%  961 aa  COPA_YERPE RecName: Full=Copper-exporting P-type ATPase A;       
  772::1345    3e-59  32% 1462 aa  ATP7B_MOUSE RecName: Full=Copper-transporting ATPase 2;       
  810::1388    9e-59  33% 1505 aa  ATP7B_SHEEP RecName: Full=Copper-transporting ATPase 2;       
  763::1336    2e-58  32% 1451 aa  ATP7B_RAT RecName: Full=Copper-transporting ATPase 2;       
  770::1348    2e-58  32% 1465 aa  ATP7B_HUMAN RecName: Full=Copper-transporting ATPase 2;       
  277::802     3e-58  30%  841 aa  ATCU_RHILV RecName: Full=Copper-transporting P-type ATPase;        
  190::696     3e-58  32%  741 aa  COPA2_HELPY RecName: Full=Copper-transporting ATPase;       
  768::1374    4e-58  32% 1476 aa  ATP7A_CRIGR RecName: Full=Copper-transporting ATPase 1;       
  129::669     6e-58  29%  672 aa  COPB_STAAU RecName: Full=Probable copper-transporting P-type ATPase
  138::678     6e-58  29%  681 aa  COPB_STAAR RecName: Full=Probable copper-transporting P-type ATPase
  363::923     6e-58  30% 1004 aa  ATU2_YEAST RecName: Full=Copper-transporting ATPase;       
  194::700     3e-57  32%  745 aa  COPA3_HELPY RecName: Full=Copper-transporting ATPase;       
  194::700     8e-57  32%  745 aa  COPA1_HELPY RecName: Full=Copper-transporting ATPase;       
  198::744     7e-56  29%  761 aa  CTPA_MYCTU RecName: Full=Cation-transporting P-type ATPase A;      
  217::737     9e-56  28%  761 aa  FIXI_RHILV RecName: Full=Nitrogen fixation protein fixI;AltName:
  151::645     1e-55  32%  725 aa  CTPC_MYCLE RecName: Full=Probable cation-transporting P-type ATPase
  329::830     1e-54  35%  904 aa  ATU2_SCHPO RecName: Full=Copper-transporting ATPase ccc2;       
  205::696     2e-54  31%  745 aa  COPB_ENTHR RecName: Full=Copper-exporting P-type ATPase B;       
  194::700     2e-54  31%  745 aa  COPA_HELPJ RecName: Full=Copper-transporting ATPase;       
  191::721     9e-54  30%  730 aa  FIXI_BRAJA RecName: Full=Nitrogen fixation protein fixI;AltName:
  212::741     3e-53  28%  747 aa  ATCS_SYNE7 RecName: Full=Cation-transporting ATPase pacS;       
  194::700     7e-53  31%  745 aa  COPA_HELPY RecName: Full=Copper-transporting ATPase;       
  424::908     2e-52  32%  915 aa  COPA_VIBCH RecName: Full=Copper-exporting P-type ATPase A;       
  250::724     5e-52  30%  780 aa  CTPA_MYCLE RecName: Full=Cation-transporting P-type ATPase A;      
  173::782     2e-51  29%  819 aa  AHM1_ARATH RecName: Full=Probable cadmium/zinc-transporting ATPase
  131::671     2e-49  27%  674 aa  COPB_STAAT RecName: Full=Probable copper-transporting P-type ATPase
  131::671     2e-49  27%  674 aa  COPB_STAA3 RecName: Full=Probable copper-transporting P-type ATPase
  137::599     3e-49  30%  718 aa  CTPC_MYCTU RecName: Full=Probable cation-transporting P-type ATPase
  137::599     3e-49  30%  718 aa  CTPC_MYCBO RecName: Full=Probable cation-transporting P-type ATPase
  131::671     8e-49  27%  674 aa  COPB_STAES RecName: Full=Probable copper-transporting P-type ATPase
  348::943     1e-48  29%  949 aa  AHM6_ARATH RecName: Full=Putative copper-transporting ATPase PAA1; 
  778::1365    2e-48  32% 1491 aa  ATP7A_MOUSE RecName: Full=Copper-transporting ATPase 1;       
  779::1366    1e-47  32% 1492 aa  ATP7A_RAT RecName: Full=Copper-transporting ATPase 1;       
  131::671     2e-47  27%  674 aa  COPB_STAEQ RecName: Full=Probable copper-transporting P-type ATPase
  213::746     8e-47  28%  752 aa  CTPB_MYCTU RecName: Full=Cation-transporting P-type ATPase B;      
  213::746     8e-47  28%  752 aa  CTPB_MYCBO RecName: Full=Cation-transporting P-type ATPase B;      
  131::623     8e-47  27%  674 aa  COPB_STAHJ RecName: Full=Probable copper-transporting P-type ATPase
  254::740     1e-46  28%  750 aa  CTPB_MYCLE RecName: Full=Cation-transporting P-type ATPase B;      
  112::644     3e-45  26%  657 aa  CTPD_MYCTU RecName: Full=Probable cation-transporting P-type ATPase
  112::644     3e-45  26%  657 aa  CTPD_MYCBO RecName: Full=Probable cation-transporting P-type ATPase
  209::734     6e-45  27%  757 aa  FIXI_RHIME RecName: Full=Nitrogen fixation protein fixI;AltName:
  787::1374    2e-43  32% 1500 aa  ATP7A_HUMAN RecName: Full=Copper-transporting ATPase 1;       
   83::587     4e-43  31%  697 aa  ATKB_BACC7 RecName: Full=Potassium-transporting ATPase B chain;    
  109::607     4e-42  29%  686 aa  ATKB2_LISIN RecName: Full=Potassium-transporting ATPase B chain 2; 
  637::1180    6e-42  27% 1216 aa  ATU1_YEAST RecName: Full=Probable copper-transporting ATPase;        
  111::569     1e-41  29%  681 aa  ATKB_THETN RecName: Full=Potassium-transporting ATPase B chain;    
  264::756     1e-40  25%  771 aa  CTPG_MYCTU RecName: Full=Probable cation-transporting ATPase G;    
  264::756     1e-40  25%  771 aa  CTPG_MYCBO RecName: Full=Probable cation-transporting ATPase G;    
  116::587     1e-40  29%  698 aa  ATKB_BACCN RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     2e-40  29%  697 aa  ATKB_BACCR RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     3e-40  30%  697 aa  ATKB_BACWK RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     5e-40  30%  697 aa  ATKB_BACC4 RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     5e-40  30%  697 aa  ATKB_BACC2 RecName: Full=Potassium-transporting ATPase B chain;    
  114::566     9e-40  28%  685 aa  ATKB_CLOAB RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     1e-39  29%  697 aa  ATKB_BACCZ RecName: Full=Potassium-transporting ATPase B chain;    
   77::582     2e-39  29%  692 aa  ATKB_BACC3 RecName: Full=Potassium-transporting ATPase B chain;    
   85::611     8e-39  28%  668 aa  ATKB_THEVO RecName: Full=Potassium-transporting ATPase B chain;    
   12::627     8e-39  28%  692 aa  ATKB_LEPIC RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     8e-39  29%  697 aa  ATKB_BACHK RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     8e-39  29%  697 aa  ATKB_BACC0 RecName: Full=Potassium-transporting ATPase B chain;    
   77::582     8e-39  29%  692 aa  ATKB_BACAH RecName: Full=Potassium-transporting ATPase B chain;    
   82::587     8e-39  29%  697 aa  ATKB_BACAC RecName: Full=Potassium-transporting ATPase B chain;    
   12::627     1e-38  28%  697 aa  ATKB_LEPIN RecName: Full=Potassium-transporting ATPase B chain;    
   58::608     3e-38  28%  665 aa  ATKB_THEAC RecName: Full=Potassium-transporting ATPase B chain;    
  198::742     7e-38  28%  790 aa  ATSY_SYNE7 RecName: Full=Probable copper-transporting ATPase synA; 
  264::742     4e-37  29%  790 aa  ATSY_SYNP6 RecName: Full=Probable copper-transporting ATPase synA; 
   54::567     3e-36  27%  682 aa  ATKB_XANCP RecName: Full=Potassium-transporting ATPase B chain;    
   66::563     4e-36  27%  673 aa  ATKB_STAHJ RecName: Full=Potassium-transporting ATPase B chain;    
   88::588     5e-36  26%  701 aa  ATKB1_ANASP RecName: Full=Potassium-transporting ATPase B chain 1; 
   54::567     8e-36  27%  682 aa  ATKB_XANAC RecName: Full=Potassium-transporting ATPase B chain;    
  133::571     8e-36  29%  686 aa  ATKB_CAUCR RecName: Full=Potassium-transporting ATPase B chain;    
   66::563     9e-35  27%  673 aa  ATKB_STAEQ RecName: Full=Potassium-transporting ATPase B chain;    
   66::563     9e-35  27%  673 aa  ATKB1_STAAR RecName: Full=Potassium-transporting ATPase B chain 1; 
   66::563     9e-35  27%  673 aa  ATKB1_STAAN RecName: Full=Potassium-transporting ATPase B chain 1; 
   66::563     9e-35  27%  673 aa  ATKB1_STAAM RecName: Full=Potassium-transporting ATPase B chain 1; 
  109::602     2e-34  28%  675 aa  ATKB_STAAB RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     2e-34  28%  675 aa  ATKB2_STAAR RecName: Full=Potassium-transporting ATPase B chain 2; 
  109::596     3e-34  28%  675 aa  ATKB_STAAW RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     3e-34  28%  675 aa  ATKB_STAAS RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     3e-34  28%  675 aa  ATKB_STAAT RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     3e-34  28%  675 aa  ATKB_STAAE RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     3e-34  28%  675 aa  ATKB_STAAC RecName: Full=Potassium-transporting ATPase B chain;    
   84::560     3e-34  27%  675 aa  ATKB_DEIRA RecName: Full=Potassium-transporting ATPase B chain;    
  109::596     3e-34  28%  675 aa  ATKB2_STAAN RecName: Full=Potassium-transporting ATPase B chain 2; 
  109::596     3e-34  28%  675 aa  ATKB2_STAAM RecName: Full=Potassium-transporting ATPase B chain 2; 
   52::596     8e-34  26%  680 aa  ATKB_RHIME RecName: Full=Potassium-transporting ATPase B chain;    
  130::598     3e-33  26%  708 aa  ATKB2_ANASP RecName: Full=Potassium-transporting ATPase B chain 2; 
   84::594     5e-33  27%  709 aa  ATKB_MYCTU RecName: Full=Potassium-transporting ATPase B chain;    
   84::594     5e-33  27%  709 aa  ATKB_MYCBO RecName: Full=Potassium-transporting ATPase B chain;    
  128::580     5e-32  27%  690 aa  ATKB_SYNY3 RecName: Full=Potassium-transporting ATPase B chain;    
  156::591     9e-32  29%  707 aa  ATKB_STRCO RecName: Full=Potassium-transporting ATPase B chain;    
  116::574     2e-31  28%  686 aa  ATKB_MYXXA RecName: Full=Potassium-transporting ATPase B chain;    
   51::582     5e-31  28%  694 aa  ATKB_AGRT5 RecName: Full=Potassium-transporting ATPase B chain;    
   57::569     2e-30  27%  681 aa  ATKB1_LISIN RecName: Full=Potassium-transporting ATPase B chain 1; 
  136::606     4e-30  29%  719 aa  ATKB_HALSA RecName: Full=Potassium-transporting ATPase B chain;    
  111::576     9e-30  27%  688 aa  ATKB_CLOBA RecName: Full=Potassium-transporting ATPase B chain;    
   63::578     1e-29  28%  697 aa  ATKB_RHILO RecName: Full=Potassium-transporting ATPase B chain;    
  125::575     1e-29  29%  690 aa  ATKB_PSEAE RecName: Full=Potassium-transporting ATPase B chain;    
  111::576     4e-29  27%  688 aa  ATKB_CLOBB RecName: Full=Potassium-transporting ATPase B chain;    
   57::569     2e-28  26%  681 aa  ATKB_LISMO RecName: Full=Potassium-transporting ATPase B chain;    
   57::569     2e-28  26%  681 aa  ATKB_LISMF RecName: Full=Potassium-transporting ATPase B chain;    
   57::569     2e-28  26%  681 aa  ATKB_LISMC RecName: Full=Potassium-transporting ATPase B chain;    
   50::565     3e-28  25%  676 aa  ATKB_ENTFA RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     6e-28  25%  688 aa  ATKB_YERPY RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     6e-28  25%  688 aa  ATKB_YERPS RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     6e-28  25%  688 aa  ATKB_YERP3 RecName: Full=Potassium-transporting ATPase B chain;    
  132::610     6e-28  28%  691 aa  ATKB_POLSQ RecName: Full=Potassium-transporting ATPase B chain;    
   57::569     6e-28  26%  681 aa  ATKB_LISMH RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPP RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPN RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPG RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPE RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPB RecName: Full=Potassium-transporting ATPase B chain;    
   39::576     8e-28  25%  688 aa  ATKB_YERPA RecName: Full=Potassium-transporting ATPase B chain;    
  119::569     8e-28  27%  681 aa  ATKB_LISW6 RecName: Full=Potassium-transporting ATPase B chain;    
   64::576     2e-27  26%  688 aa  ATKB_PHOLL RecName: Full=Potassium-transporting ATPase B chain;    
   96::576     3e-27  27%  688 aa  ATKB_CLOP1 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     4e-27  27%  682 aa  ATKB_SHIBS RecName: Full=Potassium-transporting ATPase B chain;    
  133::240     5e-27  30%  701 aa  ATKB_ANASL RecName: Full=Potassium-transporting ATPase B chain;    
   64::576     2e-26  25%  688 aa  ATKB_YERE8 RecName: Full=Potassium-transporting ATPase B chain;    
  110::672     6e-26  26%  744 aa  ATKB_RALSO RecName: Full=Potassium-transporting ATPase B chain;    
   64::576     2e-24  26%  688 aa  ATKB_DECAR RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     4e-23  25%  682 aa  ATKB_ECOLU RecName: Full=Potassium-transporting ATPase B chain;    
   63::568     5e-23  22%  684 aa  ATKB_HYDS0 RecName: Full=Potassium-transporting ATPase B chain;    
  120::672     1e-22  26%  805 aa  Y1226_METJA RecName: Full=Putative cation-transporting ATPase
   64::576     1e-22  25%  689 aa  ATKB_SERP5 RecName: Full=Potassium-transporting ATPase B chain;    
  106::673     1e-22  28%  899 aa  ATC1_SCHPO RecName: Full=Calcium-transporting ATPase 1;       
   48::570     2e-22  24%  682 aa  ATKB_KLEP3 RecName: Full=Potassium-transporting ATPase B chain;    
   48::570     3e-22  24%  682 aa  ATKB_KLEP7 RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     9e-22  25%  682 aa  ATKB_ERWT9 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     4e-21  25%  682 aa  ATKB_ECOSM RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     6e-21  25%  682 aa  ATKB_ECO5E RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     6e-21  25%  682 aa  ATKB_ECO57 RecName: Full=Potassium-transporting ATPase B chain;    
   49::617     7e-21  25%  682 aa  ATKB_ECOL6 RecName: Full=Potassium-transporting ATPase B chain;    
   49::617     7e-21  25%  682 aa  ATKB_ECOL5 RecName: Full=Potassium-transporting ATPase B chain;    
   49::617     7e-21  25%  682 aa  ATKB_ECO81 RecName: Full=Potassium-transporting ATPase B chain;    
   49::617     7e-21  25%  682 aa  ATKB_ECO27 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECOSE RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECO7I RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECO24 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_SHISS RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ESCF3 RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     1e-20  25%  682 aa  ATKB_ECOLI RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECOHS RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     1e-20  25%  682 aa  ATKB_ECODH RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     1e-20  25%  682 aa  ATKB_ECOBW RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECO8A RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     1e-20  25%  682 aa  ATKB_ECO55 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-20  25%  682 aa  ATKB_SALCH RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     2e-20  25%  682 aa  ATKB_ECOLC RecName: Full=Potassium-transporting ATPase B chain;    
  207::841     3e-20  25% 1058 aa  PMA1_DICDI RecName: Full=Probable plasma membrane ATPase;       
   64::617     3e-20  25%  682 aa  ATKB_SHIB3 RecName: Full=Potassium-transporting ATPase B chain;    
  222::888     3e-20  28% 1020 aa  ACA1_ORYSJ RecName: Full=Calcium-transporting ATPase 1, plasma
   64::617     5e-20  25%  682 aa  ATKB_ECOUT RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     5e-20  25%  682 aa  ATKB_ECOK1 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     5e-20  25%  682 aa  ATKB_ECO45 RecName: Full=Potassium-transporting ATPase B chain;    
  119::576     6e-20  25%  688 aa  ATKB_TOLAT RecName: Full=Potassium-transporting ATPase B chain;    
   64::570     6e-20  25%  682 aa  ATKB_ENT38 RecName: Full=Potassium-transporting ATPase B chain;    
  147::703     2e-19  26%  949 aa  PMA5_ARATH RecName: Full=ATPase 5, plasma membrane-type;       
   64::617     2e-19  24%  682 aa  ATKB_SALSV RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALPB RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALTY RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALNS RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALHS RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  685 aa  ATKB_SALG2 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALEP RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALDC RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     2e-19  24%  682 aa  ATKB_SALA4 RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     4e-19  24%  682 aa  ATKB_SALPK RecName: Full=Potassium-transporting ATPase B chain;    
   64::617     4e-19  24%  682 aa  ATKB_SALPA RecName: Full=Potassium-transporting ATPase B chain;    
  250::892     1e-18  25% 1033 aa  ACA2_ORYSJ RecName: Full=Calcium-transporting ATPase 2, plasma
  122::666     9e-16  26%  874 aa  ATCL_MYCGE RecName: Full=Probable cation-transporting P-type
  569::757     1e-15  31% 1115 aa  ATC1_DICDI RecName: Full=Calcium-transporting ATPase PAT1;       
  638::866     1e-15  32% 1017 aa  ACA13_ARATH RecName: Full=Putative calcium-transporting ATPase 13,
  240::476     2e-15  27% 1025 aa  ACA11_ARATH RecName: Full=Putative calcium-transporting ATPase 11,
  140::701     2e-15  24%  961 aa  PMA7_ARATH RecName: Full=ATPase 7, plasma membrane-type;       
  209::449     3e-15  26% 1017 aa  ACA5_ORYSJ RecName: Full=Probable calcium-transporting ATPase 5,
  181::743     4e-15  25%  916 aa  PMA1_AJECA RecName: Full=Plasma membrane ATPase;       
  259::525     4e-15  29% 1020 aa  ACA1_ARATH RecName: Full=Calcium-transporting ATPase 1,
  137::703     5e-15  24%  948 aa  PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type;       
  221::469     5e-15  27% 1015 aa  ACA7_ARATH RecName: Full=Putative calcium-transporting ATPase 7,
  142::708     6e-15  24%  957 aa  PMA1_NICPL RecName: Full=Plasma membrane ATPase 1;       
  220::504     6e-15  27% 1014 aa  ACA2_ARATH RecName: Full=Calcium-transporting ATPase 2, plasma
  526::858     8e-15  28% 1021 aa  ACA6_ORYSJ RecName: Full=Probable calcium-transporting ATPase 6,
  660::891     8e-15  30% 1043 aa  ACA3_ORYSJ RecName: Full=Calcium-transporting ATPase 3, plasma
  231::471     1e-14  27% 1039 aa  ACA4_ORYSJ RecName: Full=Probable calcium-transporting ATPase 4,
  240::476     1e-14  27% 1030 aa  ACA4_ARATH RecName: Full=Calcium-transporting ATPase 4, plasma
  141::707     1e-14  25%  956 aa  PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1;       
  161::739     1e-14  25%  919 aa  PMA1_SCHPO RecName: Full=Plasma membrane ATPase 1;       
  642::875     1e-14  31% 1033 aa  ACA12_ARATH RecName: Full=Putative calcium-transporting ATPase 12,
  168::272     5e-14  30% 1203 aa  AT2B4_RAT RecName: Full=Plasma membrane calcium-transporting ATPase
  587::782     9e-14  38% 1037 aa  ATC3_SCHPO RecName: Full=Calcium-transporting ATPase 3;       
   70::632     1e-13  22%  778 aa  EXP7_STRPN RecName: Full=Probable cation-transporting ATPase exp7; 
  572::726     2e-13  35%  950 aa  ATC1_YEAST RecName: Full=Calcium-transporting ATPase 1;       
  395::579     2e-13  28% 1241 aa  AT2B4_HUMAN RecName: Full=Plasma membrane calcium-transporting
  405::489     2e-13  32% 1220 aa  AT2B1_PIG RecName: Full=Plasma membrane calcium-transporting ATPase
  405::489     2e-13  32% 1258 aa  AT2B1_HUMAN RecName: Full=Plasma membrane calcium-transporting
  185::747     3e-13  23%  920 aa  PMA1_NEUCR RecName: Full=Plasma membrane ATPase;       
   64::166     3e-13  27%  569 aa  ATKB_SALTI RecName: Full=Putative potassium-transporting ATPase B
  775::979     3e-13  30% 1292 aa  ATC2_SCHPO RecName: Full=Calcium-transporting ATPase 2;       
  396::557     3e-13  30% 1258 aa  AT2B3_RAT RecName: Full=Plasma membrane calcium-transporting ATPase
  396::557     3e-13  30% 1220 aa  AT2B3_HUMAN RecName: Full=Plasma membrane calcium-transporting
  405::489     4e-13  30% 1258 aa  AT2B1_RAT RecName: Full=Plasma membrane calcium-transporting ATPase
  181::406     6e-13  29% 1039 aa  AT12A_HUMAN RecName: Full=Potassium-transporting ATPase alpha chain
  152::609     7e-13  25%  797 aa  CTPE_MYCTU RecName: Full=Probable cation-transporting ATPase E;    
  152::609     7e-13  25%  797 aa  CTPE_MYCBO RecName: Full=Probable cation-transporting ATPase E;    
  140::706     1e-12  24%  952 aa  PMA4_NICPL RecName: Full=Plasma membrane ATPase 4;       
  148::400     1e-12  28% 1033 aa  AT12A_CAVPO RecName: Full=Potassium-transporting ATPase alpha chain
  142::708     1e-12  24%  954 aa  PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type;       
  111::699     1e-12  26%  898 aa  ATMA_ECOLI RecName: Full=Magnesium-transporting ATPase, P-type 1;  
  111::699     1e-12  26%  898 aa  ATMA_ECO57 RecName: Full=Magnesium-transporting ATPase, P-type 1;  
  417::596     1e-12  28% 1112 aa  AT2B2_OREMO RecName: Full=Plasma membrane calcium-transporting
   81::526     2e-12  26%  928 aa  ATC1_YARLI RecName: Full=Calcium-transporting ATPase 1;       
  474::654     3e-12  31%  872 aa  ATCL_MYCPN RecName: Full=Probable cation-transporting P-type
  155::400     3e-12  28%  946 aa  AT2C2_HUMAN RecName: Full=Calcium-transporting ATPase type 2C
  706::850     3e-12  36% 1035 aa  AT12A_MOUSE RecName: Full=Potassium-transporting ATPase alpha chain
  141::707     4e-12  24%  956 aa  PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type;       
  405::489     4e-12  31% 1249 aa  AT2B1_RABIT RecName: Full=Plasma membrane calcium-transporting
  149::403     4e-12  29% 1036 aa  AT12A_RAT RecName: Full=Potassium-transporting ATPase alpha chain
  137::703     5e-12  23%  949 aa  PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type;       
  808::913     5e-12  38% 1173 aa  ATC2_YEAST RecName: Full=Calcium-transporting ATPase 2;       
  134::718     6e-12  26%  944 aa  AT2C2_RAT RecName: Full=Calcium-transporting ATPase type 2C member
  155::695     8e-12  25%  902 aa  ATMA_SALTY RecName: Full=Magnesium-transporting ATPase, P-type 1;  
  122::362     1e-11  26%  926 aa  ATCL_SYNE7 RecName: Full=Probable calcium-transporting ATPase;     
  793::916     1e-11  30% 1243 aa  AT2B2_RAT RecName: Full=Plasma membrane calcium-transporting ATPase
  748::871     1e-11  30% 1198 aa  AT2B2_MOUSE RecName: Full=Plasma membrane calcium-transporting
  793::916     1e-11  30% 1243 aa  AT2B2_HUMAN RecName: Full=Plasma membrane calcium-transporting
  137::728     2e-11  24%  899 aa  PMA1_KLULA RecName: Full=Plasma membrane ATPase;       
  117::390     2e-11  30% 1091 aa  ATN5_YEAST RecName: Full=Sodium transport ATPase 5;       
  117::390     2e-11  30% 1091 aa  ATN2_YEAST RecName: Full=Sodium transport ATPase 2;       
  117::390     2e-11  30% 1091 aa  ATN1_YEAST RecName: Full=Sodium transport ATPase 1;       
  153::718     3e-11  26%  944 aa  AT2C2_MOUSE RecName: Full=Calcium-transporting ATPase type 2C
  106::399     4e-11  26% 1061 aa  ECA4_ARATH RecName: Full=Calcium-transporting ATPase 4, endoplasmic
  134::397     4e-11  31% 1031 aa  AT1A_HYDAT RecName: Full=Sodium/potassium-transporting ATPase
  603::790     4e-11  36% 1042 aa  AT12A_BUFMA RecName: Full=Potassium-transporting ATPase alpha chain
  128::749     5e-11  23%  920 aa  PMA1_ZYGRO RecName: Full=Plasma membrane ATPase;       
  465::718     7e-11  26%  895 aa  PMA1_CANAL RecName: Full=Plasma membrane ATPase 1;       
  106::399     7e-11  26% 1061 aa  ECA1_ARATH RecName: Full=Calcium-transporting ATPase 1, endoplasmic
  144::398     7e-11  28% 1031 aa  ATP4A_XENLA RecName: Full=Potassium-transporting ATPase alpha chain
  124::690     7e-11  27%  919 aa  AT2C1_RAT RecName: Full=Calcium-transporting ATPase type 2C member
  130::368     7e-11  29%  996 aa  AT1A_ARTSF RecName: Full=Sodium/potassium-transporting ATPase
  693::770     7e-11  42% 1021 aa  AT1A1_CANFA RecName: Full=Sodium/potassium-transporting ATPase
  767::852     7e-11  39% 1069 aa  ACA10_ARATH RecName: Full=Calcium-transporting ATPase 10, plasma
  158::724     9e-11  26%  953 aa  AT2C1_BOVIN RecName: Full=Calcium-transporting ATPase type 2C
  236::461     9e-11  29% 1094 aa  AT12A_RABIT RecName: Full=Potassium-transporting ATPase alpha chain
  196::318     9e-11  33% 1074 aa  ACA8_ARATH RecName: Full=Calcium-transporting ATPase 8, plasma
  529::688     1e-10  32%  890 aa  ATCL_BACSU RecName: Full=Calcium-transporting ATPase;       
  124::689     1e-10  26%  918 aa  AT2C1_PONAB RecName: Full=Calcium-transporting ATPase type 2C
  124::690     1e-10  26%  919 aa  AT2C1_HUMAN RecName: Full=Calcium-transporting ATPase type 2C
  146::383     1e-10  33% 1014 aa  AT1A_TAESO RecName: Full=Sodium/potassium-transporting ATPase
  163::400     2e-10  28% 1033 aa  ATP4A_RAT RecName: Full=Potassium-transporting ATPase alpha chain
  165::402     2e-10  27% 1035 aa  ATP4A_RABIT RecName: Full=Potassium-transporting ATPase alpha chain
  164::401     2e-10  27% 1034 aa  ATP4A_PIG RecName: Full=Potassium-transporting ATPase alpha chain
  163::400     2e-10  28% 1033 aa  ATP4A_MOUSE RecName: Full=Potassium-transporting ATPase alpha chain
  165::402     2e-10  27% 1035 aa  ATP4A_HUMAN RecName: Full=Potassium-transporting ATPase alpha chain
  164::401     2e-10  27% 1034 aa  ATP4A_CANFA RecName: Full=Potassium-transporting ATPase alpha chain
  554::770     2e-10  32%  947 aa  PMA2_YEAST RecName: Full=Plasma membrane ATPase 2;       
  897::963     2e-10  40% 1228 aa  ATC_PLAFK RecName: Full=Calcium-transporting ATPase;       
  154::391     2e-10  32% 1023 aa  AT1A1_RAT RecName: Full=Sodium/potassium-transporting ATPase
  154::391     2e-10  32% 1023 aa  AT1A1_MOUSE RecName: Full=Sodium/potassium-transporting ATPase
  766::865     2e-10  34% 1086 aa  ACA9_ARATH RecName: Full=Calcium-transporting ATPase 9, plasma
  118::380     3e-10  29% 1048 aa  ECAP_SOLLC RecName: Full=Calcium-transporting ATPase, endoplasmic
  126::372     3e-10  31% 1004 aa  AT1B_ARTSF RecName: Full=Sodium/potassium-transporting ATPase
  164::401     3e-10  30% 1032 aa  AT1A4_MOUSE RecName: Full=Sodium/potassium-transporting ATPase
  119::388     3e-10  28% 1054 aa  ECA2_ARATH RecName: Full=Calcium-transporting ATPase 2, endoplasmic
  124::370     3e-10  27%  918 aa  AT2C1_MOUSE RecName: Full=Calcium-transporting ATPase type 2C
  154::391     3e-10  31% 1022 aa  AT1A_TORCA RecName: Full=Sodium/potassium-transporting ATPase
  144::381     3e-10  32% 1013 aa  AT1A3_RAT RecName: Full=Sodium/potassium-transporting ATPase
  141::378     3e-10  32% 1010 aa  AT1A3_OREMO RecName: Full=Sodium/potassium-transporting ATPase
  144::381     3e-10  32% 1013 aa  AT1A3_MOUSE RecName: Full=Sodium/potassium-transporting ATPase
  144::381     3e-10  32% 1013 aa  AT1A3_HUMAN RecName: Full=Sodium/potassium-transporting ATPase
  152::389     3e-10  31% 1020 aa  AT1A2_PONAB RecName: Full=Sodium/potassium-transporting ATPase
  152::389     3e-10  31% 1021 aa  AT1A1_SHEEP RecName: Full=Sodium/potassium-transporting ATPase
  154::391     3e-10  31% 1023 aa  AT1A1_RABIT RecName: Full=Sodium/potassium-transporting ATPase
  154::391     3e-10  31% 1023 aa  AT1A1_PONAB RecName: Full=Sodium/potassium-transporting ATPase
  154::444     3e-10  30% 1023 aa  AT1A1_OREMO RecName: Full=Sodium/potassium-transporting ATPase
  154::391     3e-10  31% 1023 aa  AT1A1_HUMAN RecName: Full=Sodium/potassium-transporting ATPase
  152::389     3e-10  30% 1021 aa  AT1A1_HORSE RecName: Full=Sodium/potassium-transporting ATPase
  152::389     3e-10  32% 1021 aa  AT1A1_CHICK RecName: Full=Sodium/potassium-transporting ATPase
  152::389     3e-10  31% 1021 aa  AT1A1_BOVIN RecName: Full=Sodium/potassium-transporting ATPase
  153::390     3e-10  30% 1022 aa  AT1A1_ANGAN RecName: Full=Sodium/potassium-transporting ATPase
  525::747     4e-10  28%  918 aa  PMA1_YEAST RecName: Full=Plasma membrane ATPase 1;       
  162::399     4e-10  30% 1029 aa  AT1A4_HUMAN RecName: Full=Sodium/potassium-transporting ATPase
  141::378     4e-10  31% 1010 aa  AT1A3_CHICK RecName: Full=Sodium/potassium-transporting ATPase
  149::386     4e-10  30% 1017 aa  AT1A2_CHICK RecName: Full=Sodium/potassium-transporting ATPase
  152::389     4e-10  31% 1020 aa  AT1A2_BOVIN RecName: Full=Sodium/potassium-transporting ATPase
  156::418     4e-10  29% 1025 aa  AT1A1_XENLA RecName: Full=Sodium/potassium-transporting ATPase
  154::416     4e-10  29% 1023 aa  AT1A1_BUFMA RecName: Full=Sodium/potassium-transporting ATPase
  625::790     6e-10  40% 1041 aa  ATNA_DROME RecName: Full=Sodium/potassium-transporting ATPase
   70::352     6e-10  29%  905 aa  ATA1_SYNY3 RecName: Full=Cation-transporting ATPase pma1;       
  152::389     6e-10  31% 1020 aa  AT1A2_RAT RecName: Full=Sodium/potassium-transporting ATPase
  152::389     6e-10  31% 1020 aa  AT1A2_MOUSE RecName: Full=Sodium/potassium-transporting ATPase
  152::389     6e-10  31% 1020 aa  AT1A2_HUMAN RecName: Full=Sodium/potassium-transporting ATPase
   30::455     8e-10  26%  704 aa  PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2;       
  157::394     8e-10  30% 1027 aa  AT1A1_CATCO RecName: Full=Sodium/potassium-transporting ATPase
  481::705     1e-09  26%  949 aa  PMA6_ARATH RecName: Full=ATPase 6, plasma membrane-type;       
  137::703     1e-09  26%  951 aa  PMA1_WHEAT RecName: Full=Plasma membrane ATPase;       
  160::397     1e-09  31% 1028 aa  AT1A4_RAT RecName: Full=Sodium/potassium-transporting ATPase
  152::399     2e-09  30% 1021 aa  AT1A1_PIG RecName: Full=Sodium/potassium-transporting ATPase
  570::782     2e-09  31% 1011 aa  ATC_TRYBB RecName: Full=Probable calcium-transporting ATPase;      
  608::704     4e-09  35%  905 aa  CTPF_MYCTU RecName: Full=Probable cation-transporting ATPase F;    
  608::704     4e-09  35%  905 aa  CTPF_MYCBO RecName: Full=Probable cation-transporting ATPase F;    
  154::620     5e-09  29%  974 aa  ATXB_LEIDO RecName: Full=Probable proton ATPase 1B;       
  611::832     8e-09  30% 1010 aa  PMA2_SCHPO RecName: Full=Plasma membrane ATPase 2;       
  141::369     1e-08  25%  956 aa  PMA3_NICPL RecName: Full=Plasma membrane ATPase 3;       
  154::620     1e-08  29%  974 aa  ATXA_LEIDO RecName: Full=Probable proton ATPase 1A;       
   97::410     2e-08  20% 1131 aa  PMA1_DUNBI RecName: Full=Plasma membrane ATPase;       
  137::703     2e-08  25%  951 aa  PMA1_ORYSJ RecName: Full=Plasma membrane ATPase;       
   95::382     3e-08  26% 1037 aa  ATC1_DUNBI RecName: Full=Cation-transporting ATPase CA1;       
  138::595     5e-08  23%  813 aa  PMAX_ARATH RecName: Full=Putative ATPase, plasma membrane-like;
  138::366     5e-08  25%  949 aa  PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type;       
  145::373     7e-08  26%  960 aa  PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type;       
  133::485     9e-08  27% 1033 aa  YD56_SCHPO RecName: Full=Putative phospholipid-transporting ATPase
  169::436     9e-08  25%  908 aa  ATMB_SALTY RecName: Full=Magnesium-transporting ATPase, P-type 1;  
  111::372     9e-08  26%  996 aa  AT2A1_MAKNI RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::366     2e-07  26% 1041 aa  AT2A2_CHICK RecName: Full=Sarcoplasmic/endoplasmic reticulum
  582::772     3e-07  30%  998 aa  ECA3_ARATH RecName: Full=Calcium-transporting ATPase 3, endoplasmic
   77::366     4e-07  26% 1042 aa  AT2A3_CHICK RecName: Full=Sarcoplasmic/endoplasmic reticulum
  153::721     8e-07  24% 1103 aa  PMA1_DUNAC RecName: Full=Plasma membrane ATPase;       
  113::755     8e-07  26% 1003 aa  ATC_ARTSF RecName: Full=Calcium-transporting ATPase
  111::751     8e-07  25% 1020 aa  ATC1_DROME RecName: Full=Calcium-transporting ATPase
   87::365     1e-06  25% 1018 aa  ATC1_ANOGA RecName: Full=Calcium-transporting ATPase
   77::366     1e-06  26%  999 aa  AT2A3_RAT RecName: Full=Sarcoplasmic/endoplasmic reticulum calcium
   77::366     1e-06  26% 1038 aa  AT2A3_MOUSE RecName: Full=Sarcoplasmic/endoplasmic reticulum
  140::706     1e-06  24%  948 aa  PMA8_ARATH RecName: Full=ATPase 8, plasma membrane-type;       
  111::751     2e-06  26% 1002 aa  ATC1_DROPS RecName: Full=Calcium-transporting ATPase
   77::366     2e-06  25% 1042 aa  AT2A2_HUMAN RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::751     2e-06  25%  994 aa  AT2A1_RANES RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::750     4e-06  25% 1043 aa  AT2A2_RAT RecName: Full=Sarcoplasmic/endoplasmic reticulum calcium
   77::750     4e-06  25% 1042 aa  AT2A2_RABIT RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::750     4e-06  25% 1042 aa  AT2A2_PIG RecName: Full=Sarcoplasmic/endoplasmic reticulum calcium
   77::750     4e-06  25% 1044 aa  AT2A2_MOUSE RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::750     4e-06  25%  997 aa  AT2A2_FELCA RecName: Full=Sarcoplasmic/endoplasmic reticulum
   77::750     4e-06  25%  997 aa  AT2A2_CANFA RecName: Full=Sarcoplasmic/endoplasmic reticulum
  111::751     4e-06  27% 1001 aa  AT2A1_HUMAN RecName: Full=Sarcoplasmic/endoplasmic reticulum
  145::343     5e-06  21%  947 aa  PMA10_ARATH RecName: Full=ATPase 10, plasma membrane-type;       
   77::366     7e-06  27% 1043 aa  AT2A3_HUMAN RecName: Full=Sarcoplasmic/endoplasmic reticulum
  111::751     7e-06  27%  994 aa  AT2A1_RAT RecName: Full=Sarcoplasmic/endoplasmic reticulum calcium
   77::751     7e-06  26%  994 aa  AT2A1_CHICK RecName: Full=Sarcoplasmic/endoplasmic reticulum
  247::457     9e-06  25% 1133 aa  ATX9_TETTH RecName: Full=Probable cation-transporting ATPase 9;    
  111::751     9e-06  27%  994 aa  AT2A1_MOUSE RecName: Full=Sarcoplasmic/endoplasmic reticulum
    4::257     1e-05  28%  273 aa  PATS_METJA RecName: Full=Soluble P-type ATPase-like phosphatase;   
  111::366     1e-05  28% 1001 aa  AT2A1_RABIT RecName: Full=Sarcoplasmic/endoplasmic reticulum
  111::366     1e-05  28%  993 aa  AT2A1_BOVIN RecName: Full=Sarcoplasmic/endoplasmic reticulum
  202::494     1e-04  22% 1256 aa  YH2M_CAEEL RecName: Full=Probable cation-transporting ATPase
 1010::1103    2e-04  33% 1625 aa  CTPI_MYCTU RecName: Full=Probable cation-transporting ATPase I;      
  145::218     2e-04  36%  233 aa  PGP2_SULSO RecName: Full=Phosphoglycolate phosphatase 2;       
    9::75      4e-04  41%   95 aa  YPDA_BACST RecName: Full=Uncharacterized protein in pdhA
  170::224     4e-04  38%  232 aa  PGP_METKA RecName: Full=Phosphoglycolate phosphatase;       
  142::235     5e-04  35%  454 aa  SYH_BACFN RecName: Full=Histidyl-tRNA synthetase;       
  686::787     6e-04  28% 1226 aa  AT133_HUMAN RecName: Full=Probable cation-transporting ATPase 13A3;
   89::209     8e-04  30% 1183 aa  AT8B5_MOUSE RecName: Full=Probable phospholipid-transporting ATPase
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLIKRMSPDEKKESGVIALCLMLLILAHFIPKNXXXXXXXXXXXXSAYPILKEAIENIFHGKWFDENFL
ATZN_SYNY3      ----------------------------------------------SGWTVLKTAGRNILRGQIFDENFL
CADA_BACSU      --------------------------------------------------IIIRAVKNIIRGQVFDEHFL
HMCT_HELPY      ----------------------------------------------SGKDVILGAFRGLRKGQFFDENAL
HMCT_HELPJ      ----------------------------------------------SGKDVILGAFRGLRKGQFFDENAL
HMCT_HELFE      LALIKQLEPDEAKPSAIVVLYLIAVATIHFSAQNWALHLSYALLAGAGKDVFLGALRAIRNKQFFDENTL
CADA_BACPF      --------------------------------------------------LFKVGLQNLLRFE-FDMKTL
CADA1_STAAU     ------------------------------------------------YSLFKVGFQNLIRFD-FDMKTL
CADA_STAAR      ------------------------------------------------YSLFKVGFQNLIRFD-FDMKTL
CADA2_STAAU     ------------------------------------------------YSLFKVGFQNLIRFD-FDMKTL
CADA1_LISMO     ------------------------------------------------FNLFKEGFANLIKLDFTMES-L
CADA2_LISMO     ------------------------------------------------YSLFKEGFKNLLKFEFTMET-L
ZOSA_BACSU      ----------------------------------------------------KEGIEETLESKTLNVELL
AHM3_ARATH      ------------------------------------------------YPILAKAVASLARFR-IDINIL
AHM4_ARATH      ------------------------------------------------FPILAKAVASVTRFR-LDINAL
COPA_ARCFU      ----------------------------------------------------------------------
ATZN_ECOLI      ------------------------------------------------YPIARQALRLIKSGSYFAIETL
COPA_BACSU      ----------------------------------------------------------------------
COPA_STAES      ----------------------------------------------------------------------
COPA_STAEQ      ----------------------------------------------------------------------
COPB_ARCFU      ----------------------------------------------------------------------
COPA_STAHJ      ----------------------------------------------------------------------
AHM5_ARATH      ----------------------------------------------------------------------
SILP_SALTY      ---------------------------------------------------------------WFPASF-
AHM2_ARATH      ----------------------------------------------------------------------
ATCU2_RHIME     ----------------------------------------------------------------------
AHM7_ARATH      ----------------------------------------------------------------------
ATCS_SYNY3      ----------------------------------------------------------------------
COPA_SALTI      ----------------------------------------------------------------------
COPA_SALTY      ----------------------------------------------------------------------
ATCU_SINMW      ----------------------------------------------------------------------
ATCU1_RHIME     ----------------------------------------------------------------------
COPA_ENTHR      ----------------------------------------------------------------------
COPA_STAAT      ----------------------------------------------------------------------
COPA_STAAE      ----------------------------------------------------------------------
COPA_STAAC      ----------------------------------------------------------------------
COPA_STAA8      ----------------------------------------------------------------------
COPA_STAA3      ----------------------------------------------------------------------
CTPV_MYCTU      ----------------------------------------------------------------------
COPA_STAAN      ----------------------------------------------------------------------
COPA_STAAM      ----------------------------------------------------------------------
COPA_STAA9      ----------------------------------------------------------------------
COPA_STAA2      ----------------------------------------------------------------------
COPA_STAA1      ----------------------------------------------------------------------
COPA_STAAW      ----------------------------------------------------------------------
COPA_STAAS      ----------------------------------------------------------------------
COPA_STAS1      ----------------------------------------------------------------------
COPA_STAAR      ----------------------------------------------------------------------
Y290_HAEIN      ----------------------------------------------------------------------
COPA_STAAB      ----------------------------------------------------------------------
COPA_HELFE      ----------------------------------------------------------------------
COPA_ECO57      ----------------------------------------------------------------------
COPA_ECOLI      ----------------------------------------------------------------------
COPA_YERPE      ----------------------------------------------------------------------
ATP7B_MOUSE     ----------------------------------------------------------------------
ATP7B_SHEEP     ----------------------------------------------------------------------
ATP7B_RAT       ----------------------------------------------------------------------
ATP7B_HUMAN     ----------------------------------------------------------------------
ATCU_RHILV      --------------------------------------------------------------------FP
COPA2_HELPY     ----------------------------------------------------------------------
ATP7A_CRIGR     ----------------------------------------------------------------------
COPB_STAAU      ----------------------------------------------------------------------
COPB_STAAR      ----------------------------------------------------------------------
ATU2_YEAST      ----------------------------------------------------------------------
COPA3_HELPY     ----------------------------------------------------------------------
COPA1_HELPY     ----------------------------------------------------------------------
CTPA_MYCTU      ----------------------------------------------------------------------
FIXI_RHILV      ----------------------------------------------------------------------
CTPC_MYCLE      ----------------------------------------------TGYPFLRGALR---FGKT-GTDAL
ATU2_SCHPO      ----------------------------------------------------------------------
COPB_ENTHR      ----------------------------------------------------------------------
COPA_HELPJ      ----------------------------------------------------------------------
FIXI_BRAJA      ----------------------------------------------------------------------
ATCS_SYNE7      ----------------------------------------------------------------------
COPA_HELPY      ----------------------------------------------------------------------
COPA_VIBCH      ----------------------------------------------------------------------
CTPA_MYCLE      ----------------------------------------------------------------------
AHM1_ARATH      -----------------------------------------------------DALMDIAGGK-VNIHVL
COPB_STAAT      ----------------------------------------------------------------------
COPB_STAA3      ----------------------------------------------------------------------
CTPC_MYCTU      ----------------------------------------------TGYPFLRGALRSLRSGK-AGTDAL
CTPC_MYCBO      ----------------------------------------------TGYPFLRGALRSLRSGK-AGTDAL
COPB_STAES      ----------------------------------------------------------------------
AHM6_ARATH      ----------------------------------------------------------------------
ATP7A_MOUSE     ----------------------------------------------------------------------
ATP7A_RAT       ----------------------------------------------------------------------
COPB_STAEQ      ----------------------------------------------------------------------
CTPB_MYCTU      ----------------------------------------------------------------------
CTPB_MYCBO      ----------------------------------------------------------------------
COPB_STAHJ      ----------------------------------------------------------------------
CTPB_MYCLE      ----------------------------------------------------------------------
CTPD_MYCTU      ----------------------------------------------------------------------
CTPD_MYCBO      ----------------------------------------------------------------------
FIXI_RHIME      ----------------------------------------------------------------------
ATP7A_HUMAN     ----------------------------------------------------------------------
ATKB_BACC7      ---------------------------------------------------------------WF--NIT
ATKB2_LISIN     ----------------------------------------------------------------------
ATU1_YEAST      --------------------------------------------------------------------YI
ATKB_THETN      ----------------------------------------------------------------------
CTPG_MYCTU      ----------------------------------------------------------------------
CTPG_MYCBO      ----------------------------------------------------------------------
ATKB_BACCN      ----------------------------------------------------------------------
ATKB_BACCR      ----------------------------------------------------------------------
ATKB_BACWK      ----------------------------------------------------------------------
ATKB_BACC4      ----------------------------------------------------------------------
ATKB_BACC2      ----------------------------------------------------------------------
ATKB_CLOAB      ----------------------------------------------------------------------
ATKB_BACCZ      ----------------------------------------------------------------------
ATKB_BACC3      ----------------------------------------------------------------------
ATKB_THEVO      ----------------------------------------------------------------------
ATKB_LEPIC      -------------------------------------------------PILKEAILNTFHPFLQAKNPV
ATKB_BACHK      ----------------------------------------------------------------------
ATKB_BACC0      ----------------------------------------------------------------------
ATKB_BACAH      ----------------------------------------------------------------------
ATKB_BACAC      ----------------------------------------------------------------------
ATKB_LEPIN      -------------------------------------------------PILKEAILNTFHPFLQAKNPV
ATKB_THEAC      ----------------------------------------------------------------------
ATSY_SYNE7      ----------------------------------------------------------------------
ATSY_SYNP6      ----------------------------------------------------------------------
ATKB_XANCP      ---------------------------------------------------------------------L
ATKB_STAHJ      ----------------------------------------------------------------------
ATKB1_ANASP     ----------------------------------------------------------------------
ATKB_XANAC      ---------------------------------------------------------------------L
ATKB_CAUCR      ----------------------------------------------------------------------
ATKB_STAEQ      ----------------------------------------------------------------------
ATKB1_STAAR     ----------------------------------------------------------------------
ATKB1_STAAN     ----------------------------------------------------------------------
ATKB1_STAAM     ----------------------------------------------------------------------
ATKB_STAAB      ----------------------------------------------------------------------
ATKB2_STAAR     ----------------------------------------------------------------------
ATKB_STAAW      ----------------------------------------------------------------------
ATKB_STAAS      ----------------------------------------------------------------------
ATKB_STAAT      ----------------------------------------------------------------------
ATKB_STAAE      ----------------------------------------------------------------------
ATKB_STAAC      ----------------------------------------------------------------------
ATKB_DEIRA      ----------------------------------------------------------------------
ATKB2_STAAN     ----------------------------------------------------------------------
ATKB2_STAAM     ----------------------------------------------------------------------
ATKB_RHIME      --------------------------------------------------------------------FV
ATKB2_ANASP     ----------------------------------------------------------------------
ATKB_MYCTU      ----------------------------------------------------------------------
ATKB_MYCBO      ----------------------------------------------------------------------
ATKB_SYNY3      ----------------------------------------------------------------------
ATKB_STRCO      ----------------------------------------------------------------------
ATKB_MYXXA      ----------------------------------------------------------------------
ATKB_AGRT5      --------------------------------------------------------------------FI
ATKB1_LISIN     ----------------------------------------------------------------------
ATKB_HALSA      ----------------------------------------------------------------------
ATKB_CLOBA      ----------------------------------------------------------------------
ATKB_RHILO      ----------------------------------------------------------------------
ATKB_PSEAE      ----------------------------------------------------------------------
ATKB_CLOBB      ----------------------------------------------------------------------
ATKB_LISMO      ----------------------------------------------------------------------
ATKB_LISMF      ----------------------------------------------------------------------
ATKB_LISMC      ----------------------------------------------------------------------
ATKB_ENTFA      ---------------------------------------------------------------WF--NIS
ATKB_YERPY      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPS      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERP3      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_POLSQ      ----------------------------------------------------------------------
ATKB_LISMH      ----------------------------------------------------------------------
ATKB_YERPP      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPN      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPG      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPE      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPB      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_YERPA      ----------------------------------------------------------VYLGSWLTTLIW
ATKB_LISW6      ----------------------------------------------------------------------
ATKB_PHOLL      ----------------------------------------------------------------------
ATKB_CLOP1      ----------------------------------------------------------------------
ATKB_SHIBS      ----------------------------------------------------------------------
ATKB_ANASL      ----------------------------------------------------------------------
ATKB_YERE8      ----------------------------------------------------------------------
ATKB_RALSO      ----------------------------------------------------------------------
ATKB_DECAR      ----------------------------------------------------------------------
ATKB_ECOLU      ----------------------------------------------------------------------
ATKB_HYDS0      ----------------------------------------------------------------------
Y1226_METJA     ----------------------------------------------------------------------
ATKB_SERP5      ----------------------------------------------------------------------
ATC1_SCHPO      ----------------------------------------------------------------------
ATKB_KLEP3      ---------------------------------------------------------------------L
ATKB_KLEP7      ---------------------------------------------------------------------L
ATKB_ERWT9      ----------------------------------------------------------------------
ATKB_ECOSM      ----------------------------------------------------------------------
ATKB_ECO5E      ----------------------------------------------------------------------
ATKB_ECO57      ----------------------------------------------------------------------
ATKB_ECOL6      ----------------------------------------------------------------------
ATKB_ECOL5      ----------------------------------------------------------------------
ATKB_ECO81      ----------------------------------------------------------------------
ATKB_ECO27      ----------------------------------------------------------------------
ATKB_ECOSE      ----------------------------------------------------------------------
ATKB_ECO7I      ----------------------------------------------------------------------
ATKB_ECO24      ----------------------------------------------------------------------
ATKB_SHISS      ----------------------------------------------------------------------
ATKB_ESCF3      ----------------------------------------------------------------------
ATKB_ECOLI      ----------------------------------------------------------------------
ATKB_ECOHS      ----------------------------------------------------------------------
ATKB_ECODH      ----------------------------------------------------------------------
ATKB_ECOBW      ----------------------------------------------------------------------
ATKB_ECO8A      ----------------------------------------------------------------------
ATKB_ECO55      ----------------------------------------------------------------------
ATKB_SALCH      ----------------------------------------------------------------------
ATKB_ECOLC      ----------------------------------------------------------------------
PMA1_DICDI      ------------------------------------------------YPILE-----FLYFMWNPLSWT
ATKB_SHIB3      ----------------------------------------------------------------------
ACA1_ORYSJ      ----------------------------------------------------------------------
ATKB_ECOUT      ----------------------------------------------------------------------
ATKB_ECOK1      ----------------------------------------------------------------------
ATKB_ECO45      ----------------------------------------------------------------------
ATKB_TOLAT      ----------------------------------------------------------------------
ATKB_ENT38      ----------------------------------------------------------------------
PMA5_ARATH      ----------------------------------------------------------------------
ATKB_SALSV      ----------------------------------------------------------------------
ATKB_SALPB      ----------------------------------------------------------------------
ATKB_SALTY      ----------------------------------------------------------------------
ATKB_SALNS      ----------------------------------------------------------------------
ATKB_SALHS      ----------------------------------------------------------------------
ATKB_SALG2      ----------------------------------------------------------------------
ATKB_SALEP      ----------------------------------------------------------------------
ATKB_SALDC      ----------------------------------------------------------------------
ATKB_SALA4      ----------------------------------------------------------------------
ATKB_SALPK      ----------------------------------------------------------------------
ATKB_SALPA      ----------------------------------------------------------------------
ACA2_ORYSJ      ----------------------------------------------------------------------
ATCL_MYCGE      ----------------------------------------------------------------------
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     ----------------------------------------------------------------------
PMA7_ARATH      ----------------------------------------------------------------------
ACA5_ORYSJ      ----------------------------------------------------------------------
PMA1_AJECA      ----------------------------------------------------------------------
ACA1_ARATH      ----------------------------------------------------------------------
PMA2_ARATH      ----------------------------------------------------------------------
ACA7_ARATH      ----------------------------------------------------------------------
PMA1_NICPL      ----------------------------------------------------------------------
ACA2_ARATH      ----------------------------------------------------------------------
ACA6_ORYSJ      ----------------------------------------------------------------------
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      ----------------------------------------------------------------------
ACA4_ARATH      ----------------------------------------------------------------------
PMA1_SOLLC      ----------------------------------------------------------------------
PMA1_SCHPO      ----------------------------------------------------------------------
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       ----------------------------------------------------------------------
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      ----------------------------------------------------------------------
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     ----------------------------------------------------------------------
AT2B1_PIG       ----------------------------------------------------------------------
AT2B1_HUMAN     ----------------------------------------------------------------------
PMA1_NEUCR      ----------------------------------------------------------------------
ATKB_SALTI      ----------------------------------------------------------------------
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       ----------------------------------------------------------------------
AT2B3_HUMAN     ----------------------------------------------------------------------
AT2B1_RAT       ----------------------------------------------------------------------
AT12A_HUMAN     ----------------------------------------------------------------------
CTPE_MYCTU      ----------------------------------------------------------------------
CTPE_MYCBO      ----------------------------------------------------------------------
PMA4_NICPL      ----------------------------------------------------------------------
AT12A_CAVPO     ----------------------------------------------------------------------
PMA9_ARATH      ----------------------------------------------------------------------
ATMA_ECOLI      ----------------------------------------------------------------------
ATMA_ECO57      ----------------------------------------------------------------------
AT2B2_OREMO     ----------------------------------------------------------------------
ATC1_YARLI      ----------------------------------------------------------------FSENPL
ATCL_MYCPN      ----------------------------------------------------------------------
AT2C2_HUMAN     ----------------------------------------------------------------------
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     ----------------------------------------------------------------------
AT2B1_RABIT     ----------------------------------------------------------------------
AT12A_RAT       ----------------------------------------------------------------------
PMA1_ARATH      ----------------------------------------------------------------------
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       ----------------------------------------------------------------------
ATMA_SALTY      ----------------------------------------------------------------------
ATCL_SYNE7      ----------------------------------------------------------------------
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      ----------------------------------------------------------------------
ATN5_YEAST      ----------------------------------------------------------------------
ATN2_YEAST      ----------------------------------------------------------------------
ATN1_YEAST      ----------------------------------------------------------------------
AT2C2_MOUSE     ----------------------------------------------------------------------
ECA4_ARATH      ----------------------------------------------------------------------
AT1A_HYDAT      -----------------------------------------------------------------DELYL
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      --------------------------------------------------------------------FV
PMA1_CANAL      ----------------------------------------------------------------------
ECA1_ARATH      ----------------------------------------------------------------------
ATP4A_XENLA     ----------------------------------------------------------------------
AT2C1_RAT       ----------------------------------------------------------------------
AT1A_ARTSF      ----------------------------------------------------------------------
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     ----------------------------------------------------------------------
AT12A_RABIT     ----------------------------------------------------------------------
ACA8_ARATH      ---------------------------------------------------------------------I
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     ----------------------------------------------------------------------
AT2C1_HUMAN     ----------------------------------------------------------------------
AT1A_TAESO      ----------------------------------------------------------------------
ATP4A_RAT       ----------------------------------------------------------------------
ATP4A_RABIT     ----------------------------------------------------------------------
ATP4A_PIG       ----------------------------------------------------------------------
ATP4A_MOUSE     ----------------------------------------------------------------------
ATP4A_HUMAN     ----------------------------------------------------------------------
ATP4A_CANFA     ----------------------------------------------------------------------
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       ----------------------------------------------------------------------
AT1A1_MOUSE     ----------------------------------------------------------------------
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      ----------------------------------------------------------------------
AT1B_ARTSF      ----------------------------------------------------------------------
AT1A4_MOUSE     ----------------------------------------------------------------------
ECA2_ARATH      ----------------------------------------------------------------------
AT2C1_MOUSE     ----------------------------------------------------------------------
AT1A_TORCA      ----------------------------------------------------------------------
AT1A3_RAT       ----------------------------------------------------------------------
AT1A3_OREMO     ----------------------------------------------------------------------
AT1A3_MOUSE     ----------------------------------------------------------------------
AT1A3_HUMAN     ----------------------------------------------------------------------
AT1A2_PONAB     ----------------------------------------------------------------------
AT1A1_SHEEP     ----------------------------------------------------------------------
AT1A1_RABIT     ----------------------------------------------------------------------
AT1A1_PONAB     ----------------------------------------------------------------------
AT1A1_OREMO     ----------------------------------------------------------------------
AT1A1_HUMAN     ----------------------------------------------------------------------
AT1A1_HORSE     ----------------------------------------------------------------------
AT1A1_CHICK     ----------------------------------------------------------------------
AT1A1_BOVIN     ----------------------------------------------------------------------
AT1A1_ANGAN     ----------------------------------------------------------------------
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     ----------------------------------------------------------------------
AT1A3_CHICK     ----------------------------------------------------------------------
AT1A2_CHICK     ----------------------------------------------------------------------
AT1A2_BOVIN     ----------------------------------------------------------------------
AT1A1_XENLA     ----------------------------------------------------------------------
AT1A1_BUFMA     ----------------------------------------------------------------------
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      ------------------------------------------------YILLIAGTVKAFLGSWTNAWVI
AT1A2_RAT       ----------------------------------------------------------------------
AT1A2_MOUSE     ----------------------------------------------------------------------
AT1A2_HUMAN     ----------------------------------------------------------------------
PMA2_SOLLC      ----------------------------------------------------------------------
AT1A1_CATCO     ----------------------------------------------------------------------
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      ----------------------------------------------------------------------
AT1A4_RAT       ----------------------------------------------------------------------
AT1A1_PIG       ----------------------------------------------------------------------
ATC_TRYBB       ----------------------------------------------------------------------
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      ----------------------------------------------------------------------
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      ----------------------------------------------------------------------
ATXA_LEIDO      ----------------------------------------------------------------------
PMA1_DUNBI      ----------------------------------------------------------------------
PMA1_ORYSJ      ----------------------------------------------------------------------
ATC1_DUNBI      -------------------------------------------------------------------DFI
PMAX_ARATH      ----------------------------------------------------------------------
PMA3_ARATH      ----------------------------------------------------------------------
PMA4_ARATH      ----------------------------------------------------------------------
YD56_SCHPO      ----------------------------------------------------------------------
ATMB_SALTY      ----------------------------------------------------------------------
AT2A1_MAKNI     ----------------------------------------------------------------------
AT2A2_CHICK     ---------------------------------------------------------------WFEE---
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     ---------------------------------------------------------------WFEEGEE
PMA1_DUNAC      ----------------------------------------------------------------------
ATC_ARTSF       ----------------------------------------------------------------------
ATC1_DROME      ----------------------------------------------------------------------
ATC1_ANOGA      ----------------------------------------------------------------------
AT2A3_RAT       ---------------------------------------------------------------WFEEGEE
AT2A3_MOUSE     ---------------------------------------------------------------WFEEGEE
PMA8_ARATH      ----------------------------------------------------------------------
ATC1_DROPS      ----------------------------------------------------------------------
AT2A2_HUMAN     ---------------------------------------------------------------WFEE---
AT2A1_RANES     ---------------------------------------------------------------WFEE---
AT2A2_RAT       ---------------------------------------------------------------WFEE---
AT2A2_RABIT     ---------------------------------------------------------------WFEE---
AT2A2_PIG       ---------------------------------------------------------------WFEE---
AT2A2_MOUSE     ---------------------------------------------------------------WFEE---
AT2A2_FELCA     ---------------------------------------------------------------WFEE---
AT2A2_CANFA     ---------------------------------------------------------------WFEE---
AT2A1_HUMAN     ----------------------------------------------------------------------
PMA10_ARATH     ----------------------------------------------------------------------
AT2A3_HUMAN     ---------------------------------------------------------------WFEEGEE
AT2A1_RAT       ----------------------------------------------------------------------
AT2A1_CHICK     ---------------------------------------------------------------WFEE---
ATX9_TETTH      ----------------------------------------------------------------------
AT2A1_MOUSE     ----------------------------------------------------------------------
PATS_METJA      ----------------------------------------------------------------------
AT2A1_RABIT     ----------------------------------------------------------------------
AT2A1_BOVIN     ----------------------------------------------------------------------
YH2M_CAEEL      ---------------------------------------------------------------WYNDEYA
CTPI_MYCTU      ----------------------------------------------------------------------
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       ----------------------------------------------------------------------
AT133_HUMAN     ----------------------------------------------------------------------
AT8B5_MOUSE     --------------------------------------------------------------------FL


                         .         .         *         .         .         .         .:140
query           MSVATVGALAIGQFSEAIAVMLFYRVGEIFEDLAIENSKKSITNLLDIRPEYANLELNGKLQQVKPELLN
ATZN_SYNY3      MTIATLGALAIHQLPEAVAVMLFFRVGELFQEYSVGRSRRSIKALLEARPDTANLKRNGTVQQVSPETVQ
CADA_BACSU      MALATIGAFLIQQYPEGVAVMLFYQIGELFQGAAVSRSRKSISALMDIRPDYANLKTKNGIEQVSSEDVQ
HMCT_HELPY      MLIATIAAFFVGAYEESVSIMVFYSAGEFLQKLAVSRSKKSLKALVDVAPNLAYLKKGDELVSVAPEDLR
HMCT_HELPJ      MLIATIAAFCVGAYEESVSIMVFYSAGEFLQILAIARSKKSLKALVDVAPNLAYLKKGDTLVSVAPEDLR
HMCT_HELFE      MLSATIAAFGVGAHEEAVSIMVFYSAGEFLQQLAIARSKQSLHALLDVAPNHAVRKVGQELQEVEPSALA
CADA_BACPF      MTVAVIGGAIIGEWAEVAIVVILFAISEALERFSMDRARQSIRSLMDIAPKEALVKRNGQEIMIHVDDIA
CADA1_STAAU     MTVAVIGATIIGKWAEASIVVILFAISEALERFSMDRSRQSIRSLMDIAPKEALVRRNGQEIIIHVDDIA
CADA_STAAR      MTXXXXXXXXXXXXXXXSIVVVLFAISEALERFSMDRARQSIRSLMDIAPKEALVMRNGQEIMIHVDDIA
CADA2_STAAU     MTXXXXXXXXXXXXXXXSIVVILFAISEALERFSMDRARQSIRSLMDIAPKEALVRRNGQEIMIHVDDIA
CADA1_LISMO     MTIAIIGASIIGEWAEGSIVVILFAFSEVLERYSMDKARQSIRSLMDIAPKEALIRRDDVEQMIAVSDIQ
CADA2_LISMO     MTIAIIGAAFIGEWAEGSIVVILFAVSEALERYSMDKARQSIRSLMDIAPKEALVRRSGTDRMVHVDDIQ
ZOSA_BACSU      MIFAAIGSALIGYWAEGAILIFIFSLSGALETYTMNKSSRDLTSLMQLEPEEATLMVNGETKRVPVSDLQ
AHM3_ARATH      VVVTVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYKASAVMQSLMSLAPQKAVIAETG--EEVEVDELK
AHM4_ARATH      TLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASIVMSSLMSLAPRKAVIADTGL--EVDVDEVG
COPA_ARCFU      ------------------------------EARAKSRTGEAIKKLVGLQAKTAVVIRDGKEIAVPVEEVA
ATZN_ECOLI      MSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPETATRLRKGEREEVAINSLR
COPA_BACSU      -----------------------------FETKAKGRSSDAIKKLMKLQAKTATVVRDGQEQIIPIDEVL
COPA_STAES      -------------FETSAILITLILLGKYLEARAKSQTTNALSELLNLQAKEARVIKENKEIMLPLDKVK
COPA_STAEQ      -------------FETSAILITLILLGKYLEARAKSQTTNALSELLNLQAKEARVIKENKEIMLPLDKVK
COPB_ARCFU      ------GKFFFWELATLIDIML---LGHYIEMRSVLGASRALEELVKIMPSEAHLLKDGEIVEVKVENLK
COPA_STAHJ      -----------------ITLILF---GKYLEARAKSQTTNALSELLNLQAKEARLDDNGMEKMVPLNQVN
AHM5_ARATH      ----SVGALLYGAFDASAMLITFVLLGKYLESLAKGKTSDAMKKLVQLTPATAILLTEGKEREIDALLIQ
SILP_SALTY      ---RNMDGLVAIYFEAAAVITVLVLLGQVLELRAREQTSGAITALLNLAPKTARLDQDGHETDINAEDVL
AHM2_ARATH      -------------FMEAAAVVFLFTISDWLETRASYKATSVMQSLMSLAPQKAIIAXXXXXXXXXXXXXX
ATCU2_RHIME     -------------YEAAAVIVTLVLLGRYLESRAKGRTSQAIKRLVGLQPKTAFVLRGGEFVEAQISEVV
AHM7_ARATH      -------------FETSAMLISFIILGKYLEVMAKGKTSQAIAKLMNLAPDTASLDKEGNVEEIDGRLIQ
ATCS_SYNY3      ------GLAAHVYFEAAAVVITLILLGRSLEQRARRETSAAIRKLMGLQPQTALVKRGEHWETVAIAELA
COPA_SALTI      -------------YYEASAMIILINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADVQ
COPA_SALTY      -------------YYEASAMIILINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADVQ
ATCU_SINMW      -------------YEAAAVIVTLILVGRYLESRAKGRTSQAIKRLVGLQPKTAFVLHSGEFXXXXXXXXX
ATCU1_RHIME     -------------YEAAAVIVTLILLGRYLEARAKGRTSQAIKRLLGLQPKTAFVAHGDEFVEIQISDVV
COPA_ENTHR      -------------FESSSMIITLILLGKYLEHTAKSKTGDAIKQMMSLQTKTAQVLRDGKEETIAIDEVM
COPA_STAAT      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAAE      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAAC      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAA8      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAA3      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
CTPV_MYCTU      -------------FDTSALIIAFVVLGRHLEARATGKASEAISKLLELGAKEATLLVDGQELLVPVDQVQ
COPA_STAAN      -------------FETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAAM      -------------FETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAA9      -------------FETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAA2      -------------FETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAA1      -------------FETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAAW      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAAS      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
COPA_STAS1      -----------------ITLILF---GKYLETRAKTQTTNALSELLNLQAKEARVLRDNKEQMIPLNDVV
COPA_STAAR      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVH
Y290_HAEIN      -------------FEASVMVIGFVSLGKFLEDRTKKHSLNSLSMLLQLTPKKVTVLRNEKWIEIALDQVN
COPA_STAAB      -----------------ITLILF---GKYLEARAKSQTTNALGELLSLQAKEARILKDGNELMIPLNEVH
COPA_HELFE      -------------FESVCVILLFVMAGKRVEENSKDKALEAMQSLMRHQSLNALKIENGQSVEVPLESLQ
COPA_ECO57      -------------YYEASAMIILINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAEVQ
COPA_ECOLI      -------------YYEASAMIILINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAEVQ
COPA_YERPE      -------------YYEASAMIILINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQ
ATP7B_MOUSE     -------------------LFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGREEQVPMELVQ
ATP7B_SHEEP     -------------------LFVFIALGRWLEHVVKSKTSEALARLMSLQATEATVVTLGREEQVPMELVQ
ATP7B_RAT       -------------------LFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGREEQVPMELVQ
ATP7B_HUMAN     -------------------LFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGREEQVPMELVQ
ATCU_RHILV      MSFRGHGAAVPVYFEAAAVIVALVFVGQVLELKARERTGSAIRALLDLAPKTARIDAEGNESDVPVDDIN
COPA2_HELPY     -------------FESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMHNNQQIEVLVDSIV
ATP7A_CRIGR     ----------ITSFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATLDSDNILEQVDVELVQ
COPB_STAAU      -------------FWELATLILIMLLGHWIEMNAVGNAGNALKKMAELLPNTAKLIDNNQREEVKISDIH
COPB_STAAR      -------------FWELATLILIMLLGHWIEMNAVGNAGNALKKMAELLPNTAKLIDNNQREEVKISDIH
ATU2_YEAST      ---SSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEELLQ
COPA3_HELPY     -------------FESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQQIEVLVDSIV
COPA1_HELPY     -------------FESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKIQNDQQIEVLVDSIV
CTPA_MYCTU      ---ALLGSDAI-YFEVAAGVTVFVLVGRYFEARAXXXXXXXXXXXXXXXKEVAVLLPDGSEMVIPADELK
FIXI_RHILV      -------------FDASVSLLFFLLIGRTLDHIMREKARAAINXXXXXXXXXXXINPDGSRRYIAVEEIA
CTPC_MYCLE      VSVATIASLILRENXXXXXXXXXXNIGEYLQDLTLRRTRRAISALLSGTQDTAWIRLTDGPQQVPIGTVQ
ATU2_SCHPO      --------------------------------------------------------------EILADLIE
COPB_ENTHR      -------------FWELATLIVIMLLGHWIEMNAVSNASDALQKLAELLPESVKLKKDGTEETVSLKEVH
COPA_HELPJ      -------------FESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMHNNQQIEVLVDSIV
FIXI_BRAJA      --VETIHHAEHAYFDAAIMLLTFLLVGRFLDQNMRRRTRAVAGNLAALKAETAAKFVGDEISQVPVAAIS
ATCS_SYNE7      --------------------------GRSLEERAKGQTSAAIRQLIGLQAKTARVLRQGQELTLPITEVQ
COPA_HELPY      -------------FESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNNQQIEVLVDSIV
COPA_VIBCH      ----------------------------------------------------------------------
CTPA_MYCLE      --------------------------------------------------------------------LN
AHM1_ARATH      MALAAFASVFMGNALEGGLLLAMFNLAHIAEEFFTSRSMVDVKELKESNPDSALLVHNGNVKSVPVHSVE
COPB_STAAT      -------------FWELATLILIMLLGHWIEMNAVGNAGDALKKMAELLPNSAIKVMNGQREEVKISDIM
COPB_STAA3      -------------FWELATLILIMLLGHWIEMNAVGNAGDALKKMAELLPNSAIKVMNGQREEVKISDIM
CTPC_MYCTU      VSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRAISELLRGNQDTAWVRLTDPSAQVPIDTVQ
CTPC_MYCBO      VSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRAISELLRGNQDTAWVRLTDPSAQVPIDTVQ
COPB_STAES      -------------FWELATLILIMLLGHWIEMNAVGNAGDALKKMAELLPNSAIKVMNGQREEVKISDIM
AHM6_ARATH      -------------FEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGDLQNSTVEVLS
ATP7A_MOUSE     -------------------LFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIXXXXXXXQVDVELVQ
ATP7A_RAT       -------------------LFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIXXXXXXXQVDVELVQ
COPB_STAEQ      -------------FWELATLILIMLLGHWIEMNAVGNAGDALKKMAELLPNSAIKVMNGQREEVKISDIM
CTPB_MYCTU      ----------------AAGVTVFVLAGRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASLK
CTPB_MYCBO      ----------------AAGVTVFVLAGRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASLK
COPB_STAHJ      -------------FWELATLILIMLLGHWIEMNAVGNAGDALKKMAELLPNSAIKVMNGQREEVKISDIM
CTPB_MYCLE      ---------------------------------------------------------NGAELTIPAGELK
CTPD_MYCTU      -------------FDGALLIVIFATSGAL-DDIATRHTAESVKGLLDLAPDQAVVQGDGSERVVAASELX
CTPD_MYCBO      -------------FDGALLIVIFATSGAL-DDIATRHTAESVKGLLDLAPDQAVVQGDGSERVVAASELX
FIXI_RHIME      ----TIGHGEHAWFDASVTLLFFLLIGRTLDHMMRGRARTAISGLARLSPRGATVHPDGSREYRAVDEIN
ATP7A_HUMAN     -------------------LFVFIALGRWLEHIAKGKTSEALAKLISLQATEATLDSDNILEQVDVELVQ
ATKB_BACC7      VSFILLFTVLFANFAEALAEGR----GKAQAD-SLKHSKKDV---------FANVKENGNIVQVSATDLR
ATKB2_LISIN     ----------------------------------------------------ARLILNGKEKVVNANTLK
ATU1_YEAST      FSIVSFGYFVVGQFFETSSLLVLIMVGRFVSELARHRAVKSIS-VRSLQASSAILDKTGKETEINIRLLQ
ATKB_THETN      ------------------------------------------------------VQSDGSIKIVKSSELK
CTPG_MYCTU      -------------------------------------------------PDQATVLREGTETIVASTELH
CTPG_MYCBO      -------------------------------------------------PDQATVLREGTETIVASTELH
ATKB_BACCN      ---------------------------------SLKQSKKDV---------YANIKENGEITRVLASNLK
ATKB_BACCR      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_BACWK      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_BACC4      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_BACC2      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_CLOAB      ---------------------------------------------------------DGSIKTINANELK
ATKB_BACCZ      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_BACC3      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGDIVQVSATDLR
ATKB_THEVO      -----------------------------------EGKSKAITDSLKKTDVIAHVQKDGNIVDVRSNELK
ATKB_LEPIC      MFIVFLGALVYSSFNLQISLWLWFTVANFAEAIAEGRGKARTDSLKKTRSNIIAKKLVGKIENVPGTLLK
ATKB_BACHK      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGEIVQVSATDLR
ATKB_BACC0      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGEIVQVSATDLR
ATKB_BACAH      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGEIVQVSATDLR
ATKB_BACAC      -----------GWFNITVSLILLFTVANFAEALAEGRGKAQADSLKQSKKDFANVKENGEIVQVSATDLR
ATKB_LEPIN      MFIVFLGALVYSSFNLQISLWLWFTVANFAEAIAEGRGKARTDSLKKTRSNIIAKKLVGKIENVPGTLLK
ATKB_THEAC      ------------QFYLAVVILLFLTV--FFSSMSTEGKSKAITDSLKFKTEVAHVIRDGNPVDVKSTDLR
ATSY_SYNE7      -------------FDEPVMLLGFILLGRTLEEQARFRSXXETTQLLTAPSSIAPQDLLEAPAQIWPVALR
ATSY_SYNP6      --------------------------------------------------------------------LR
ATKB_XANCP      AAVITASGHGNAGFGWAVTAILFVTVGNFAEAIAEARGRGQAASLRRARKDLVETALGGRETRVPAAELR
ATKB_STAHJ      -------------FSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKRIKQDGSYEMIDASDLK
ATKB1_ANASP     -------------FNGLLTGILFFTVANFAEAVAEGRGKAQADTLRSTKSEAIAKQLSGTIAEVPSTNLK
ATKB_XANAC      AAVITASGHSHAGFGWAVTAILFVTVGNFAEAIAEARGRGQAASLRRARKDLVETALGGRETRVPAAELR
ATKB_CAUCR      --------------------------------------------------------------------LG
ATKB_STAEQ      -------------FSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKRIKQDGSYEMIDASDLK
ATKB1_STAAR     -------------FSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKRIKQDGSYEMIDASDLK
ATKB1_STAAN     -------------FSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKRIKQDGSYEMIDASDLK
ATKB1_STAAM     -------------FSIFIILLLTLVFANFSEALAEGRGKAQANALRQTQTEMKRIKQDGSYEMIDASDLK
ATKB_STAAB      ------------------------------------------------------IEENGAYRIVNATELK
ATKB2_STAAR     ------------------------------------------------------IEENGAYRIVNATELK
ATKB_STAAW      ------------------------------------------------------IEENGAYRIVNATELK
ATKB_STAAS      ------------------------------------------------------IEENGAYRIVNATELK
ATKB_STAAT      ------------------------------------------------------IEENGAYRIVNATELK
ATKB_STAAE      ------------------------------------------------------IEENGAYRIVNATELK
ATKB_STAAC      ------------------------------------------------------IEENGAYRIVNATELK
ATKB_DEIRA      ------------------------------EGMAEARGKAQAASLRSAREDVARRLVNGQEELVAGTALE
ATKB2_STAAN     ------------------------------------------------------IEENGAYRIVNATELK
ATKB2_STAAM     ------------------------------------------------------IEENGAYRIVNATELK
ATKB_RHIME      LDVATGGGSRL--FSGQIAAWLWFTVATFAEAVAEGRGKAQADFLRHTKSELSARKLGRETKEIPATMLK
ATKB2_ANASP     ---------------------------------------------------------NGSLEKIGSTQLR
ATKB_MYCTU      -------------FNGLVAAFLWFTVANFAEAMAEGRGKAQAAALRKVRSEMANRRTAGNIESVPSSRLD
ATKB_MYCBO      -------------FNGLVAAFLWFTVANFAEAMAEGRGKAQAAALRKVRSEMANRRTAGNIESVPSSRLD
ATKB_SYNY3      ---------------------------------------------------------DGSLEMVSSTHLR
ATKB_STRCO      ----------------------------------------------------------------------
ATKB_MYXXA      ---------------------------------------------------------DGREERVPAPDLR
ATKB_AGRT5      RDLITGGANLA--FSFQINLWLWFTVANFAEAVAEGRGKAQADSLRKTRTETQAKLLNSQYKMVAGDSLK
ATKB1_LISIN     -------------YTLAIALILWFTVANFAEAIAEGRGRAQADSLKMARKDVLNLEDKSDVIEVASNDLK
ATKB_HALSA      ----------------------------------------------------------------------
ATKB_CLOBA      -----------------------------------------------------SIEKRDEITKVSSALLK
ATKB_RHILO      ------------RFTLQIIIWLWFTVANFAEAVAEGRGKAQADSLRKARTETQAKLLAGKFKLVPGTSLK
ATKB_PSEAE      ---------------------------------------------------------DGSFESVVASSLR
ATKB_CLOBB      -----------------------------------------------------SLEKKDEITKVSSALLK
ATKB_LISMO      -------------YTLAIALILWFTVANFAEAIAEGRGRAQADSLKMARKDVLNVDDKTDVIEVASNDLK
ATKB_LISMF      -------------YTLAIALILWFTVANFAEAIAEGRGRAQADSLKMARKDVLNIDDKTDVIEIASNDLK
ATKB_LISMC      -------------YTLAIALILWFTVANFAEAIAEGRGRAQADSLKMARKDVLNIDDKTDVIEIASNDLK
ATKB_ENTFA      ITIFLWLTLLFANFAEAVAEGRGKAQADSLKQAKKEVMTYKINSLEDIKEE--------NFIELQSSDLK
ATKB_YERPY      LAILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPS      LAILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERP3      LAILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_POLSQ      --------------------------------------------------------------------LR
ATKB_LISMH      -------------YTLAIALILWFTVANFAEAIAEGRGRAQADSLKMARKDVLNIDDKTDVIEIASNDLK
ATKB_YERPP      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPN      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPG      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPE      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPB      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_YERPA      LDILSGHTTGSAMFTGSIALWLWFTVANMAEALAEGRSKAQAASLRGVKKKLSEARVDAPQEKVSADSLR
ATKB_LISW6      --------------------------------------------------------------------LK
ATKB_PHOLL      -------------FTGNIALWLWFTVANFAEALAEGRSKAQAASLKGVRKTSWATKLNGSREKAPSDSLR
ATKB_CLOP1      ---------------------------------ALRSAKKDI-----LANRIESIETKEKVSKVNSTELR
ATKB_SHIBS      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ANASL      ------------------------------------------------------LSPDGKITDVPSTSLK
ATKB_YERE8      -------------FTGSVALWLWFTVANFAEALAEGRSKAQAESLRGVKKKLSEARFDAPQEKVSADSLR
ATKB_RALSO      -------------FILAVSVWLWFTVANVAEALAEGRSKQQAASLRGIKTTVADPQRRDRVQPRAATALR
ATKB_DECAR      -------------FILAITIWLWFTVANFAEALAEGRSKAQAASLRGLKKELAEPRFGAQWQMTPAADLR
ATKB_ECOLU      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_HYDS0      -------------FSANVSLWLWLTVSNFAESIAESRGKARAKSLREAKSNLFAKKLKNKYEKIPASSLQ
Y1226_METJA     ---------------------------------------------------------DGKWQIIPAKELV
ATKB_SERP5      -------------FTGSIAMWLWFTVANFAEALAEGRSKAQAESLRGTKKKLAGPRREGATEKVSAESLR
ATC1_SCHPO      -----------------------------------EQSLKALNNLV---PHYCNVIRSGKTEHIVASKLV
ATKB_KLEP3      LAIAMAGGALTGSFTAAVSIWLWFTVANFAEAMAEGRSKAQANSLKGVKKTAFARKLDATVDHVPAEDLR
ATKB_KLEP7      LAIAMAGGALTGSFTAAVSIWLWFTVANFAEAMAEGRSKAQANSLKGVKKTAFARKLDAPVDHVPAEDLR
ATKB_ERWT9      -------------FTVAISVWLWFTVANFAEALAEGRSKAQANSLKGVTKTSFAKKLNEAKYPVAADTLR
ATKB_ECOSM      -------------FSAAISAWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO5E      -------------FSVAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO57      -------------FSVAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOL6      ISIAMASGVMPGNFSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOL5      ISIAMASGVMPGNFSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO81      ISIAMASGVMPGNFSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO27      ISIAMASGVMPGNFSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOSE      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO7I      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO24      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_SHISS      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ESCF3      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOLI      -------------FSAAISGWLWITVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOHS      -------------FSAAISGWLWITVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAVADKVPADQLR
ATKB_ECODH      -------------FSAAISGWLWITVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOBW      -------------FSAAISGWLWITVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO8A      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO55      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_SALCH      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_ECOLC      -------------FSAAISGWLWITVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAVADKVPADQLR
PMA1_DICDI      MEVAAIVSIALLDWVDFILILLNATIGFIEENTA-GNAVEALKNSL---VSQIRCMRDGEWVMLPSPDLV
ATKB_SHIB3      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ACA1_ORYSJ      -----------------------YRQSLQFKDLDKEKKKIQV-----------QVTRNGFRQRLSIYDLL
ATKB_ECOUT      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECOK1      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_ECO45      -------------FSAAISGWLWVTVANFAEALAEGRSKAQANSLKGVKKTAFARKLRAAADKVPADQLR
ATKB_TOLAT      -------------------------------------------------------------QPVPADSLR
ATKB_ENT38      -------------FTGTISVWLWFTVANVAEALAEGRSKAQANSLKGINKTAFARKLRAQMDHVPADELR
PMA5_ARATH      -------------------------------------------------------------------ILV
ATKB_SALSV      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALPB      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALTY      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALNS      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALHS      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALG2      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALEP      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALDC      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALA4      -------------FTGIISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALPK      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATKB_SALPA      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ACA2_ORYSJ      ---------------------------------------------------------NGLRQRVLIDDLL
ATCL_MYCGE      ---------------------------------------------------------NGELISINVSEVV
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     ---------------------------------------------------------DGSRQEVSIHDLV
PMA7_ARATH      ---------------------------------------------------------DGKWNEIDAAELV
ACA5_ORYSJ      ----------------------------------LDNEKKKI---------FIHVTRDGRRQKISIYDLV
PMA1_AJECA      ---------------------------------------------------------NGRLTEVEAPEVV
ACA1_ARATH      ----------------------------------------------------------------------
PMA2_ARATH      ---------------------------------------------------------DGKWSEQEAAILV
ACA7_ARATH      -----------------------YRQSLQFRDL--DKEKKKIT---------VQVTRNGFRQKMSIYDLL
PMA1_NICPL      ---------------------------------------------------------DGRWKEEDAAVLV
ACA2_ARATH      -----------------------YRQSLQFRDL--DKEKKKIT---------VQVTRNGFRQKLSIYDLL
ACA6_ORYSJ      ----------------------------------------------------------------------
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      ----------------------------------LDNEKKKI---------FIHVTRDGRRQKISIYDLV
ACA4_ARATH      ---------------------------------------------------------DGSRQEISIHDLV
PMA1_SOLLC      ---------------------------------------------------------DGKWDEEDASVLV
PMA1_SCHPO      -----------------------YQAGSIVDELKKSLALKAVV----IR--------EGQVHELEANEVV
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       -----------------------------FNDWSKEKQFRGLQSRIELEQKFSIIR-NGQLIQLPVAEIV
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      ------------------AVICFNAFSGIVTEL---RAKHMVDKLNLMTKEKVKTIRDGQEVALNPEELV
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     ----------------------------------------------------------------------
AT2B1_PIG       ----------------------------------------------------------------------
AT2B1_HUMAN     ----------------------------------------------------------------------
PMA1_NEUCR      ---------------------------------------------------------DGTLKEIEAPEVV
ATKB_SALTI      -------------FTGVISLWLWFTVANFAEALAEGRSKAQANSLKGVKKTAFARRLDAQADNVPAAELR
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       ----------------------------------------------------------------------
AT2B3_HUMAN     ----------------------------------------------------------------------
AT2B1_RAT       ----------------------------------------------------------------------
AT12A_HUMAN     -------------------------------------------------PQQALVIRDSEKKTIPSEQLV
CTPE_MYCTU      ----------------------------------------------------------------------
CTPE_MYCBO      ----------------------------------------------------------------------
PMA4_NICPL      ---------------------------------------------------------DGRWSEQEAAILV
AT12A_CAVPO     -------------------VVILTGIFAYYQEAKSTNIMSSFSKMI---PQEALVTRDAEKKVIPAEQLV
PMA9_ARATH      ---------------------------------------------------------DGKWSEQEAAILV
ATMA_ECOLI      ISYATEDLFAAGVIALMVAISLLNFIQEARSTKAADALKAMVSNTATVLRVINDKGENGWLE-IPIDQLV
ATMA_ECO57      ISYATEDLFAAGVIALMVAISLLNFIQEARSTKAADALKAMVSNTATVLRVINDKGENGWLE-IPIDQLV
AT2B2_OREMO     ----------------------------------------------------------------------
ATC1_YARLI      L-LLLIGAAAVSFFSITLAILIVTTVGFVQE----YRSEKSLEALNKLVPPEAHLIRAGNSQTVLASTLV
ATCL_MYCPN      ----------------------------------------------------------------------
AT2C2_HUMAN     -------------------------------------SEKSLEELTKMVPPECNCLREGKLQHLLARELV
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     ---------------------------------------------------------DGRWGEQDAAILV
AT2B1_RABIT     ----------------------------------------------------------------------
AT12A_RAT       -----------------VLVVILTGIFAYYQEAKSTNIMASFSKMI---PQQALVIRDAEKKVISAEQLV
PMA1_ARATH      ---------------------------------------------------------DGKWSEQEAAILV
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       --------------SIALAVLIVVTVGFIQE----YRSEKSLEELTKLVPPECNCLRDGKLRHMLARDLV
ATMA_SALTY      ---------------------------------AMVSNTATVLRVINENGENAWLEL--PIDQLVP----
ATCL_SYNE7      -------------------------------------AEKALAALKGMAAPLVRVRRDNRDQEIPVAGLV
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      ----------------AVGFIQEYQAGSIVDEL-----KKTLANS-------AVVIRDGNLVEVPSNEVV
ATN5_YEAST      ---------------------------------------KTMNSLKNLSSPNAHVIRNGKSETINSKDVV
ATN2_YEAST      ---------------------------------------KTMNSLKNLSSPNAHVIRNGKSETINSKDVV
ATN1_YEAST      ---------------------------------------KTMNSLKNLSSPNAHVIRNGKSETINSKDVV
AT2C2_MOUSE     -------------------------------------SEKSLEELTKLVPPECNCLRDGKLRHMLARDLV
ECA4_ARATH      ------GEMGITAFVEPLVIFLILIVNAIVGIWQETNAEKALEALKEIQSQQATVMRDGKVSSLPAKELV
AT1A_HYDAT      GIVLSVVVIITGCFS-------YYQ--ESKSSKIMESFKKMI-------PQEALVLRDGKKITINAEQCX
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      MEAAAVLAAGLEDWVDVICGLLFLNAGEFQAGSIVEELKKTLANT-------ATVIRDGSVQEAPANEIV
PMA1_CANAL      ----------------------------------------------------------------------
ECA1_ARATH      ------GEMGITAFVEPLVIFLILIVNAIVGIWQETNAEKALEALKEIQSQQATVMRDGKVSSLPAKELV
ATP4A_XENLA     -----------------IAVVVVTGCFGYYQEFKSTNIIASFKNLV---PQQATVVRDGDKFQINANQLV
AT2C1_RAT       -------------------------------------SEKSLEELSKLVPPECHCVREGKLEHTLARDLV
AT1A_ARTSF      ------------------------------------NASKIMDSFKNLMPQFAFVIRDGKKIQLKAEEVT
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     -------------------------------------SEKSLEELSKLMPPECHCVREGKLEHTLARDLV
AT12A_RABIT     -------------------------------------------------PQQAVVIRDSEKKVIPAEQLV
ACA8_ARATH      LMVAAVASLALGIKTEGIKESIAFAVILVIVVTAVSDYKQSL-QFQNLNDEKRNIHLEGRRVEISIYDIV
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     -------------------------------------SEKSLEELSKLVPPECHCVREGKLEHTLARDLV
AT2C1_HUMAN     -------------------------------------SEKSLEELSKLVPPECHCVREGKLEHTLARDLV
AT1A_TAESO      -------------------------------------SSKIMESFAKLVPQYAVVIRGGQRIDAPAEALV
ATP4A_RAT       -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
ATP4A_RABIT     -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
ATP4A_PIG       -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
ATP4A_MOUSE     -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
ATP4A_HUMAN     -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
ATP4A_CANFA     -------------------------------------STNIIASFKNLVPQQATVIRDGDKFQINADQLV
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEDVV
AT1A1_MOUSE     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEDVV
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      ------------------------------------NAEKALEALKEMQGESAKVLRDGYLVPDFPKELV
AT1B_ARTSF      ----------------------------IFSYYQENKSSRIMDSFKNLVPQYALALREGQRVTLKAEELT
AT1A4_MOUSE     -------------------------------------SSKIMESFKNMVPQQALVIRDGEKMQINVRDVV
ECA2_ARATH      ------------------------------------NAEKALEALKEMQCESAKVLRDGNLPNLPARELV
AT2C1_MOUSE     -------------------------------------SEKSLEELSKLVPPECHCVREGKLEHTLARDLV
AT1A_TORCA      -------------------------------------SSKIMDSFKNMVPQQALVIRDGEKSSINAEQVV
AT1A3_RAT       -------------------------------------SSKIMESFKNMVPQQALVIREGEKMQVNAEEVV
AT1A3_OREMO     -------------------------------------SSKIMESFKNMVPQQALVIREGEKVQVNAEEVM
AT1A3_MOUSE     -------------------------------------SSKIMESFKNMVPQQALVIREGEKMQVNAEEVV
AT1A3_HUMAN     -------------------------------------SSKIMESFKNMVPQQALVIREGEKMQVNAEEVV
AT1A2_PONAB     -------------------------------------SSKIMDSFKNMVPQQALVIREGEKMQINAEEVV
AT1A1_SHEEP     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
AT1A1_RABIT     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEDVV
AT1A1_PONAB     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
AT1A1_OREMO     -------------------------------------SSKIMESFKNLVPRQALGIRDGEKKNINAEEVV
AT1A1_HUMAN     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
AT1A1_HORSE     -------------------------------------SSKIMESFKNMVPQQALVVRNGEKMSINAEEVV
AT1A1_CHICK     -------------------------------------SSKIMESFKNMVPQQALVVRNGEKMSINAEGVV
AT1A1_BOVIN     -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
AT1A1_ANGAN     -------------------------------------SSRIMDSFKNLVPQQALVIRDGEKKCINAEEVV
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     -------------------------------------SSKIMESFKNMVPQQALVIRGGEKMQINVQEVV
AT1A3_CHICK     -------------------------------------SSKIMESFKNMVPQQALVIREGEKMQLNAEEVV
AT1A2_CHICK     -------------------------------------SSKIMDSFKNMVPQQALVIREGEKIQINAENVV
AT1A2_BOVIN     -------------------------------------SSKIMDSFKNMVPQQALVVREGEKMQINAEEVV
AT1A1_XENLA     -------------------------------------SSKIMESFKNMVPQQALVIRSGEKLSINAEEVV
AT1A1_BUFMA     -------------------------------------SSRIMESFKNMVPQQALVIRNGEKLSINAENVV
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      WGVTLVNAI-IGYIQEAKA------------EGAIASLAKAVTTEATVLRDGQNL-------RIPSQDLV
AT1A2_RAT       -------------------------------------SSKIMDSFKNMVPQQALVIREGEKMQINAEEVV
AT1A2_MOUSE     -------------------------------------SSKIMDSFKNMVPQQALVIREGEKMQINAEEVV
AT1A2_HUMAN     -------------------------------------SSKIMDSFKNMVPQQALVIREGEKMQINAEEVV
PMA2_SOLLC      ----------------------------------------------------------------------
AT1A1_CATCO     -------------------------------------SSKIMDSFKNLVPQQALVVRDGEKKQINAEEVV
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      ---------------------------------------------------------DGRWGEQEASILV
AT1A4_RAT       -------------------------------------SSKIMESFKTMVPQQALVIRDGEKMQINVRDVV
AT1A1_PIG       -------------------------------------SSKIMESFKNMVPQQALVIRNGEKMSINAEEVV
ATC_TRYBB       ----------------------------------------------------------------------
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      ----------------------------------------------------ATVYRDSKWQQIDAAVLV
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      ---------------------------------------------------------DGKWKEEDAAVLV
ATXA_LEIDO      ----------------------------------------------------ATVYRDSKWQQIDAAVLV
PMA1_DUNBI      -AIISIALLDVADFVLIVGLLLINAIISFYEE---SNADKAIKALTAALAPKAMVVRDGAIVTIDAVNLV
PMA1_ORYSJ      ---------------------------------------------------------DGRWGEQEAAILV
ATC1_DUNBI      IAISEGESIQSGLIEPMVILLILVAVGVVTE----RNAEKAIEQLKSYEADDATVLRNGQLQLIPSADIV
PMAX_ARATH      ---------------------------------------------------------DGKWSEQEASILV
PMA3_ARATH      ---------------------------------------------------------DGKWSEQEASILV
PMA4_ARATH      ---------------------------------------------------------DGRWGEQDAAILV
YD56_SCHPO      --------LKIGYLSTYIAPLIFV--------LLITLTKEAVDDLKRRRRDYANNEITVNDSPCAAQNIQ
ATMB_SALTY      -------------------------------------------------------------EEIPIEELV
AT2A1_MAKNI     ------------------------------------NAEDAIEALKEYEPEMGKVYRSDRVQRIKAREIV
AT2A2_CHICK     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKARDIV
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     STTAFVEPIVI------IMILIANAVVGVWQE---RNAESAIEALKEYEPEMGKVIRADRVQRIRARDIV
PMA1_DUNAC      ---------------------------------------------------------NGAMVTIDAVDLV
ATC_ARTSF       -----------------------------------KNAESAIEALKEYEPEMGKVIRADKIQKIKARDLV
ATC1_DROME      ------------------------------------NAESAIEALKEYEPEMGKVVRQDKIQKVRAKEIV
ATC1_ANOGA      -------------FVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRGDKVQKIRAKEIV
AT2A3_RAT       TTTA---------FVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRVQRIRARDIV
AT2A3_MOUSE     TTTA---------FVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRVQRIRARDIV
PMA8_ARATH      ---------------------------------------------------------DGKWGEQEASILV
ATC1_DROPS      ------------------------------------NAESAIEALKEYEPEMGKVIRQDKIQKVRAKEIV
AT2A2_HUMAN     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A1_RANES     ------GEETVTAFVEPFVILLILIANAVVGVWQERNAEDAIEALKEYEPEMGKVYRSDRVQRIKARELV
AT2A2_RAT       ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A2_RABIT     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A2_PIG       ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A2_MOUSE     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A2_FELCA     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A2_CANFA     ------GEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRVQRIKAKDIV
AT2A1_HUMAN     ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
PMA10_ARATH     ---------------------------------------------------------DGQWQEQDASILV
AT2A3_HUMAN     TTTA---------FVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRVQRIRARDIV
AT2A1_RAT       ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
AT2A1_CHICK     ------GEETITAFVEPFVILLILIANAVVGVWQERNAENAIEALKEYEPEMGKVYRADRVQRIKARDLV
ATX9_TETTH      ---------------------------------------------------------------VASNMIA
AT2A1_MOUSE     ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
PATS_METJA      ----------------------------------------------------------------------
AT2A1_RABIT     ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
AT2A1_BOVIN     ------------------------------------NAENAIEALKEYEPEMGKVYRADRVQRIKARDIV
YH2M_CAEEL      YYASLIVILSLGSI-----VMDVYQIRT--QEIRLRSMVHSTESVEVIR--------EGTEMTIGSDQLV
CTPI_MYCTU      ----------------------------------------------------------------------
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       ----------------------------------------------------------------------
AT133_HUMAN     ----------------------------------------------------------------------
AT8B5_MOUSE     QLVPQISSLAYTTVIPLIVVLSITGVKDAIDDVKRHRSDQQINN------RSVSILVNGRVEEIKWRNVQ


                         +         .         .         .         .         *         .:210
query           KGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGETNPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTV
ATZN_SYNY3      VDDLILVKPGEKVPLDGEILGGTSQVDTSALTGESVPGTVKPGDTILAGMINQSGVLTIRVTKLFSESSI
CADA_BACSU      TGDIIVVNPGESIPLDGKVVQGSAMVDTSALTGESVPRKAAEGQDVMSGFINQNGVLHIEVTKGYQESAV
HMCT_HELPY      VNDIXXXXXXXXXXXXXXXXXXESLLDERALSGESMPVNVSENSKVLGGSLNLKAVLEIQVEKMYKDSSI
HMCT_HELPJ      INXXXXXXXXXXXXXXXXXXKGESLLDERALSGESMPVNVSERSKVLGGSLNLKAVLEIQVEKLYKDSSI
HMCT_HELFE      IGDVVIVKVGEKIPTDGVVLRGESLLDQKALTGESLPVNVKEHSAVLGGSINLKGVLEIQVSKLYADSSV
CADA_BACPF      VGDIMIVKPGQKIAMDGVVVSGYSAVNQTAITGESVPVEKTVDNEVFAGTLNEEGLLEVEITKLVEDTTI
CADA1_STAAU     VGDIMIVKPGEKIAMDGIIVNGLSAVNQAAITGESVPVSKAVDDEVFAGTLNEEGLIEVKITKYVEDTTI
CADA_STAAR      VGDIMIVKPGEKIAMDGIIINGVSAVNQAAITGESVPVAKTVDDEVFAGTLNEEGLLEVKITKYVEDTTI
CADA2_STAAU     VGDIMIVKPGEKIAMDGIIINGVSAVNQAAITGESVPVAKTVDDEVFAGTLNEEGLLEVKITKYVEDTTI
CADA1_LISMO     IGDIMIIKPGQKIAMDGVVIKGYSAINQSAITGESIPVEKKVDDEVFAGTLNEEGLLEVKVTKHVEDTTI
CADA2_LISMO     IGDIMIIKPGQKIAMDGHVVKGYSAVNQAAITGESIPVEKNIDDSVFAGTLNEEGLLEVAVTKRVEDTTI
ZOSA_BACSU      AGDMIVIKPGERVAADGIIESGSTSLDESALTGESMPVEKNTGDTVFTGTVNRNGSLTVRVTKANEDSLF
AHM3_ARATH      TNTVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEAFPVPKLKDSTVWAGTINLNGYITVNTTALAEDCVV
AHM4_ARATH      INTVVSVKAGESIPIXXXXXXXXXXXXEKTLTGESFPVSKQRESTVMAATINLNGYIKVKTTALARDCVV
COPA_ARCFU      VGDIVIVRPGEKIPVDGVVVEGESYVDESMISGEPVPVLKSKGDEVFGATINNTGVLKIRATRVGGETLL
ATZN_ECOLI      PGDVIEVAAGGRLPADGKLLSPFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSEPGASAI
COPA_BACSU      VNDIVYVKPGERIPVDGEVVEGRSAVDESMITGESLPVDKNPGDSVTGSTVNANGFLKIKAVNVGKDTAL
COPA_STAES      VGDTLLIKPGEKIPVDGKVTKGDTSIDESMLTGESIPVEKSSGDSVIGSTMNKNGSIMIEATQVGGDTAL
COPA_STAEQ      VGDTLLIKPGEKIPVDGKVTKGDTSIDESMLTGESIPVEKSSGDSVIGSTMNKNGSIMIEATQVGGDTAL
COPB_ARCFU      PGDKVLVKPGEKIPVDGIVVEGESFVNEAMLTGESKPVAKKPGDTVIGGAINGEGSLVVEVEKTGKDTYL
COPA_STAHJ      VDDILLIKPGEKIPVDGQIIKGETAIDESMLTGESMPVDKHVDDVVIGSTMNTNGVITIMATKVGKDTAL
AHM5_ARATH      PGDTLKVHPGAKIPADGVVVWGSSYVNESMVTGESVPVSKEVDSPVIGGTINMHGALHMKATKVGSDAVL
SILP_SALTY      PGDKLRIRPGESIPVDGIVVEGKTTVDESMVTGESMPVTKTEGEPVIGGTINQTGSLIIRAEKVGDETML
AHM2_ARATH      XXXXXXXX--ETIPIDGIVVDGNCEVDEKTLTGEAFPVPKQRDSTVWAGTINLNGYICVKTTSLAGDCVV
ATCU2_RHIME     AGDVIRIRPGEKIPVDGTVIDGSSYVDEAMITGEPLPVQKTADSAVVGGTINKTGSITFKATKVGSDTLL
AHM7_ARATH      KNDVIKIVPGAKVASDGYVIWGQSHVNESMITGEARPVAKRKGDTVIGGTLNENGVLHVKVTRVGSESAL
ATCS_SYNY3      INDVVRVRPGEKIPVDGVVVAGNSTVDESLVTGESFPVDKTVGTEVIGATLNKSGSLDIQVSKLGQDSXX
COPA_SALTI      PGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSILFRASAVGSHTTL
COPA_SALTY      PGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTL
ATCU_SINMW      XGDVIRIRPGEKIPVDGTVTDGSSYVDESMITGEPVPVQKATDSAVIGGTINKTGSITFKATKVGSDTLL
ATCU1_RHIME     VGDVIRIRPGEKIPVDGTVLDGNSYVDESMITGEPVPVQKAAGAEVVGGTINKNGSFTFRATKVGGDTLL
COPA_ENTHR      IDDILVIRPGEQVPTDGRIIAGTSALDESMLTGESVPVEKKEKDMVFGGTINTNGLIQIQVSQIGKDTVL
COPA_STAAT      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAAE      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAAC      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAA8      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAA3      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
CTPV_MYCTU      VGDLVRVRPGEKIPVDGEVTDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLLTVRATAVGADTAL
COPA_STAAN      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAAM      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAA9      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAA2      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAA1      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAAW      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAAS      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_STAS1      EGDYLIIKPGEKIPVDGKIIKGKTSIDESMLTGESMPVEKVQDDNVIGSTMNKNGSITVKATKVGKDTAL
COPA_STAAR      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
Y290_HAEIN      IGEIIRANQGERIAADGVIESGNGWCDESHLTGESRPEEKQKGGKVLAGAMVTEGSIIYRANQLGSQTLL
COPA_STAAB      VGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTAL
COPA_HELFE      KGDILQILPGSYIPVDGVLFKGEAEVDESMLSGESLPVYKKEGMDLFAGTLNTTTTFQMRATHTKAQSTL
COPA_ECO57      PGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTL
COPA_ECOLI      PGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTL
COPA_YERPE      LGMILRLTTGDRVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTL
ATP7B_MOUSE     RGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTL
ATP7B_SHEEP     RGDIIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSMVIAGSMNAHGSVLITATHVGNDTTL
ATP7B_RAT       RGDIIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLIKATHVGNDTTL
ATP7B_HUMAN     RGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTL
ATCU_RHILV      VADRLRVRPGERVPVDGSVLEGQSTVDESMISGEPLPVEKSKGDPLTGGTINKNGTFVMSAEKVGADTVL
COPA2_HELPY     VGDILKVLPGSAIAVDXXXXXXXXXLDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQDNKNSTL
ATP7A_CRIGR     RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTL
COPB_STAAU      IDDIVEVRAGESIPTDGIIVRGETSIDESLVTGESKKVHKTHNDDVIGGSINGSGTVQVKVTATGENGYL
COPB_STAAR      IDDIVEVRAGESIPTDGIIVRGETSIDESLVTGESKKVHKTHNDDVIGGSINGSGTVQVKVTATGENGYL
ATU2_YEAST      VNDIVEIKPGMKIPADGIITRGESEIDESLMTGES--ILVPKKTPVIAGSVNGPGHFYFRTTTVGEETKL
COPA3_HELPY     VGDILKVLPGSAIAVDXXXXXXXXXLDESMLSGEALPVYKKVGDKVFSGTLNSHTSFLMKATQNNKNSTL
COPA1_HELPY     VGDILKVLPGTLIAVDXXXXXXXXXLDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTL
CTPA_MYCTU      EQQRFVVRPGQIVAADGLAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGRLIVEAAAVGADTQF
FIXI_RHILV      AGDEISIAAGERVPVDGIVVSGESDLDLSIVTGESSPVTVASDSEVSSGAMNLTGSLVLRATRIAKNSLL
CTPC_MYCLE      IGDEVVVHEHVAIPVDGEVIDGEAVVNQSAITGENLPVSVMAGSHVHAGSVVVRGRLMVRASAVGKHTTI
ATU2_SCHPO      RGDLILVKPGEIIPVDGTVVEGSSYVDESSVSGEPVPVHKTIDDELLSGTANGNGRLLVKATKSPRESQL
COPB_ENTHR      EGDRLIVRAGDKMPTDGTIDKGHTIVDESAVTGESKGVKKQVGDSVIGGSINXXXXXXXXXXXXXXNGYL
COPA_HELPJ      VGDILKVLPGSAIAVDXXXXXXXXXLDESMLSGEALPVYKKVGDKVFSGTLNSNTSFLMKATQDNKNSTL
FIXI_BRAJA      PGDIVLLRPGERCAVDGTVIEGRSEIDQSLITGETLYVTAEQGTPVYAGSMNISGTLRVRVSAASEATLL
ATCS_SYNE7      VEDWVRVRPGEKVPVDGEVIDGRSTVDESMVTGESLPVQKQVGDEVIGATLNKTGSLTIRATRVGRETFX
COPA_HELPY      VGDILKVLPGSAIAVDXXXXXXXXXLDESMLSGEALPVYKKVGDKVFSGTFNSHTSFLMKATQNNKNSTL
COPA_VIBCH      ------IKPGEQVPVDGVVSTGHSYLDESMLTGEPIPVLKEAGAKVAAGTLNQDGSLVITATGIGAQTML
CTPA_MYCLE      EQQRFVVRPGQTIAADGLVIDGSATVSMSPITGEAKPVRVNPGAQVIGGTVVLNGRLIVEAAAVGDETQL
AHM1_ARATH      VGSYVLVGTGEIVPVDCEVYQGSATITIEHLTGEVKPLEAKAGDRVPGGARNLDGRMIVKATKAWNDSTL
COPB_STAAT      TDDIVEVKAGESIPTDGIIVQGQTSIDESLVTGESKKVQKNQNDNVIGGSINGSGTIQVKVTAVGEDGYL
COPB_STAA3      TDDIVEVKAGESIPTDGIIVQGQTSIDESLVTGESKKVQKNQNDNVIGGSINGSGTIQVKVTAVGEDGYL
CTPC_MYCTU      IGDEVVVHEHVAIPVDGEVVDGEAIVNQSAITGENLPVSVVVGTXXXXXXXXXXXXXXXXXXXXXNQTTI
CTPC_MYCBO      IGDEVVVHEHVAIPVDGEVVDGEAIVNQSAITGENLPVSVVVGTXXXXXXXXXXXXXXXXXXXXXNQTTI
COPB_STAES      TDDIVEVKAGESIPTDGIIVQGQTSIDESLVTGESKKVQKNQNDNVIGGSINGSGTIQVKVTAVGEDGYL
AHM6_ARATH      VGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGSQVAAGSINLNGTLTVEVHRSGGETAV
ATP7A_MOUSE     RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTL
ATP7A_RAT       RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTL
COPB_STAEQ      TDDIVEVKAGESIPTDGIIVQGQTSIDESLVTGESKKVQKNQNDNVIGGSINGSGTIQVKVTAVGEDGYL
CTPB_MYCTU      KRQRFVTRPGETXXXXXXXXXXXXXXXMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQF
CTPB_MYCBO      KRQRFVTRPGETXXXXXXXXXXXXXXXMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQF
COPB_STAHJ      TDDIVEVKAGESIPTDGIIVQGQTSVDESLVTGESKKVQKNQNDNVIGGSINGSGTIQVKVTAVGEDGYL
CTPB_MYCLE      KQQHFLVRPGETITADGVVIDGTATIDMSAITGEARPVHASPASTVVGGTTVLDGRLVIEATAVGGDTQF
CTPD_MYCTU      XXXXXXXXXXXXIPADGAVLSGASDVDQRSITGESMPVAKARGDEVFAGTVNGSGVLHLVVTRDPSQTVV
CTPD_MYCBO      XXXXXXXXXXXXIPADGAVLSGASDVDQRSITGESMPVAKARGDEVFAGTVNGSGVLHLVVTRDPSQTVV
FIXI_RHIME      PGDRLIVAAGERVPVDGRVLSGTSDLDRSVVNGESSPTVVTTGDTVQAGTLNLTGPLTLEATAAARDSFI
ATP7A_HUMAN     RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTL
ATKB_BACC7      KGDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIIITSNPGESFI
ATKB2_LISIN     KGDIVLVNMGEVIPSDGEIIEGVASVDESAITGESAPVLKESGASVTGGTTVASDYLKIQITSNPGESFI
ATU1_YEAST      YGDIFKVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNTI
ATKB_THETN      KGDIVICEAGDIIPADGEIIEGLAAIDESAITGESAPVIKEAGSSVTGGTKVISDRIKIRVTVDEGESFL
CTPG_MYCTU      VGDQMIVKPGERLATDGIIRAGRTALDVSAITGESVPVEVGPGDEVFAGSINGLGVLQVGVTATAANNSL
CTPG_MYCBO      VGDQMIVKPGERLATDGIIRAGRTALDVSAITGESVPVEVGPGDEVFAGSINGLGVLQVGVTATAANNSL
ATKB_BACCN      KGDMVLVKQGEMIPGDGEVIRGLASVDESAITGESAPVMKEAGGSVTGGTMVVSDEITIRITSNPGESFL
ATKB_BACCR      KGDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACWK      KGDIVIVKQGEMIPNDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACC4      KGDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACC2      KGDVVIVKQGEMIPNDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_CLOAB      KGDVVLVENGDVIPNDGEVVDGVASVDESAITGESAPVMKEPGASVTGGTKVVSDWLKVEITATPGESFL
ATKB_BACCZ      KGDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACC3      KGDLVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_THEVO      KNDIIIIYKDEIVPIDGEVIEGSGYVDESNVTGESRAVMKVIGDTVTGSTRLVTDKLKIRATADPGSTFI
ATKB_LEPIC      IGDIVICEAGDLISGDGEILEGIASVDESAITGESAPVVRESGSAVTGGTKVLSDRIKISITAEQGRTFL
ATKB_BACHK      KDDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACC0      KDDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACAH      KDDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGESFI
ATKB_BACAC      KDDVVIVKQGEMIPSDGEVIKGLASVDESAITGESAPVIKEAGGSVTGGTMVVSDEITIVITSNPGKSFI
ATKB_LEPIN      IGDIVICEAGDLIPGDGEILEGIASVDESAITGESAPVVRESGSAVTGGTKVLSDRIKISITAEQGRTFL
ATKB_THEAC      KGDIIVVYRDEIIPIDGEVIEGSGYVDESNVTGESRAVMKVIGDTVTGSTRLVTDKIKIRATADPGSTFI
ATSY_SYNE7      AGDYVQVLPGDRIPVDGCIVAGQSTLDTAMLTGEPLPQPCQVGDRVCAGTLNLSHRLVIRAEQTGSQTRL
ATSY_SYNP6      AGDYVQVLPGVRIPVDGCIVAGQSTLDTAMLTGEPLPQPCQVGDRVCAGTLNLSHRLVIRAEQTGSQTRL
ATKB_XANCP      PGDFVLVSEGEFVPADGEIVRGLATINEAAVTGESAPVLRTDRSGVIGGTRVLSDEIVFKVTAEPGQSFL
ATKB_STAHJ      KGDIVRVETGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDVIGGTSVASDWLEVEITSEPGHSFL
ATKB1_ANASP     QGDTVYVVAGDIIPADGEVIMGVASVDESAITGESAPVLKESGSDVASGTRIISDELIVRVTSDPGKGFI
ATKB_XANAC      PGDYVMVSEGEFVPADGEIVRGVATINEAAVTGESAPVLRTDRSGVIGGTRVLSDEIVFKVTAEPGHSFL
ATKB_CAUCR      VGEVILVEAGEVIPTDGEIIEGMASVNEAAITGESAPVIRESGSAVTGGTTVVSDWIKMRVTAEAGSTFL
ATKB_STAEQ      KGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDVIGGTSVASDWLEVEITSEPGHSFL
ATKB1_STAAR     KGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDVIGGTSVASDWLEVEITSEPGHSFL
ATKB1_STAAN     KGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDVIGGTSVASDWLEVEITSEPGHSFL
ATKB1_STAAM     KGHIVRVATGEQIPNDGKVIKGLATVDESAITGESAPVIKESGGDVIGGTSVASDWLEVEITSEPGHSFL
ATKB_STAAB      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB2_STAAR     AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_STAAW      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_STAAS      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_STAAT      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_STAAE      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_STAAC      AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_DEIRA      RGDLVVVEAGEMIPADGEIVEGLASVDESAITGESAPVIGTDHSGVTGGTKVLSDRIVIQITSGAGESFL
ATKB2_STAAN     AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB2_STAAM     AGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDVIGGTLVTSDWLEIRVESEAGTSFL
ATKB_RHIME      VGDLVLVQAGELIPGDGEVVEGVASVNESAITGESAPVIREAGSAVTGGTEVLSDWVKVRITTAPGSTFV
ATKB2_ANASP     RGDVIKVVANDMIPGDGEVIQGIGSVDESAITGESAPVLKQPGTDIASGTRLLSDELIIRITADPGQGFI
ATKB_MYCTU      LDDVVEVSAGETIPSDGEIIEGIASVDESAITGESAPVIRESGSAVTGGTVVLSDRIVVRITAKQGQTFI
ATKB_MYCBO      LDDVVEVSAGETIPSDGEIIEGIASVDESAITGESAPVIRESGSAVTGGTVVLSDRIVVRITAKQGQTFI
ATKB_SYNY3      KGDRIVVSVGDIIPADGEVLEGVASVDESAITGESAPVLKEPGSDVASGTRIISDELIIRVTADPGKGFI
ATKB_STRCO      ---------GDVIPGDGDVVEGVASVDESAITGESAPVIRESGSAVTGGTKVLSDRIVVRITTKPGETFI
ATKB_MYXXA      KGDEVICEAGDLIPGDGEVVEGIASVDESAITGESAPVIRESGSAVTGGTKVLSDRIRVRISANPGDSFL
ATKB_AGRT5      VNDVVLVEAGDIIPSDGEVIEGVASVNEAAITGESAPVIRESGSAVTGGTQVLSDWIRVRITAAAGSTFL
ATKB1_LISIN     KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVIRVTAVSGESFL
ATKB_HALSA      ---VVFVDEGDIIPRDGTVVEGSASVDESAITGESEPVIRQSGTSVVGGTEVLSDRIKVEVTSEEGESFL
ATKB_CLOBA      KGDIVIVVAGEQVPADGEVIDGAASVDESAITGESAPVIRESGSAVTGGTTVISDWLIIEVTSEAGESFL
ATKB_RHILO      VGDIVLVEAGDIIPSDGEVVEGVASVNEAAITGESAPVIRESGSAVTGGTQVLSDWIRVRITAAAGHTFL
ATKB_PSEAE      KGDVVRVQAGEMIPGDGEVIEGVAAVNEAAITGESAPVIVTGNTQVVSDWLL------VRIGANPGESTL
ATKB_CLOBB      KGDIVIVVAGEQVPADGEVIDGAASVDESAITGESAPVIRESGSAVTGGTTVISDRLIIQVTSEAGESFL
ATKB_LISMO      KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVVRVTAVSGESFL
ATKB_LISMF      KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVVRVTAVSGESFL
ATKB_LISMC      KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVVRVTAVSGESFL
ATKB_ENTFA      RNDLVYVRAGEQIPADGDVIEGAASVDESAITGESAPVIRESGSAVTGGTTVVSDYLVIRVTSENGQSFL
ATKB_YERPY      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPS      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERP3      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_POLSQ      KGDIFIAEANDVIAADGEVIAGVASVDESAITGESAPVIVTGGTRVLSDWIV------VRVTVNPGETFI
ATKB_LISMH      KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVVRVTAVSGESFL
ATKB_YERPP      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPN      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPG      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPE      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPB      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_YERPA      KGDLVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIVTGGTRVLSDWLVVE--CRVNPGETFLD---
ATKB_LISW6      KDDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGSAVTGGTTLVSDWLVIRVTAVSGESFL
ATKB_PHOLL      KGDIVIIEAGETIPCDGEVIEGGASVDESAITGESAPVIRESGSSVTGGTHVLSDWLVVECSVNPGETFL
ATKB_CLOP1      KGDLIIVKAGEQIPADGDVVYGAASVDESAITGESAPVIVTGGTQVISDYIV------VKVSNNPGESFM
ATKB_SHIBS      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ANASL      QGDTVYVVAGDVIPADGEVIMGVASVDESAITGESAPVLKESGSDIASGTRIISDELIVRVTADPGKGFI
ATKB_YERE8      KGDVVLIEAGDTVPCDGEVLEGGASVDESAITGESAPVIRESGSSVTGGTRVLSDWLVVECSVNPGETFL
ATKB_RALSO      RGDIVLIEAGDMVPGDGEVIEGVASVDESAITGESAPVIVTGGTRVLSDWIVA------RITANPGESFL
ATKB_DECAR      KGDVIVVQAQETIPADGEVIEGVASVDESAITGESAPVIVTGGTRVLSDWIV------VRVTVNPGETFV
ATKB_ECOLU      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_HYDS0      KGDLFLLEKDDIIPIDGELIEGVLLVNESAVTGESAPVIRTDKSSVTAGTKXXXXXXXXXXXXNPGETFI
Y1226_METJA     PGDVVRIRIGDIVPADIILVDGDLVVDESALTGESLPVEKKIGDIAYSGSIVKKGEMTGIVKATGLNTYF
ATKB_SERP5      KGDVVLVEAGDTIPCDGEVLEGGASVDESAITGESAPVIRESGSSVTGGTRVLSDWLVVQCSVNPGETFL
ATC1_SCHPO      PGDLVILQIGDRVPADRIVEATELEIDESNLTGENSPSLTERNNIAFMGTLVRHGHGRGIVVATGSDTEF
ATKB_KLEP3      KGDVVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIRCSVNPGETFL
ATKB_KLEP7      KGDVVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIRCSVNPGETFL
ATKB_ERWT9      KGDWVLVEAGDIIPCDGEVLEGGASVDESAITGESAPVIRESGSSVTGGTRILSDWLVVQCSVNPGETFL
ATKB_ECOSM      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO5E      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO57      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOL6      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOL5      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO81      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO27      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOSE      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO7I      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO24      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_SHISS      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ESCF3      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOLI      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOHS      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECODH      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOBW      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO8A      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO55      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_SALCH      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_ECOLC      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
PMA1_DICDI      PGDVVMLKIGAIIPADRVIEAEQVKIDQSSLTGESLPVTKKIGDEVYSGSAMKQGEAKCVVTATGVNTFF
ATKB_SHIB3      KGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ACA1_ORYSJ      PGDVVHLAIGDQVPADGLFISGFSLLNESSLTGESEPVVVNEDNPLLSGTKVQDGSCKMLITTVGMRTQW
ATKB_ECOUT      KGDIVLVEASDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECOK1      KGDIVLVEASDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_ECO45      KGDIVLVEASDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIECSVNPGETFL
ATKB_TOLAT      KGDYVLVSAGEVIPYDGEVIEGVASVDESAITGESAPVIRESGSAVTGGTRVLSDWLVIGCTVNPGETFL
ATKB_ENT38      KGDVVLVEAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVVQCSVNPGETFL
PMA5_ARATH      PGDVISIKLGDIIPADARLLDGDPLIDQSSLTGESIPVTKNPSDEVFSGSICKQGEIEAIVIATGVHTFF
ATKB_SALSV      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALPB      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALTY      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALNS      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALHS      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALG2      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALEP      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALDC      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALA4      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALPK      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ATKB_SALPA      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGASVTGGTRILSDWLVIACSVNPGETFL
ACA2_ORYSJ      PGDAVHLAVGDQVPADGLFISGFSVLDESSLTGESEPVFVNEDNYLLSGTKVLDGSCKMLVTAVGMRTQW
ATCL_MYCGE      VGDIIFVDAGDIIPADGLLQVNNLRCLESFLTGESTPVDKTIDSNVFSGAQVVYGSGVFQVEAVGIKTQV
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     VGDVVHLSIGDQVPADGIFISGNLEIDESSLSGESEPSHVNKEKPLLSGTKVQNGSAKMLVTTVGMRTEW
PMA7_ARATH      PGDIVSIKLGDIIPADALLEGDPLKIDQATLTGESLPVTKNPGASVYSGSTCKQGEIEAVVIATGVHTFF
ACA5_ORYSJ      VGDIVHLSIGDQVPADGLYIHGYSLLDESSLSGESDPVYVSQDKPILAGTKVQDGSAKMIVTAVGMRTEW
PMA1_AJECA      PGDILQVEEGTIIPADGRIVTEEAFLQVSAITGES--LAVDKDTCYASSAVKRGEAFMVITATG--DNTF
ACA1_ARATH      -GDVVHLGIGDQIPADGLFISGFSVLNESSLTGESEPVSVSVEHPLLSGTKVQDGSCKMLVTTVGMRTQW
PMA2_ARATH      PGDIVSIKLGDIIPADALLEGDPLKVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFF
ACA7_ARATH      PGDVVHLAIGDQVPADGLFLSGSVVIDESSLTGESEPVMVTAQNPLLSGTKVQDGSCKMLVTTVGMRTQW
PMA1_NICPL      PGDIISIKLGDIIPADALLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAIVIATGVHTFF
ACA2_ARATH      PGDIVHLAIGDQVPADGLFLSGSVVIDESSLTGESEPVMVNAQNPLMSGTKVQDGSCKMMITTVGMRTQW
ACA6_ORYSJ      ----------------------------------------------------------------------
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      VGDIVHLSIGDQVPADGLYIHGYSLLDESSLSGESDPVYVSQDKPILAGTKVQDGSAKMIVTAVGMRTEW
ACA4_ARATH      VGDVVHLSIGDQVPADGIFISGNLEIDESSLSGESEPSHVNKEKPLLSGTKVQNGSAKMLVTTVGMRTEW
PMA1_SOLLC      PGDIISIKLGDIIPADALLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFF
PMA1_SCHPO      PGDILKLDEGTIICADGRVVTPDVHLQVSAITGES--LAVDKDPTFASSGVKRGEGLMVVTATG--DSTF
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       VGDIAQVKYGDLLPADGIIQGNDLKIDESSLTGESDHVKKTKDPMLLSGTHVMEGSGRMVVT--------
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      LGDVIRLSAGEQIPSDALVLEGFAEVNEAMLTGESDLVQKEVDXXXXXXXXXXXXXXXXQVHHVGADNYA
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     ----------------------------------------------------------------------
AT2B1_PIG       ----------------------------------------------------------------------
AT2B1_HUMAN     ----------------------------------------------------------------------
PMA1_NEUCR      PGDILQVEEGTIIPADGRIVTDDAFLQVSALTGESLAVDKHKGDQVFASSAVKRGEAFVVITATGDNTFV
ATKB_SALTI      KGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVI-------------------------------
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       ----------------------------------------------------------------------
AT2B3_HUMAN     ----------------------------------------------------------------------
AT2B1_RAT       ----------------------------------------------------------------------
AT12A_HUMAN     VGDIVEVKGGDQIPADRVLSSQGCRVDNSSLTGESEPQLETKNICFYSTTCLEGTVTGMVINTG--DRTI
CTPE_MYCTU      ------------------------------LTGEADPIAKDAGDTVMSGSFVVSGAGAYRATKVGXXXXX
CTPE_MYCBO      ------------------------------LTGEADPIAKDAGDTVMSGSFVVSGAGAYRATKVGXXXXX
PMA4_NICPL      PGDIISVKLGDIIPADALLEGDPLKIDQSALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFF
AT12A_CAVPO     VGDIVEIKGGDQIPADRLLFSQGCKVDNSSLTGESEPQLETKNIAFYSTTCLEGTATGMVINTG--DRTI
PMA9_ARATH      PGDIISIKLGDIVPADGRLLDGDPLIDQSALTGESLPVTKHPGQEVYSGSTCKQGELEAVVIATGVHTFF
ATMA_ECOLI      PGDIIKLAAGDMIPADRILQARDLFVAQASLTGESLPVATTRDTLCFMGTTVVSGTAQAMVIATGANTWF
ATMA_ECO57      PGDIIKLAAGDMIPADRILQARDLFVAQASLTGESLPVATTRDTLCFMGTTVVSGTAQAMVIATGANTWF
AT2B2_OREMO     ----------------------------------------------------------------------
ATC1_YARLI      PGDLVEFSVGDRIPADRIVKAVHLSIDESNLTGETTP--VTKDTNPVTGTPPTNTAYMGTLVRDGNGTGI
ATCL_MYCPN      ----------------------------------------------------------------------
AT2C2_HUMAN     PGDVVSLSIGDRIPADRLTEVTDLLVDESSFTGEAEPCLTTLSNIVFMGTLVQYGRGQGVVIGTGESSQF
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     PGDIISIKLGDIVPADALLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFF
AT2B1_RABIT     ----------------------------------------------------------------------
AT12A_RAT       VGDVVEIKGGDQIPADRLVFSQGCKVDNSSLTGESEPQLETKNIGFYSTTCLEGTATGIVINTG--DRTI
PMA1_ARATH      PGDIVSIKLGDIIPADALLEGDPLKVDQSALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFF
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       PGDVVSLSMGDRIPADRLTEVTDLLVDESSFTGEVEPCLSTLSNVVFMGTLVQCGKGQGVVIGTGEQSQF
ATMA_SALTY      -GDIIKLAAGDMIPADRIIQARDLFVAQASLTGESLPVAATRDTLCFMGTNVVSGTAQAVVMATGAGTWF
ATCL_SYNE7      PGDLILLEAGDQVPADALVESANLQVKESALTGEAEAVQKLADQQLPTDVVIGDRTNCLFQGTEVMNTEL
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      PGDILQLEDGVVIPADGVTEDCFIQIDQSAITGES--LAVDKDSTFSSSTVKRGEAFMIVTATG--DSTF
ATN5_YEAST      PGDICLVKVGDTIPADRLIETKNFDTDESLLTGESLP--VSKDANLVFGK-EEETSVGDRLNLAFSSSAV
ATN2_YEAST      PGDICLVKVGDTIPADRLIETKNFDTDESLLTGESLP--VSKDANLVFGK-EEETSVGDRLNLAFSSSAV
ATN1_YEAST      PGDICLVKVGDTIPADRLIETKNFDTDESLLTGESLP--VSKDANLVFGK-EEETSVGDRLNLAFSSSAV
AT2C2_MOUSE     PGDIVSLSMGDRIPADRLTEVTDLLVDESSFTGEVEPCLSTLSNVVFMGTLVQCGKGQGVVIGTGEQSQF
ECA4_ARATH      PGDIVELRVGDKVPADMRVVSSTLRVEQGSLTGESEAVSKTKKCMVFAGTTVVNGNCICLVTDTGMNTEI
AT1A_HYDAT      XXXXXXXXXXXRIPADRIVECKGLKVDNSSLTGESEPQIETKNLAFFSTNAVEGTATGIVV--RIGDNTV
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      PGDILKLEDGTVIPADGRLVTEECFLQVSSITGESLAVDKHYGDEVFSSSTVKRGEGFMIVTATGDNTFV
PMA1_CANAL      ----------------------------------------------------------------------
ECA1_ARATH      PGDIVELRVGDKVPADMRVVSSTLRVEQGSLTGESEAVSKTKKCMVFAGTTVVNGNCICLVTDTGMNTEI
ATP4A_XENLA     VGDLVEIKGGDRVPADRIITSQGCKVDNSSLTGESEPQLETRNIAFFSTMCLEGTATGIIINTG--DRTI
AT2C1_RAT       PGDTVCLSVGDRVPADRLFEAVDLSIDESSLTGETTPCLASRSNIAFMGTLVRCGKAKGIVIGTGENSEF
AT1A_ARTSF      VGDLVEVKFGDRIPADIRITSCQSMVDNSSLTGESEPQLETKNLAFFFTNTLEGTGRGI-VINVGDDSVM
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     PGDTVCLSVGDRVPADRLFEAVDLSVDESSLTGETTPCLASRSNIAFMGTLVRCGKAKGIVIGTGENSEF
AT12A_RABIT     VGDIVEIKGGDQIPADIRLLSAQGCVDNSSLTGESEPQLETKNITFYSTTCLEGTATGMVINTG--DRTI
ACA8_ARATH      VGDVIPLNIGNQVPADGVLISGHSLLDESSMTGESK--IVNKDA--------------------------
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     PGDTVCLSVGDRVPADRLFEAVDLSIDESSLTGETTPCLASRSNIAFMGTLVRCGKAKGVVIGTGENSEF
AT2C1_HUMAN     PGDTVCLSVGDRVPADRLFEAVDLSIDESSLTGETTPCLASRSNIAFMGTLVRCGKAKGVVIGTGENSEF
AT1A_TAESO      VGDIIDVKFGDRVPADRVIKASSFKVDNSALTGESEPQLETKNLAFFSTNAVEGTCRGVVVATG--DRTV
ATP4A_RAT       VGDLVEMKGGDRVPADIRILSAQGCVDNSSLTGESEPQLETRNIAFFSTMCLEGTAQGLVVSTG--DRTI
ATP4A_RABIT     VGDLVEMKGGDRVPADRILAAQGCKVDNSSLTGESEPQLETRNIAFFSTMCLEGTAQGLVVNTG--DRTI
ATP4A_PIG       VGDLVEMKGGDRVPADRILQAQGRKVDNSSLTGESEPQLETRNIAFFSTMCLEGTAQGLVVNTG--DRTI
ATP4A_MOUSE     VGDLVEMKGGDRVPADIRILSAQGCVDNSSLTGESEPQLETRNIAFFSTMCLEGTAQGLVVSTG--DRTI
ATP4A_HUMAN     VGDLVEMKGGDRVPADRILAAQGCKVDNSSLTGESEPQLETRNIAFFSTMCLEGTVQGLVVNTG--DRTI
ATP4A_CANFA     VGDLVEMKGGDRVPADRILQAQGCKVDNSSLTGESEPQLETRNIALFSTMCLEGTAQGLVVNTG--DRTI
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_MOUSE     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      PGDIVELRVGDKVPADATLKSSTLRVEQSSLTGESMPVLQAKENMVFAGTTVVNGSCICIVVNTGMCTEI
AT1B_ARTSF      MGDIVEVKFGDRVPADRVLEARSFKVDNSSLTGESEPQLETKNLAFFSTNAVEGTMRGIVIG--IGDNTV
AT1A4_MOUSE     LGDLVEVKGGDQIPADRVISAQGCKVDNSSLTGESEPQLETRNIIFFSTNCVEGTARGIVIATG--DYTV
ECA2_ARATH      PGDIVELNVGDKVPADMRVKTSTLRVEQSSLTGEAMPVLKGKENMVFAGTTVVNGSCVCIVTSIGMDTEI
AT2C1_MOUSE     PGDTVCLSVGDRVPADRLFEAVDLSVDESSLIGETAPCLASRSNIAFMGTLVRCGKAKGIVIGTGENSEF
AT1A_TORCA      VGDLVEVKGGDRIPADRIISACSCKVDNSSLTGESEPQLETKNIAFFSTNCVEGTARGIVIN--IGDHTV
AT1A3_RAT       VGDLVEIKGGDRVPADRIISAHGCKVDNSSLTGESEPQLETRNITFFSTNCVEGTARGVVVATG--DRTV
AT1A3_OREMO     AGDLIEVKGGDRIPADIRVTSAHGCVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVICTG--DRTV
AT1A3_MOUSE     VGDLVEIKGGDRVPADRIISAHGCKVDNSSLTGESEPQLETRNITFFSTNCVEGTARGVVVATG--DRTV
AT1A3_HUMAN     VGDLVEIKGGDRVPADRIISAHGCKVDNSSLTGESEPQLETRNITFFSTNCVEGTARGVVVATG--DRTV
AT1A2_PONAB     VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DRTV
AT1A1_SHEEP     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_RABIT     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVIYTG--DRTV
AT1A1_PONAB     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_OREMO     LGDLVEVKGGDRIPADRIISAHGCKVDNSSLTGESEPQLETRNISFFSTNCIEGTARGIVINTE--DRTV
AT1A1_HUMAN     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_HORSE     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_CHICK     VGDLVEVKGGDRIPADRIISAHGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTAVGIVIST--GDRTV
AT1A1_BOVIN     VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
AT1A1_ANGAN     AGDLVEVKGGDRIPADLRVASAQGCVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGVVINTG--DRTV
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     LGDLVEIKGGDRVPADRLISAQGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DSTV
AT1A3_CHICK     VGDLVEVKGGDRVPADRIISAHGCKVDNSSLTGESEPQLETRNITFFSTNCVEGTARGVVIATG--DRTV
AT1A2_CHICK     VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVISTG--DRTV
AT1A2_BOVIN     VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DRTV
AT1A1_XENLA     LGDLVEVKGGDRIPADRVISSHGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVNTG--DRTV
AT1A1_BUFMA     QGDLVEVKGGDRIPADRIISAHGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVINTG--DRTV
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      IGDIVSLASGDKVPADRLLKVRNLQVDESALTGEAVP--VEKAVELLP----EETPLAERLNMAYAXXXX
AT1A2_RAT       VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DRTV
AT1A2_MOUSE     VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DRTV
AT1A2_HUMAN     VGDLVEVKGGDRVPADRIISSHGCKVDNSSLTGESEPQLETRNICFFSTNCVEGTARGIVIATG--DRTV
PMA2_SOLLC      ----------------------------------------------------------------------
AT1A1_CATCO     IGDLVEVKGGDRIPADRIISSHGCKVDNSSLTGESEPQLETKNIAFFSTNCVEGTARGIVISTG--DRTV
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      PGDIVSIKLGDIVPADALLEGDPLKIDQSGLTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFF
AT1A4_RAT       LGDLVEVKGGDQVPADRVIAAQGCKVDNSSLTGESEPQLETRNIIFFSTNCVEGTARGVVIATG--DHTV
AT1A1_PIG       VGDLVEVKGGDRIPADRIISANGCKVDNSSLTGESEPQLETRNIAFFSTNCVEGTARGIVVYTG--DRTV
ATC_TRYBB       ----------------------------------------------------------------------
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      PGDLVKLASGSAVPADCSINEGVIDVDEAALTGESLPVTMGPEHMPKMGSNVVRGEVEGTVQYTGSLTFF
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      PGDIISIKLGDIIPADALLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFF
ATXA_LEIDO      PGDLVKLASGSAVPADCSINEGVIDVDEAALTGESLPVTMGPEHMPKMGSNVVRGEVEGTVQYTGSLTFF
PMA1_DUNBI      PGDVILIRLGNIVPADXXXXXXPMQIDQAALTGESLPAKKFTGDVAFSGSSIKQGERHAVVYATGVNTFF
PMA1_ORYSJ      PGDIISIKLGDIVPADALLEGDPLKIDQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFF
ATC1_DUNBI      PGDIVELAVGNKVPADTRVSTTSLKIDQSLLTGESNEQAVYQDNMLFSGTLXXXXXXXXXXXXXXSNTAI
PMAX_ARATH      PGDIVSIKPGDIIPCDALLEGDTLKVDQSALTGEFGPITKGPGEEVFSGTTCKQGEMEAVVIATGVHTFS
PMA3_ARATH      PGDIVSIKLGDIIPADALLEGDPLKVDQSALTGESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFF
PMA4_ARATH      PGDIISIKLGDIVPADALLEGDPLKIDQSALTGESLPVTKSSGDGVYSGSTCKQGEIEAVVIATGVHTFF
YD56_SCHPO      AGDVVYIAKDQRIPADMILVGNEAFIRTDQLDGETDKLRIPCSNQHTEGIVLNNQKRPISVDHTLWANTV
ATMB_SALTY      PGDVVFLAAGDLVPADRLLASRDLFISQSILSGESLPVVAGKDSEQLSLLDLGNICLMTNVTSGRAQAVV
AT2A1_MAKNI     PGDIVEVSVGDKVPADVSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTNXXXXXXXXXXXXXXVSTEI
AT2A2_CHICK     PGDIVEVAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVIATGV-NTEI
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     PGDIVEVAVGDKVPADRIIESTTLRVDQSILTGESDPRAVNQDKKLFSGTNXXXXXXXXXXXXXXXYTEI
PMA1_DUNAC      PGDVILIRIGNVVPADVKLEHGAVQIDQAALTGESLPAKKFTGNVAFSGSTVKQGERHAVVYATGVNTFF
ATC_ARTSF       PGDIVEISVGDKIPADLSILSTTLRIDQSILTGESDPRAVNQDKKLFSGTNVSAGKARGVVMGTGLNTAI
ATC1_DROME      PGDLVEVSVGDKIPADTHIYSTTLRIDQSILTGESDPRAVNQDKKLFSGTNVAAGKARGVVIGTGLSTAI
ATC1_ANOGA      PGDVVEVSVGDKIPADIKIYSTTIRIDQSILTGESDPRAVNQDKKLFSGTNVAAGKARGVVIGTGLNTAI
AT2A3_RAT       PGDIVEVAVGDKVPADLEIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIASGKALGVAVATGLH-TEL
AT2A3_MOUSE     PGDIVEVAVGDKVPADLEIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIASGKALGVAVATGLQ-TEL
PMA8_ARATH      PGDLISIKLGDIVPADALLEGDPLKIDQSALTGESLPTTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFF
ATC1_DROPS      PGDLVEVSVGDKIPADTHIYSTTIRIDQSILTGESDPRAVNQDKKLFSGTNVAAGKARGVVIGTGLSTAI
AT2A2_HUMAN     PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A1_RANES     PGDIVEVAVGDKVPADISIKSTTLRIDQSILTGETRAVNQDKKNMLFSGTNXXXXXXXXXXXXXXPNTEI
AT2A2_RAT       PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A2_RABIT     PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A2_PIG       PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A2_MOUSE     PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A2_FELCA     PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A2_CANFA     PGDIVEIAVGDKVPADTSIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAMGVVVATGV-NTEI
AT2A1_HUMAN     PGDIVEVAVGDKVPADIAIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKALGI-VATTGVGTEI
PMA10_ARATH     PGDIISIKLGDIIPADALLEGDPLKIDQSVLTGESLPVTKKKGEQVFSGSTCKQGEIEAVVIATGSTTFF
AT2A3_HUMAN     PGDIVEVAVGDKVPADLEIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTITSGKAVGVAVATGLH-TEL
AT2A1_RAT       PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAVGI-VATTGVSTEI
AT2A1_CHICK     PGDIAEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIGAGKAVGIVVATGV-NTEI
ATX9_TETTH      PGDIVLFKREVTLPFDCVILEGSCQVTEANITGENNDIFKYESSKLFQGMKIEDDILKVIVVRTGFGSYK
AT2A1_MOUSE     PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAVGI-VATTGVSTEI
PATS_METJA      ----------------------------------------------------------------------
AT2A1_RABIT     PGDIVEVAVGDKVPADISIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKALGI-VATTGVSTEI
AT2A1_BOVIN     PGDIVEVAVGDKVPADITIKSTTLRVDQSILTGESDPRAVNQDKKLFSGTIAAGKAIGI-VATTGVGTEI
YH2M_CAEEL      PGDILLIPPGCLMQCDSVLMNGTVIVNESVLTGESVPITLTDETNDSVFNIEKNSGTQVLQTRFYRGKKV
CTPI_MYCTU      ----------------------------------------------------------------------
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       ----------------------------------------------------------------------
AT133_HUMAN     ----------------------------------------------------------------------
AT8B5_MOUSE     VGDIIKLENNHPVTADMLLLSGLTYIETADLDGETN-LKVKQAISVTSAM--------------------


                         .         .         .         +         .         .         .:280
query           VKILELVQNASEKKTKTENFITKFSQIYTPVIVISAIMLASIPPLFLGQEFQVWLYRALIFLVISCPCAL
ATZN_SYNY3      AKVLDLVENASSKKASTEKFITQFARYYTPVIVFLSLAVALLPPLFIGADRADWVYRALVLLVISCPCGL
CADA_BACSU      SKILDLVQNASSRKARTENFITKFAKYYTPXXXXXXXXXXXXXXXXXGAALSDWVYRALIFLVISCPCAL
HMCT_HELPY      AKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVLPPLFSMGSFDEWIYRGLVALMVSCPCAL
HMCT_HELPJ      AKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVLPPLFSMGSFDEWIYRGLVALMVSCPCAL
HMCT_HELFE      AKIVDLVSNAVSQKSQTEKFITTFARYYTXXXXXXXXXXXXXXXXXGHGDFDTWIYRGLFALMVSCPCAL
CADA_BACPF      SKIIHLVEEAQGERAPSQAFVDKFAKYYTPIIMIIATLVAIVPPLFFDGSWETWIYQGLAVLVVGCPCAL
CADA1_STAAU     TKIIHLVEEAQGERAPAQAFVDKFAKYYTXXXXXXXXXXXXXXXXFFGGSWDTWVYQGLAVLVVGCPCAL
CADA_STAAR      SKIIHLVEEAQGERAPAQAFVDKFAKYYTXXXXXXXXXXXXXXXXFFGGSWDTWVYQGLAVLVVGCPCAL
CADA2_STAAU     SKIIHLVEEAQGERAPAQAFVDKFAKYYTXXXXXXXXXXXXXXXXFFGGSWDTWVYQGLAVLVVGCPCAL
CADA1_LISMO     SKIIHLVEEAQGERAPAQAFVDKFAKYYTPTIMLIAXXXXXXXXXFFGGDWDTWVYQGLSLLVVGCPCSL
CADA2_LISMO     SKIIHLVEEAQGERAPAQAFVDTFAKYYXXXXXXXXXXXXXXXXLLFGGNWETWVYQGLSVLVVGCPCAL
ZOSA_BACSU      RKIIKLVESAQNSVSPAQAFIERFENAYVKGVLIAVALLLFVPHFALGWSWSETFYRAMVFMVVASPCAL
AHM3_ARATH      AKMAKLVEEAQNSKTETQRFIDKCSKYYTPAIILISICFVAIPFALKVHNLKHWVHLALVVLVSACPCGL
AHM4_ARATH      AKMTKLVEEAQKSQTKTQRFIDKCSRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGL
COPA_ARCFU      AQIVKLVEDAMGSKPPIQRLADKVVAYFIPTVLLVAIS-AFIYWYFIAHAPLLFAFTTLIVLVVACPCAF
ATZN_ECOLI      DRILKLXXXXXXXXXXXXXFIDRFSRIYTPAIMXXXXXXXXXXXXXXXXSWQEWIYKGLTLLLIGCPCAL
COPA_BACSU      SHIIKIVEEAQGSKAPIQRLADQISGIFVPIVLGIAVLTFLIWYLWAAPDFAEAISKFIAVLVIACPCAL
COPA_STAES      SHIIKVVEDAQSSKAPIQRLADIISGYFVPIVVSXXXXXXXXXXXXXHPQFEPALVSAISVLVIACPCAL
COPA_STAEQ      SHIIKVVEDAQSSKAPIQRLADIISGYFVPIVVSXXXXXXXXXXXXXHPQFEPALVSAISVLVIACPCAL
COPB_ARCFU      NQVIELVRQAQESKSRTQDLANRXXXXXXXXXVTLAIWLAYI------ADFAFAIERAVTVMVITCPHAL
COPA_STAHJ      SNIIKVVEEAQSSKAPIQRLADIISGYFVPIVIAIALLLIWITLVHPGQ-FEDXXXXXXXXXXXXCPCAL
AHM5_ARATH      SQIISLVETAQMSKAPIQKFADYVASIFVPVVITLALFVGAYPDEWLGTHFVFSLMFSISVVVIACPCAL
SILP_SALTY      SRIVQMVADAQRSRAPIQRMADSVSGWFVPLVILIAVVAFMIWSVW-GPEPRMGLIAAVSVLIIACPCAL
AHM2_ARATH      AKMAKLVEEAQSSKTKSQRLIDKCSQYYTPAIILVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGL
ATCU2_RHIME     AQIIKLVETAQGSKLPIQALVDRVTGWFVPAVILAAVLFAAWYTFGPSPALSFXXXXXXXXXXXXCPCAM
AHM7_ARATH      AQIVRLVESAQLAKAPVQKLADRISKFFVPLVIFLSFSLHWYPESWIPSSFELALQFGISVMVIACPCAL
ATCS_SYNY3      XXXXXXXXXXXXSKAPIQHFVDRITHWFVPTVIVVAIAAFCIWWLTTG-NITLAVLTLVEVLIIACPCAL
COPA_SALTI      SRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAI-WYFFGPAPQITLVIATTVLIIACPCAL
COPA_SALTY      SRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAI-WYFFGPAPQITLVIATTVLIIACPCAL
ATCU_SINMW      AQIIRLVEAAQGSKLPIQALVDRVTAWFVPVVILAALLFAAWYVLGPSPALSFXXXXXXXXXXXXCPCAM
ATCU1_RHIME     AQIIKMVETAQGSKLPIQALVDKVTAWFVPAVILVAVLTFAAWYVFPSPALTFXXXXXXXXXXXXCPCAM
COPA_ENTHR      AQIIQMVEDAQGSKAPIQQIADKISGIFVPIXXXXXXXXXXXXG-WLTKDWQLALLHSVSVLVIACPCAL
COPA_STAAT      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAAE      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAAC      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAA8      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAA3      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
CTPV_MYCTU      AQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIAANPV-AGMTAAVAVLIIACPCAL
COPA_STAAN      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLIFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAAM      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLIFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAA9      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLIFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAA2      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLIFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAA1      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLIFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAAW      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAAS      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_STAS1      ASIIKVVEEAQGSKAPIQRLADVISGYFVPIVVGIAVLTFIIWIAFVQQQFEXXXXXXXXXXXXXXXXXL
COPA_STAAR      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
Y290_HAEIN      GDMMNALSDAQGSKAPIARFADKXXXXXXXXXXXXXXXXXALTYILTNDSVSS-LIHAVSVLVIACPCAL
COPA_STAAB      ANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIALLTFIVITLVTPGTFEPALVASISVLVIACPCAL
COPA_HELFE      AKILTLIAKAQGSKAPIARLADKVAGVFVP-IVIGIASIAFLVWLVLG-DFTRALEVFIAILVISCPCAL
COPA_ECO57      SRIIRMVRQAQSSKPEIGQLADKISXXXXXXXXXXXXXXXXI-WYFFGPAPQITLVIATTVLIIACPCAL
COPA_ECOLI      SRIIRMVRQAQSSKPEIGQLADKISXXXXXXXXXXXXXXXXI-WYFFGPAPQITLVIATTVLIIACPCAL
COPA_YERPE      ARIIKLVRQAQSSKPEIGKLADRXXXXXXXXXXXXXXXXGLIWYFFGPQQXXXXXXXXXXXXIIACPCAL
ATP7B_MOUSE     AQIVKLVEEAQMSKAPIQQLADRFSGYFVPIIIISTLTLVPSPSKHISQTIRFAFQTSITVLCIACPCSL
ATP7B_SHEEP     AQIVKLVEEAQMSKAPIQQLADRFSGYFVPIIIISTVTLVPAPSKGISQAEVVLRFTSITVLCIACPCSL
ATP7B_RAT       AQIVKLVEEAQMSKAPIQQLADRFSGYFVPIIIISTLTLVPSPSKHISQTIRFAFQTSITVLCIACPCSL
ATP7B_HUMAN     AQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVPNKHISQTIRFAFQTSITVLCIACPCSL
ATCU_RHILV      SRIVDMVAKAQRSRAPIQGAVDRXXXXXXXXXXXXXXXXXXXXXX-IGPEPRMGXXXXXXXXXXXCPCAL
COPA2_HELPY     SQIVEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILLIIAPKPDFWWNFGIALEVFVSVLVISCPCAL
ATP7A_CRIGR     SQIVKLVEEAQTSKAPIQQFADKLGGYFVPFIVLVSIATLLVWIIIGFQNFTIFAFQASIVLCIACPCSL
COPB_STAAU      SQVMGLVNQAQNDKSKAELLSDKVAG-YLFYFAVSIGLISFIVWMLIQNNVDFALERLVTVLVIACPHAL
COPB_STAAR      SQVMGLVNQAQNDKSKAELLSDKVAG-YLFYFAVSIGLISFIVWMLIQNNVDFALERLVTVLVIACPHAL
ATU2_YEAST      ANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLISANPPVAFADNFFICLQTATSVVIVACPCAL
COPA3_HELPY     SQIIEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILLIIAPKPDFWWNFGIALEVFVSVLVISCPCAL
COPA1_HELPY     SQIVEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAILLIIAPKPDFWWNFGIALEVFVSVLVISCPCAL
CTPA_MYCTU      AGMVRLVEQAQAQKADAQRLADRISSVFVPAVLVIAALTAA-GWLIAGGQPDRXXXXXXXXXXXXCPCAL
FIXI_RHILV      SEIIGLMXXXXXXXXXXXXXXXXXXTLYSPVVHLLALV-SFLAWGFLGGDWKQAMLVAVAVLIITCPCAL
CTPC_MYCLE      GRIVTRVEEAQHDRAPIQTVGENFSRCFVPTFVVSAITLAITKDV----------RRTMTVLLIACPCAV
ATU2_SCHPO      AVIVDLVQRAQISHAPIQQFADRVAGIFVPVIVALSISTSKYPSVFMG-KFAVCLKLTISVVVVACPCAL
COPB_ENTHR      AKVMEMVRKAQGEKSKLEFLSDKVAKWLFYVALVVGI-IAFIAWLFLANLPDA-LERMVTVFIIACPHAL
COPA_HELPJ      SQIIEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAVLAFVVWLIIAPKPDFWWNFRTALVLVISCPCAL
FIXI_BRAJA      AEIARLLDNALQARSRYMRLADRASRLYAPVVHATA-LITILGWVIAGASWHDAIVTGVAVLIITCPCAL
ATCS_SYNE7      XXXXXXXXXXXXSKAPIQRLADQVTGWFVPAVIAIAILTFVLWFNWIGN-VTLALITAVGVLIIACPCAL
COPA_HELPY      SQIIEMIYNAQSSKAEISRLADKVSSVFVPSVIAISILLIIAPKPDFWWNFGIALEVFVSVLVISCPCAL
COPA_VIBCH      ARIIQMVRQAQSSKPAMARLADQXXXXXXXXXXXXXXXXXXLWYLYPDPKASYMLVVATTVLIIACPCAL
CTPA_MYCLE      AGMVRLVEXXXXXXXXXXRLADRIASVFVPC-VFAVAALTAVGWLIAGSGPDRVFSAAIAVLVIACPCAL
AHM1_ARATH      NKIVQLTEEAHSNKPKLQRWLDEFGENYSKVVVVLSLAIAFLGPFLFKWPFRGSVYRALGLMVAASPCXX
COPB_STAAT      SQVMGLVNQAQNDKSSAELLSDKVAG-YLFYFAVSVGVISFIVWMLIQNDVDFALERLVTVLVIACPHAL
COPB_STAA3      SQVMGLVNQAQNDKSSAELLSDKVAG-YLFYFAVSVGVISFIVWMLIQNDVDFALERLVTVLVIACPHAL
CTPC_MYCTU      GRIISRVEEAQLDRAPIQTVGENFSRRFVPTFIVSAIAL-----LITGD-----VRRAMTMLLIACPCAV
CTPC_MYCBO      GRIISRVEEAQLDRAPIQTVGENFSRRFVPTFIVSAIAL-----LITGD-----VRRAMTMLLIACPCAV
COPB_STAES      SQVMGLVNQAQNDKSSAELLSDKVAGYLFYFAVIVGV-ISFIVWMLIQNDVDFALERLVTVLVIACPHAL
AHM6_ARATH      GDIIRLVEEAQSREAPVQQLVDKVAGRFTGVMALSALFGAHVLPLHNGSPMSLALQLSCSVLVVACPCAL
ATP7A_MOUSE     SQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIFAFQASIVLCIACPCSL
ATP7A_RAT       SQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIFAFQASIVLCIACPCSL
COPB_STAEQ      SQVMGLVNQAQNDKSSAELLSDKVAG-YLFYFAVSVGVISFIVWMLIQNDVDFALERLVTVLVIACPHAL
CTPB_MYCTU      AAMVRLVEQAQTQKARAQRLADHIAGVFVPVVFVIA-GLAGAAWLVSGAGADRAFSVTLGVLVIACPCAL
CTPB_MYCBO      AAMVRLVEQAQTQKARAQRLADHIAGVFVPVVFVIA-GLAGAAWLVSGAGADRAFSVTLGVLVIACPCAL
COPB_STAHJ      SQVMGLVNQAQNDKSSAELLSDKVAGYLFYFAVIVGV-ISFIVWMLIQNDVDFALERLVTVLVIACPHAL
CTPB_MYCLE      AAMVRLVEDAQVQKARVQHLADRIAAVFVPMVFVIXXXXXXXXXXXXXXPDRAFSV-VLGVLVIACPCTL
CTPD_MYCTU      ARIVELVADASATKAKTQLFIEKIEQRYSLGMVAATLALIVIPLMF-GADLRPVLLRAMTFMIVASPCAV
CTPD_MYCBO      ARIVELVADASATKAKTQLFIEKIEQRYSLGMVAATLALIVIPLMF-GADLRPVLLRAMTFMIVASPCAV
FIXI_RHIME      AEIIGLMXXXXXXXXXXXXXXXXXXXXXSPAVHLLAL-LTFVGWMLVEGDVRHAMLVAVAVLIITCPCAL
ATP7A_HUMAN     SQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSILLVWIVIGFLNFEIVETYFASITVLCIACPCSL
ATKB_BACC7      DKMISLVEGAARQKTPNE---IALNTVLTSLTFIFLIVVVTLPIFTNYLGFQIDTAVLVALLVCLIPTTX
ATKB2_LISIN     DKMIQLVEGASRKKTPNE---IALSTLLVSLTIIFLIVIVSLYPMAIYTGIKLPVSTLVALTVCLIPTTX
ATU1_YEAST      STIATMVDEAKLTKPKIQNIADKIASYFVPTIIITVVTFCVWIAVGIRVEIQAIIY-AITVLIVSCPCVI
ATKB_THETN      DRMIKLVEGAKRQKSPNEIALTT---VLVSLTIIFIVVVMTLYPMAKFVHVRISAATMIALLVCLIPTTX
CTPG_MYCTU      ARIVHIVEAEQVRKGASQRLADCIARPLVPSIMIAAALIAGTGSV-LGNPL-VWIERXXXXXXXXXXXXX
CTPG_MYCBO      ARIVHIVEAEQVRKGASQRLADCIARPLVPSIMIAAALIAGTGSV-LGNPL-VWIERXXXXXXXXXXXXX
ATKB_BACCN      DKMILLVEGATRQKTPNEIALNTVLISLTLIFLIAVVTL----PLFTNYGFQIDTSILVALLVCLIPTTX
ATKB_BACCR      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACWK      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACC4      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACC2      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_CLOAB      DKMINLVEGASRQKTPNE---IALNTILVSLTLIFLIVLVALYPMATYTGVKIPMSTLIALLVCLIPTTX
ATKB_BACCZ      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACC3      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_THEVO      DKMIELVEKSTREKTPNEISLTVFLSGLTLIFLVITASIFAISHYF-GRTANXXXXXXXXXXXX--PTTX
ATKB_LEPIC      DQMIALVEGAKRQKTPNEIALTMLLSGLSFIFLIAVMSL----PLFAGQSANLSIPILISLLVCLIPTTI
ATKB_BACHK      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACC0      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACAH      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_BACAC      DKMISLVEGAARQKTPNEIAL----NXXXXXXXXXXXXXXXXXPIFTNYGFQIDTAVLVALLVCLIPTTX
ATKB_LEPIN      DQMIALVEGAKRQKTPNEIALTMLLSGLSFIFLIAVMSL----PLFAGQSANLSIPILISLLVCLIPTTI
ATKB_THEAC      DKMIDLVNRATREKTPNEIALTVFLSGLTLIFLIITASIFSISHYY-GRTANXXXXXXXXXXXX--PTTX
ATSY_SYNE7      AAIVRCVAEAQQRKAPVQ----RFADAIAGRFVYGVCAIAALTFGFWATLGSRWXXXXXXXXXXXCPCAL
ATSY_SYNP6      AAIVRCVAEAQQRKAPVQ----RFADAIAGRFVYGVCAIAALTFGFWATLGSRWXXXXXXXXXXXCPCAL
ATKB_XANCP      DRMIALVEGANRQKTPNE---IXXXXXXXXXXXXXXIVVASLPAIFVGVTXXXXXXXXXXXXXI--PTTX
ATKB_STAHJ      DKMIGLVEGATRKKTPNE---IAXXXXXXXXXXXXXXXXXXXYPLAKFLNFNLSIAMLIALAVCLIPTTX
ATKB1_ANASP     DRMIALVEGAERSKTPNEXXXXXXXXXXXXXXXXX---IATLPAFAYYADTPVNVPTLIALLVALIPTTX
ATKB_XANAC      DRMIALVEGANRQKTPNE---IXXXXXXXXXXXXXXIVVASLPAIFVGVTXXXXXXXXXXXXXI--PTTX
ATKB_CAUCR      DRMIAMVEGADRRKTPNEIALAVLLAGLTLIFLIAVVTLLG-PGKFSGVALDPLVLGALFITLI--PTTI
ATKB_STAEQ      DKMIGLVEGATRKKTPNE---IAXXXXXXXXXXXXXXXXXXXYPLAKFLNFNLSIAMLIALAVCLIPTTX
ATKB1_STAAR     DKMIGLVEGATRKKTPNE---IAXXXXXXXXXXXXXXXXXXXYPLAKFLNFNLSIAMLIALAVCLIPTTX
ATKB1_STAAN     DKMIGLVEGATRKKTPNE---IAXXXXXXXXXXXXXXXXXXXYPLAKFLNFNLSIAMLIALAVCLIPTTX
ATKB1_STAAM     DKMIGLVEGATRKKTPNE---IAXXXXXXXXXXXXXXXXXXXYPLAKFLNFNLSIAMLIALAVCLIPTTX
ATKB_STAAB      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB2_STAAR     DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_STAAW      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_STAAS      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_STAAT      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_STAAE      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_STAAC      DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_DEIRA      DRMIALVEGASRQKTPNEIAXXXXXXXXXXXXXXAVVTLYPFTVYAGAPASAVTLIALLVCLI---PTTX
ATKB2_STAAN     DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB2_STAAM     DKMIALVEGA--ERNKTPNEIAXXXXXXXXXXXXXXXXXXXYP---IASYLHLILPIAMLIALTVCPTTX
ATKB_RHIME      DRMIALIEGAQRQKTPNEIALSILLSGLTLIFLIAVVTLWGLXXXXXXXXXXXXXXXXXXXXI---PTTX
ATKB2_ANASP     DRMISLVEGAERSKTPNEIXXXXXXXXXXQVFLI---VVATMPSFFISTAFGAXXXXXXXXXXXXXPTTX
ATKB_MYCTU      DRMIALVEGAARQQTPNEIALNILLAGLTIIFLLAVVTLQPFAIYSGGGQRXXXXXXXXXXXIPTTIGAL
ATKB_MYCBO      DRMIALVEGAARQQTPNEIALNILLAGLTIIFLLAVVTLQPFAIYSGGGQRXXXXXXXXXXXIPTTIGAL
ATKB_SYNY3      DRMIDLVEGA--ERSKTPNEIXXXXXXXXXXXXXXXXXXXXPPPANY-IDSPVSXXXXXXXXXXXXXXXX
ATKB_STRCO      DRMINLVEGAARQKTPNE---IALNILLASLTVVFLLACATLPPFYAGTHLDMIVLVALLVCLI--PTTI
ATKB_MYXXA      DRMIGLVEGAARQKTPNEVAXXXXXXXXXXXXXXACVTLV---PLALYSGVPLSGTAVVALLVCLIPTTX
ATKB_AGRT5      DRMISLVEGAERQKTPNEIALNILLAGMTLIFVLATATIPSFAAYAGGSIPIIVLVALFVTLIPTTIGAL
ATKB1_LISIN     DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLAVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_HALSA      DQMIGLVEDAQRQKTPNEIAMTXXXXXXXXXXXXXGEYLASFVGGFAGXXXXXXXXXXXXXMPTTIG-AL
ATKB_CLOBA      DKMISMVEGAARKKTPNEXXXXXXXXXXXXXXXXVTVSLYSYSIFSANQAGVVISVTSLVALLV-CLAPT
ATKB_RHILO      DRMISLVEGAERQKTPNEIALNILLVGMTLIFVLATATIPSFASYSGGYISVTVLVALFVTLIPTTIGAL
ATKB_PSEAE      DRMIALVEGA--KRQKTPNEVAXXXXXXXXXXXXXXXXXXXKPALFAGGNLPLVFLVALLVTLI--PTTX
ATKB_CLOBB      DKMISMVEGAARKKTPNEXXXXXXXXXXXXXXXXVTVSLYSYSIFSANQAGVVISVTSLVALLV-CLAPT
ATKB_LISMO      DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLAVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_LISMF      DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLAVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_LISMC      DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLAVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_ENTFA      DKMIAMVEGTQRKKTPNEQXXXXXXXXXXXXXXXXXXPFTDFSSQLSGKGEXXXXXXXXXXXXXXXPTTX
ATKB_YERPY      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPS      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERP3      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_POLSQ      DRMISMVENAKRQKTPNEXXXXXXXXXXXXXXXXXXFSMFSVAASGSGSPIQITVLIALLVCLIPTTIAG
ATKB_LISMH      DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLTVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_YERPP      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPN      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPG      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPE      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPB      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_YERPA      -RMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEASQAGSPVTITVLVAL
ATKB_LISW6      DKMIAMVEGASRKKTPNEIAL----QIL--LVTLSIIFLAVSATLLPFTEFAISITNVIALLVCLAPTTI
ATKB_PHOLL      DRMISMVEGAKRRKTPNEXXXXXXXXXXXXXXXXVCVTLLSIFSVEINHSGQPITVTVLIALLV-CLIPT
ATKB_CLOP1      DKMIAMVEGASRKKTPNEIAL----QIL--LVSLTIIFLVVTASLYAYSEFSXXXXXXXXXXXXXXPTTI
ATKB_SHIBS      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ANASL      DRMIALVEGAERTKTPNE----------------------------------------------------
ATKB_YERE8      DRMIAMVEGAKRRKTPNEVALTIL------LVALTIVFLLATATLYPFSVFSVEANQAGSPVTITVLVAL
ATKB_RALSO      DRMISMVEGAKRQKTPNEXXXXXXXXXXXPYSIFSVEVMKAA-----GVTSSPITITVLVALLV-CLIPT
ATKB_DECAR      DRMIAMVENAKRQKTPNEXXXXXXXXXXXXIVTLLPFSMFSVEVAGAGTPISITVLIALLVCLI--PTTI
ATKB_ECOLU      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_HYDS0      DKMISLVEGAKRRKTPNEEILIISLTIVFLVVVINFRALSYYSVYSTNKGXXXXXXXXXXXXXXXXXXXX
Y1226_METJA     GKTVKLVEKA-EKVSSYQKMIIKIGD-YXXXXXXXXXXXXXXXXXFRGKSLIETAQFALVLAVSAIPAAM
ATKB_SERP5      DRMIAMVEGAKRRKTPNEXXXXXXXXXXXXXXXXXPFSQYSVDAANGGSVVSITVLVALLV----CLIPT
ATC1_SCHPO      GRVFLTMQQTEKPKTPLQNSMDDLGKQLSLISLIGIAVIVLV-GFFQGKNWLEMLTIGVSLAVAAIPEGL
ATKB_KLEP3      DRMIAMVEGAQRRKTPNE---------XXXXXXXXXXXXXXXXXXXXXWPFSAWSGNAXXXXXXXXXXXX
ATKB_KLEP7      DRMIAMVEGAQRRKTPNE---------XXXXXXXXXXXXXXXXXXXXXWPFSAWSGNAXXXXXXXXXXXX
ATKB_ERWT9      DRMIAMVEGATRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWVSITVLVALLVCLIPT
ATKB_ECOSM      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO5E      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO57      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOL6      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOL5      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO81      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO27      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOSE      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO7I      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO24      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SHISS      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ESCF3      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOLI      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOHS      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECODH      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOBW      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO8A      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO55      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALCH      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOLC      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
PMA1_DICDI      GRAANLVQETEHLQVILRNFCISFIAIWVLVELLVDFLXXXXXXXXXXXXRCLPLNNALVLLVGGIPIAM
ATKB_SHIB3      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ACA1_ORYSJ      GKLMATLSEGGDDETPLQ---VKLNGVAT-IIGKIGLFFAVITFIVLSQGLISKKYHEGLLLSWSXPEGL
ATKB_ECOUT      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECOK1      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_ECO45      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_TOLAT      DRMISMVEGAKRRKTPNEIALSXXXXXXXXXXXXMPFSQYSVNSMGHGEPISVTVLVALLV----CLIPT
ATKB_ENT38      DRMIAMVEGAQRRKTPNE-----------XXXXXXXXXXXXXXXXXXXXXWPFSAYGGXXXXXXXXXXXX
PMA5_ARATH      GKAAHLVDNTNQ--------IGHFQKVLTSIFCICSIALGIIVELLVMYPIQRRRYRLLVLLIGGIPIAM
ATKB_SALSV      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALPB      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALTY      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALNS      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALHS      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALG2      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALEP      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALDC      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALA4      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALPK      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ATKB_SALPA      DRMIAMVEGAQRRKTPNEXXXXXXXXXXXXXXXXXXXXX---------WPFSAWGGNAXXXXXXXXXXXX
ACA2_ORYSJ      GKLMAVLTDGGDDETPLQTRLNGVANTIGKIGLFFAVLFIVLSQGIIGQKYXXXFXXXXXXXXXXXPEGL
ATCL_MYCGE      GKIAKTVDDSVTKLSPLQQKLEKIGKWFSGLGLFAVVFLVQTALLGFDNFTNNWXXXXXXXXXXXXPEGL
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     GKLMDTLSEGGEDETKLNGVATIIGKIGLGFAVLTFVVLCFVVEKATAGSITEWSSEDALTLLXXXPEGL
PMA7_ARATH      GKAAHLVDST----THVGHFQKVLTAIGNFCICSIAVGMAIEIVVIYGLQYRVGIDNLLVLLIGGIPIAM
ACA5_ORYSJ      GKLMSTLSEGGEDETPLQVKLNGVATVIGKIGLVFAILLVLLVRFLIDKGMTVGLYSTDALTIVNXPEGL
PMA1_AJECA      VGRGPALVNAASAGTGHFTEXXXXXXXXXXXXXXXXXXXXWVSSFYRSNSIVTILEFTLAITIIGVPVGL
ACA1_ARATH      GKLMATLSEGGDDETKLNGVATIIGKIFFAVITFAVLVQGLANQKRLDNSHWIWTADELMAMLXXXPEGL
PMA2_ARATH      GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAIGMVIEIIVMYPIQRRKYRLLVLLIGGIPIAM
ACA7_ARATH      GKLMATLSEGGDDETKLNGVATIIGKIGLSFAIVTFAVLVQMRKLSLGPELLEYFXXXXXXXXXXXPEGL
PMA1_NICPL      GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAVGMIIEIIVMYPIQHRAYRPLVLLIGGIPIAM
ACA2_ARATH      GKLMATLTEGGDDETPLQTIIGKIGXXXXXXXXXXXXQGMFMRKLSTGTHW-VWSGDEALELLXXXPEGL
ACA6_ORYSJ      ----------------------------------------------------------------------
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      GKLMSTLSEGGEDETPLQVKLNGVATIIGKIGLVFAILLVLLVRFLIDKGMTVGLYSTDALTIVNXPEGL
ACA4_ARATH      GKLMETLVDGGEDETKLNGVATIIGKIGLSFAVLTFVVLSSEDALTLLDYFAI----SVTIIVVAVPEGL
PMA1_SOLLC      GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAVGMIIEIIVMYPIQHRKYRPLVLLIGGIPIAM
PMA1_SCHPO      VGRAASLVNAAAGGTGHFTEVLNXXXXXXXXXXXXXXFCIYTAAFYRSVRLARLLEYTLAITIIGVPVGL
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       ----------------------------------------------------------------------
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      AKLMLEAKTVKPINSRIMKSLDKLAGFTGKIIIPFXXXXXXXXXXXXXXXXXSSVVNSSTALLGMLPKGX
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     --------------------------------------LPECTPIYI-QYFVKFFIIGITVLVVAVPEGL
AT2B1_PIG       --------------------------------------LAECTPIYI-QYFVKFFIIGVTVLVVAVPEGL
AT2B1_HUMAN     --------------------------------------LAECTPIYI-QYFVKFFIIGVTVLVVAVPEGL
PMA1_NEUCR      GRAAALV-NAASGGSGHFTEVLNXXXXXXXXXXXXXXXXXWVSSFYRSNPIVQILEFTLAITIIGVPVGL
ATKB_SALTI      ----------------------------------------------------------------------
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       -------------------------------VVDGRVWLAECTPVYV-QYFVKFFIIGVTVLVVAVPEGL
AT2B3_HUMAN     -------------------------------VVEGRTWLAECTPVYV-QYFVKFFIIGVTVLVVAVPEGL
AT2B1_RAT       --------------------------------------LAECTPIYI-QYFVKFFIIGVTVLVVAVPEGL
AT12A_HUMAN     IHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIA---VSLKYQV--LDSIIFLVANVPEGX
CTPE_MYCTU      XXXXXXXXXFTLVKSELRNGINRILQFITYLLVPAGLLTIYTQLFTTHVGWRESVLRMVGALVPMVPEGL
CTPE_MYCBO      XXXXXXXXXFTLVKSELRNGINRILQFITYLLVPAGLLTIYTQLFTTHVGWRESVLRMVGALVPMVPEGL
PMA4_NICPL      GKAAHLVDST--------NNVGHFQKVLTAIFCICSIAIGMLVEIIVMYPIQHRKYRLLVLLIGGIPIAM
AT12A_CAVPO     IRIASLASGVGNEKTPIATEIEHFVHIVAGVAVSIGILF-----FIIAVSLKYRVLDSIIFLVANVPEGX
PMA9_ARATH      GKAAHLVDSTNQEG--------HFQKVLTAIFCICSIAIGMLIEIVVMYPIQKRAYRLLVLLIGGIPIAM
ATMA_ECOLI      GQLAGRVSEQESEPNAFQQGISRVSMLLIRFMLVMAPVVLLINGYTKGDWWEAALF-ALSVAVGLTPEML
ATMA_ECO57      GQLAGRVSEQESEPNAFQQGISRVSMLLIRFMLVMAPVVLLINGYTKGDWWEAALF-ALSVAVGLTPEML
AT2B2_OREMO     -------------------------------------------PIYI-QYFVKFFIIGVTVLVVAVPEGL
ATC1_YARLI      VAVYDMVSEISTPKTPLQASMDNLGKDLS-LVSFGVIGVICLIGMFQGRDWLEMFTIGVSLAVAAIPEGL
ATCL_MYCPN      ----------------------------------------------------------------------
AT2C2_HUMAN     GEVFKMMQAEETPKTPLQKSMDRLGKQLTLFSIIGLIMLIGWSQ---GKQLLSMFTIGVSLAVAAIPEGL
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     GKAAHLVD--------TTNHVGHFQQVLTAIFCICSIAVGMIIEIVVMYPIQHRAYRPLVLLIGGIPIAM
AT2B1_RABIT     --------------------------------------LAECTPIYI-QYFVKFFIIGVTVLVVAVPEGL
AT12A_RAT       IRIASLASGVGSEKTPIAIEIEHFVHIVAGVAVSIDIIF-----FITAVCMKYYVLDAIIFLVANVPEGX
PMA1_ARATH      GKAAHLVDSTNQVG-HFQKVLTSIGNFXXXXXXXXXXXXXVVMYPIQHRKYRDGIDNLLVLLIGGIPIAM
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       GEVFKMMRAEETPKTPLQKSMDKLGKQLT-VFSFGIIGLLMLVGWVQGKPLLSMFTIGVSLAVAAIPEGL
ATMA_SALTY      GQLAGRVSEQDNEQNAFQKGISRVSMLLIRFMLVMAPVVLIINGYTKGDWWEAALF-ALSVAVGLTPEML
ATCL_SYNE7      GRIATLLQSVESEKTPLQQRLDKLGN----VLVSXXXXXXXXXXXXXXXXXQSWLSVGLSMAVAIVPEGL
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      VGRAAALVNKAAAGSGHFTEXXXXXXXXXXXXXXXXXXXXWVASFYRTNKIVRILRYTLAITIVGVPVGL
ATN5_YEAST      VKVIKTALNSEIGKTKKVTGAFLGTNVGTPLLSKLAVLLFWIAVLFASQKFDVDKRVAIYAICVAIPSSL
ATN2_YEAST      VKVIKTALNSEIGKTKKVTGAFLGTNVGTPLLSKLAVLLFWIAVLFASQKFDVDKRVAIYAICVAIPSSL
ATN1_YEAST      VKVIKTALNSEIGKTKKVTGAFLGTNVGTPLLSKLAVLLFWIAVLFASQKFDVDKRVAIYAICVAIPSSL
AT2C2_MOUSE     GEVFKMMRAEETPKTPLQKSMDKLGKQLT-IFSFGIIGLLMLVGWVQGKPFLSMFTVGVSLAVAAIPEGL
ECA4_ARATH      GRVHSQIQEAAEEDTPLKKKLNEFGEVLTMIILICALVWLINVKYFLSWEYVDGWPRNFKFSFEKCTYYF
AT1A_HYDAT      MRIANLASGLGSGKTPIALEIEHFIHIVTGVAVFLGVSFLIIS-LAMGYH---WL-EAIIFLVANVPEGX
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      GRAASLVNAAAGGQGH-----------FTEXXXXXXXXXXXXXXXXXXXXWTACFYRTVRIVIVGVPVGL
PMA1_CANAL      ----------------------------------------------------------------------
ECA1_ARATH      GRVHSQIQEAAEEDTPLKKKLNEFGEVLTMIILICALVWLINVKYFLSWEYVDGWPRNFKFSFEKCTYYF
ATP4A_XENLA     IRIATLASGVGNEKTPIAIEIEHFVDIIAGLAIFFGATFFVVA-MVIGYTFLRAMVFFMAIVVAYVPEGL
AT2C1_RAT       GEVFKMMQAEEAPKTKSMDLLGKQLSFYS-FGIIGIIMLVG---WLLGKDILEMFTISVSLAVAAIPEGL
AT1A_ARTSF      GRIACLASSLDSGKTPIAREIEHFIHIITAMAVSLAAVFAVISFLY----GYTWLEAAIFIIVAKVPEGX
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     GEVFKMMQAEEAPKTKSMDLLGKQLSFYS-FGIIGIIMLVG---WLLGKDILEMFTISVSLAVAAIPEGL
AT12A_RABIT     IRIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSVGILFFIIAVCMKYHVLDAIIFLIAI-IVANVPEGX
ACA8_ARATH      ----------------------------------------------------------------------
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     GEVFKMMQAEEAPKTKSMDLLGKQLSFYS-FGIIGIIMLVG---WLLGKDILEMFTISVSLAVAAIPEGL
AT2C1_HUMAN     GEVFKMMQAEEAPKTKSMDLLGKQLSFYS-FGIIGIIMLVG---WLLGKDILEMFTISVSLAVAAIPEGL
AT1A_TAESO      MRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIA-FILGY---YWL-DAVIFLVANVPEGX
ATP4A_RAT       IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVA-MCIGYTFLRAMVFFMAIVVAYVPEGL
ATP4A_RABIT     IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVA-MCIGYTFLRAMVFFMAIVVAYVPEGL
ATP4A_PIG       IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFF-IVAMCIGYTFLRAMVFFMAIVVAYVPEGL
ATP4A_MOUSE     IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVA-MCIGYTFLRAMVFFMAIVVAYVPEGL
ATP4A_HUMAN     IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFF-IVAMCIGYTFLRAMVFFMAIVVAYVPEGL
ATP4A_CANFA     IRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVA-MCIGYTFLRAMVFFMAIVVAYVPEGL
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       MRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_MOUSE     MRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      GKIQRQIHDASESDTPLKKKLDEFGNRLTFAIVVCLVVWAINYKYFLSWEFEKCAYYAVALAVAAIPEGL
AT1B_ARTSF      MRIAGLASGLDTGETPIAKEIAHFIHIITGVAVFLGVTFFII-AFVLGYH---WL-DAVVFLVANVPEGX
AT1A4_MOUSE     MRIASLTSGLQMGKTPIATEIEHFIHLITAVAVFLGVSFFWLS-IILGY---TWL-DAVIFLVANVPEGX
ECA2_ARATH      GKIQRQIHEASESETPLKKKLDEFGSRLTTAICIVCVLVWMIKPVNIKFSFEKCTYYAVALAVAAIPEGL
AT2C1_MOUSE     GEVFKMMQAEEAPKTKSMDLLGKQLSFYS-FGIIGIIMLVG---WLLGKDILEMFTISVSLAVAAIPEGL
AT1A_TORCA      MRIATLASGLEVGQTPXXXXXXXXXXXXTGVAVFLGVSFF-ILSLILGY---TWL-EAVIFLVANVPEGX
AT1A3_RAT       MRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFF-ILSLILGY---TWL-EAVIFLVANVPEGX
AT1A3_OREMO     MRIATLTSGLETGKTPIAVEIEHFIHIITGVAVFLGVTFF-ILAIILGY---TWL-KAVIFLVANVPEGX
AT1A3_MOUSE     MRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFF-ILSLILGY---TWL-EAVIFLVANVPEGX
AT1A3_HUMAN     MRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFF-ILSLILGY---TWL-EAVIFLVANVPEGX
AT1A2_PONAB     MRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFPGVSFFVLS-LILGYS---WL-EAVIFLVANVPEGX
AT1A1_SHEEP     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_RABIT     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_PONAB     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_OREMO     MRIATLASSLEGGKTPXXXXXXXXXXXXTGVAVFLGVSFF-ILSLILGYN---WL-EAVIFLVANVPEGX
AT1A1_HUMAN     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_HORSE     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGVTFFILSLIL---EY-TWL-EAVIFLVANVPEGX
AT1A1_CHICK     MRIASLASGLEGGKTPIAMEIEHFIHLITGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_BOVIN     MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
AT1A1_ANGAN     MRIATLASSLEVGRTPXXXXXXXXXXXXTGVAVFLGVSFF-ILSLILGY---AWL-EAVIFLVANVPEGX
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     MRIASLTSGLAVGQTPIAAEIEHFIHLITVVAVFLGVTFFALS-LLLGYG---WL-EAIIFLVANVPEGX
AT1A3_CHICK     MRIATLASGLEVGKTPIAVEIEHFIQLITGVAVFLGISFFVLS-LILGY---TWL-EAVIFLVANVPEGX
AT1A2_CHICK     MRIASLASGLEVGRTPIAMEIEHFIRLITGV----AVXXXXXXXXXXXXXXYTWL-EAVIFLVANVPEGX
AT1A2_BOVIN     MRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLS-LILGYS---WL-EAVIFLVANVPEGX
AT1A1_XENLA     MRIATLASGLDGGRTPXXXXXXXXXXXXTGVAVFLGVSF-----FILSLILQYTWLEAVIFLVANVPEGX
AT1A1_BUFMA     MRIATLASGLEGGQTPIAVEIGHFIHIITGVAVFLGVSFFILSLIL----HYTWL-EAVIFLVANVPEGX
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      XXXMGQISQSMEKQVSLMTPLTKFSHTLLYVIVTLAAFTFAVGWGRGGSPLE--MFEAAVALAVSAPEGL
AT1A2_RAT       MRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLS-LILGYS---WL-EAVIFLVANVPEGX
AT1A2_MOUSE     MRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLS-LILGYS---WL-EAVIFLVANVPEGX
AT1A2_HUMAN     MRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLS-LILGYS---WL-EAVIFLVANVPEGX
PMA2_SOLLC      ----------------------------------------------------------LVLLIGGIPIAM
AT1A1_CATCO     MRIATLASGLEVGRTPXXXXXXXXXXXXTGV----AVXXXXXXXXXXXXXXYSWL-EAVIFLVANVPEGX
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      GKAAHLVDSTNQ--------VGHFQQVLTAIFCIVSIAVGIVIEIIVMFPIQRRKYRALVLLIGGIPIAM
AT1A4_RAT       MRIASLTSGLTMGKTPIATEIEHFIHIITAVAVFLGVTFFFLS-LILGY---TWL-DAVIFLVANVPEGX
AT1A1_PIG       MRIATLASGLEGGQTPXXXXXXXXXXXXTGVAVFLGV---SFFILSLILEY-TWL-EAVIFLVANVPEGX
ATC_TRYBB       ----------------------------------------------------------------------
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      GKTAALLQSV---ESDLGNIHVILRRVMLALCAISFILCMCCFIYLLARFYETFLQFAVVVLVVSIPIAL
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAVGMIIEIIVMYPIQHRKYRPLVLLIGGIPIAM
ATXA_LEIDO      GKTAALLQSV---ESDLGNIHVILRRVMFSLCAISFMLCMCCFIYLLARFYETFLQFAVVVLVVSIPIAL
PMA1_DUNBI      GRAAALI-SGTNNVSNLQTVMNKMSAICIVTILLWVVVELAVQECVGGREGCPTLLNMLVVLVGGIPIAM
PMA1_ORYSJ      GKAAHLVDSTNQ--------VGHFQTVLTAIFCICSIAVGIVIEIIVMFPIQHRAYRSLVLLIGGIPIAM
ATC1_DUNBI      GKIRDAMGVEEDVVTPLKAKLDEFGALLSKVILVWVVNINRFNDPALGGWFQGAIHYAVALAVAAIPEGL
PMAX_ARATH      GTTAHLVDNRTNKVGHFRKVVTEIENLCXXXXXXXXXXXXXXMYWIQRRNFSDVINNLLVLVIGGIPLAM
PMA3_ARATH      GKAAHLVDSTNQ--------VGHFQKVLTAIFCICSIAVGIAIEIVVMYPIQRRHYRLLVLLIGGIPIAM
PMA4_ARATH      GKAAHLVD--------TTNQIGHFQQVLTAIFCICSIAVGMLIEIVVMYPIQHRAYRPLVLLIGGIPIAM
YD56_SCHPO      LKDTRQSMNSSKAKTKVEKEINFYSKILCTFVLVLSIGLTFSHGI--KTDWYISVFRYLILFSSIIPINL
ATMB_SALTY      VATGSRTWFGSLAKTRTQTAFDRGVNSVSWLLIRFMLIMVPVVLLINGFSKGDWVEASLFALAVAVPEML
AT2A1_MAKNI     GKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAIDPVHGGSWIRGAVYYAVALAVAAIPEGL
AT2A2_CHICK     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     GKIRNQMVETEPEKTPLQQKLDEFSQQLSKVIFLVCIAVWVIDPVHGGSWFRGAIYTSVALAVAAIPEGL
PMA1_DUNAC      GRAAALI-SGTHNVANIQRVMNRIGGLC--LITIGVWVVIEVPVQFAGKEGCPTLLNMLVILVGAIPIAM
ATC_ARTSF       GSIRTQMFETEEMKTPLQQKLDEFGEQLSKVISVICVAVWAIDPAHGGSWIKGAIYYAVALAVAAIPEGL
ATC1_DROME      GKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAIDPAHGGSWIKGAIYYAVALAVAAIPEGL
ATC1_ANOGA      GKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISLICVAVWAIDPAHGGSWIKGAVYYAVALAVAAIPEGL
AT2A3_RAT       GKIRSQMAAVEPERTPLQRKLDEFGRQLSHAIICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAV
AT2A3_MOUSE     GKIRSQMAAVEPERTPLQRKLDEFGRQLSHAIICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAV
PMA8_ARATH      GKAAHLVDST--------NNVGHFQKVLTSIFCICSXXXXXXXXXXXXYPIQHRTYRLLVLLIGGIPIAM
ATC1_DROPS      GKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAIDPAHGGSWIKGAIYYAVALAVAAIPEGL
AT2A2_HUMAN     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A1_RANES     GKIRDEMAATEQEKTPLQQKLDEFGEQLSKVIICVAVWLINIDPIHGGSWIKGAIYYAVALAVAAIPEGL
AT2A2_RAT       GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A2_RABIT     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A2_PIG       GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A2_MOUSE     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A2_FELCA     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A2_CANFA     GKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A1_HUMAN     GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWFRGAIYYAVALAVAAIPEGL
PMA10_ARATH     GKTARLV-DSTDVTGHFQQVLTSIGNFCICSIAVGMVLEIIIMFPVQHRSYRXXXXXXXXXXXXXXPIAM
AT2A3_HUMAN     GKIRSQMAAVEPERTPLQRKLDEFGRQLSHAIICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAV
AT2A1_RAT       GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWFRGAIYYAVALAVAAIPEGL
AT2A1_CHICK     GKIRDEMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWIRGAIYYAVALAVAAIPEGL
ATX9_TETTH      GQIIRALLYPKPFNKKFQQQAVKLTILMATLLLISRLLDIELPPLFIA-------FRFLDILIYSAPPGM
AT2A1_MOUSE     GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWFRGAIYYAVALAVAAIPEGL
PATS_METJA      ----------------------------------------------------------------------
AT2A1_RABIT     GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWIRGAIYYAVALAVAAIPEGL
AT2A1_BOVIN     GKIRDQMAATEQDKTPLQQKLDEFGEQLSKVIICVAVWLINIDPVHGGSWIRGAIYYAVALAVAAIPEGL
YH2M_CAEEL      KAIVQLVRSIMYPKPVDFRFTKDLFKFILFLACISGFIYTIIVMIMRGNTLRRIIVRSLDIITITVPPAL
CTPI_MYCTU      ------------------------------------------------------------------PEGL
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       ----------------------------------------------------------------------
AT133_HUMAN     ----------------------------------------------------------------------
AT8B5_MOUSE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VISIPLSYFGGIGASSRAGILVKGSNYLEALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLA
ATZN_SYNY3      VISIPLGYFGGIGGAAKHGILIKGSTFLDSLTAVKTVVFDKTGTLTKGTFKVTQVVTKNGFSESELLTLA
CADA_BACSU      VVSIPLGFFGGIGAASKAGVLVKGSNYLEALNQVKYAVFDKTGTLTKGSFEVTEIKPAEGFTKDRLLEAA
HMCT_HELPY      VISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKVTDIVPQNGHSKEEVLHYA
HMCT_HELPJ      VISVPLGYFGGVGAASRKGILMKGVHVLEVLTQTKSIAFDKTGTLTKGVFKVVDIVPQNGHSKEEVLHYA
HMCT_HELFE      VISVPLGYFGGVGAASRAGILIKSVQTLEALSQVKNIAFDKTGTLSKGEFNVIDVVPIAPFSKEDVLQHA
CADA_BACPF      VISTPISIVSAIGNAAKKGVLVKGGVYLEEMGALKAIAFDKTGTLTKGVPAVTDYNVLNQINEKELLSII
CADA1_STAAU     VISTPISIVSAIGNAAKKGVLVKGGVYLEKLGAIKTVAFDKTGTLTKGVPVVTDFEVLNDVEEKELFSII
CADA_STAAR      VISTPISIVSAIGNAAKKGVLIKGGVYLEELGAIKAIAFDKTGTLTKGVPVVTDFKVLNDVEEKELFSII
CADA2_STAAU     VITTPISIVSAIGNAAKKGVLIKGGVYLEELGAIKAIAFDKTGTLTKGVPVVTDFKVLNDVEEKELFSII
CADA1_LISMO     VISTPVSIVSAIGNSAKNGVLVKGGIYLEEIGGLQAIAFDKTGTLTKGKPVVTDFIPSEHMDEQNSLSII
CADA2_LISMO     VVSTPVAIVTAIGNAAKNGVLVKGGVYLEEIGGLKAIAFDKTGTLTKGVPVVTELTEATNIQHNKNYIIM
ZOSA_BACSU      VASIMPAALSLISNGARNGMLVKGSVFLEQLGSVQMIAFDKTGTVTKGQPAVETIRIAEGFSEAEVLEAV
AHM3_ARATH      ILSTPVATFCALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSSEDISLQSLLYWV
AHM4_ARATH      ILSTPVATFCALTKAATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSSINLHKLLYWV
COPA_ARCFU      GLATPTALTVGMGKGAELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDLVPLNG-DERELLRLA
ATZN_ECOLI      VISTPAAITSXXXXXXXXXXXXXXXXXXEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATGISESELLTLA
COPA_BACSU      GLATPTSIMAGSGRAAEFGILFKGGEHLEKTHRLDTIVLDKTGTVTNGKPRLTDAIPFGRFEEKDLLQFA
COPA_STAES      GLATPTSIMVGTGRAAENGILFKGGQFVERAHYVDTIVLDKTGTITNGQPVVTDYVGDN-----DTLQLL
COPA_STAEQ      GLATPTSIMVGTGRAAENGILFKGGQFVERAHYVDTIVLDKTGTITNGQPVVTDYVGDN-----DTLQLL
COPB_ARCFU      GLAIPLVVAVSTSLAAKSGLLIRDRQAFERAKDLQAVIFDKTGTLTEGRFGVTDIVGFNH-SEDELLQIA
COPA_STAHJ      GLATPTSIMVGTGRAAENGILFKGGEYVERTHQVDTVVFDKTGTLTHGKPEVTYF-----EGDKDTLTLV
AHM5_ARATH      GLATPTAVMVATGVGATNGVLIKGGDALEKAHKVKYVIFDKTGTLTQGKATVTTTKVFSEMDRGEFLTLV
SILP_SALTY      GLATPMSIMVGVGKGAQAGVLIKNAEALERLEKVDTLVVDKTGTLTEGSPTVTGIISLNPGGETSLLRVT
AHM2_ARATH      ILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKIVAFDKTGTITRGEFIVIDFKSSRDINLRSLLYWV
ATCU2_RHIME     GLATPTSIMVGTGRAAELGILFRKGEALQRLRDADVVALDKTGTLTKGRPELTDLVAAEGFEADEVLFLV
AHM7_ARATH      GLATPTAVMVGTGVGASQGVLIKGGQALERAHKVNCIVFDKTGTLTMGKPVVVKTKLLKNMVLREFYELV
ATCS_SYNY3      GLATPTSVMVGTGKGAEYGVLIKEASSLEMAEKLTAIVLDKTGTLTQGKPSVTNFFTLSPTSTEELIQWA
COPA_SALTI      GLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAVKTFNGVDXXXXXXXX
COPA_SALTY      GLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAIKTFNGVXXXXXXXXX
ATCU_SINMW      GLATPTSIMVGTGRAAELGILFRKGEALQSLRDADVVAVDKTGTLTKGRPELTDLVAAEGFEPDEVLCLV
ATCU1_RHIME     GLATPTSIMVGTGRAAELGILFRKGEALQSLREADVIALDKTGTLTKGRPELTDIVPADGFEADEVLSFV
COPA_ENTHR      GLATPTAIMVGTGVGAHNGILIKGGEALEGAAHLNSIILDKTGTITQGRPEVTDVI-----GPKEIISLF
COPA_STAAT      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAAE      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAAC      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAA8      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAA3      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
CTPV_MYCTU      GLATPTAIMVGTGRGAELGILVKGGEVLEASKKIDTVVFDKTGTLTRARMRVTDVIAGQRRQPDQVLRLA
COPA_STAAN      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAAM      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAA9      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAA2      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAA1      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAAW      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAAS      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDN-----QTLQLL
COPA_STAS1      GLATPTSIMVGTGKAAENGILFKGGEHIERTHQIDTVVLDKTGTITNGKPVVTDF-----DGDEEALQLL
COPA_STAAR      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGCPVVTDY-----HGDDQTLQLL
Y290_HAEIN      GLATPAAIMVGLGKAVNAGVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALQPQSAVSEDDLYRFA
COPA_STAAB      GLATPTSIMVGTGRAAENGILFKGGEFVERTHQIDTIVLDKTGTITNGRPVVTDY-----HGDDQTLQLL
COPA_HELFE      GLATPMALLVAQKEASLLGLFFKDAVSLEKAKNVNHVIFDKTGTLTLGTPLVQEVRVAEGVDRLELLTLC
COPA_ECO57      GLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAVKTFADFDXXXXXXXX
COPA_ECOLI      GLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAVKTFADVDXXXXXXXX
COPA_YERPE      GLATPMSIISGVGRAAEFGVLVRDADALQQASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWA
ATP7B_MOUSE     GLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFLLLADVATLPLRKVL
ATP7B_SHEEP     GLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPKVSRVXXXXXXXXRKVLAVV
ATP7B_RAT       GLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRLVDVATLSLRKVLAVV
ATP7B_HUMAN     GLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVL
ATCU_RHILV      GLATPMSIMIATGRGAGEGVLIKDAEALERFSKGDTLIVDKTGTLTEGKPKLTDIAAFGRVGEDRLLSLA
COPA2_HELPY     GLATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSV--HSNIELLELLSLA
ATP7A_CRIGR     GLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVVESNKIPRSKILAIV
COPB_STAAU      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYIMMDKTGTLTEGNFSVNHYESTDELNNEEILSLF
COPB_STAAR      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYIMMDKTGTLTEGNFSVNHYESTDELNNEEILSLF
ATU2_YEAST      GLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKVGNVDEDEVLACI
COPA3_HELPY     GLATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSV--HSKIELLELLSLA
COPA1_HELPY     GLATLMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSV--HSKIELLELLSLA
CTPA_MYCTU      GLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAVTAAPGWEADQVLALA
FIXI_RHILV      GLAVPVVQVVAAGELFRKGIMVKDGSALERLAETDTVAFDKTGTLTMGS---SRLVRVDAMDESAAAIAR
CTPC_MYCLE      GLATPTAISAAIGNGARRGILIKGGSHLEQAGRVDAILFDKTGTLTVGRPVVTNIVAMHDWSPEQVLAYA
ATU2_SCHPO      GLSTPTAVMVGTGVGALNGIIIKGGEILERLNQVDTVVFDKTGTLTVGKLSVTDISIVDNIPKNIFWAFV
COPB_ENTHR      GLAIPLVVARSTSIAAKNGLLLKNRNAMEQANDLDVIMLDKTGTLTQGKFTVTGIILDEAYQEEEILKYI
COPA_HELPJ      GLATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVK--XXXXXXXXXXXXXXX
FIXI_BRAJA      GLAIPTVQTVASGAMFKSGVLLNSGDAIERLAEADHVIFDKTGTLTLPDLEVMNAIPA------DIFELA
ATCS_SYNE7      GLATPTSIMVGTGKGAEYGILIKSAESLELAQTIQTVILDKTGTLTQGQPSVTDFLAIGDRDQQQLLGWA
COPA_HELPY      GLATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSV--HXXXXXXXXXXXX
COPA_VIBCH      GLATPLSITVGIGKAAEMGILIRDANVLQTASQVDTVVFDKTGTLTLGKPSIQSLHVLQG-DENXXXXXX
CTPA_MYCLE      GLATPTAMMVASGRGAQLGILLKGHESFEATRAVDTVVFDKTGTLTTGQLKVSAVTAAPGWQANEVLQMA
AHM1_ARATH      XXXXXXXXXX-ISSCARKGILLKGAQVLDALASCHTIAFDKXXXXXXXXXXCKAIEPIYGHQEKEALAVA
COPB_STAAT      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYVMMDKTGTLTEGNFSVNHYESKNDLSNDTILSLF
COPB_STAA3      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYVMMDKTGTLTEGNFSVNHYESKNDLSNDTILSLF
CTPC_MYCTU      GLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKTGTLTVGRPVVTNIVAMHDWEPEQVLAYA
CTPC_MYCBO      GLSTPTAISAAIGNGARRGILIKGGSHLEQAGRVDAIVFDKTGTLTVGRPVVTNIVAMHDWEPEQVLAYA
COPB_STAES      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYVMMDKTGTLTEGNFSVNHYESKNDLSNDTILSLF
AHM6_ARATH      GLATPTAMLVGTSXXXXXXXXXXXXDILEKFSLVDTVVFDKTGTLTKGHPVVTEIIPENTWSEVEVLMLA
ATP7A_MOUSE     GLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVVESNKISRNKILAIV
ATP7A_RAT       GLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVVESNKISRNKILAIV
COPB_STAEQ      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYVMMDKTGTLTEGNFSVNHYESKNDLSNDTILSLF
CTPB_MYCTU      GLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMASGTSREEVLGLA
CTPB_MYCBO      GLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMASGTSREEVLGLA
COPB_STAHJ      GLAIPLVTARSTSIGAHNGLIIKNRESVEIAQHIDYVMMDKTGTLTEGNFSVNHYESKNDLSNDTILSLF
CTPB_MYCLE      GLATPTAMMVASGRGAQLGIFIKGYRALETINAIDTVVFDKTGTLTLGQLSVSTVTSTGGWCSGXXXXXX
CTPD_MYCTU      VLATMPPLLSAIANAGRHGVLVKSAVVVERLADTSIVALDKTGTLTRGIPRLASVAPPNVVDXXXXXXXX
CTPD_MYCBO      VLATMPPLLSAIANAGRHGVLVKSAVVVERLADTSIVALDKTGTLTRGIPRLASVAPPNVVDXXXXXXXX
FIXI_RHIME      GLAVPVVQVVAAGRLFQGGVMVKDGSAMERLAEIDTVLLDKTGTLTIGK---PRLVNAHEISPGRLATAA
ATP7A_HUMAN     GLATPTAVMVGTGVGAKTGTITHGTNQVKVLTESNRISHHKIDTETLGTCIDFQVVPGCGISCKSLVQID
ATKB_BACC7      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB2_LISIN     XXXXXXXXXXXMDRVTRFNVIALSGKAVEACGDVDTMILDKTGTITYGNRMASEFIALDKGNKNYLIHYA
ATU1_YEAST      GLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVH-ETVRGDRHNSQSLLL
ATKB_THETN      XXXXXXXXXXXMDRVTRFNVIAMSGKAVEAAGDIDTILLDKTGTITFGNRLAADFIPVGGHSKEEVTYYA
CTPG_MYCTU      XXXXXXTVVASIGAASRLGVLIKGGAALETLGTIRAVALDKTGTLTANRPVVIDVATTNGATRXXXXXXX
CTPG_MYCBO      XXXXXXTVVASIGAASRLGVLIKGGAALETLGTIRAVALDKTGTLTANRPVVIDVATTNGATRXXXXXXX
ATKB_BACCN      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHALLPVGNETIEQLAKWA
ATKB_BACCR      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACWK      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACC4      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACC2      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_CLOAB      XXXXXXXXXXXMDRVTRFNVIAMSGKAVEACGDVDTMILDKTGTITYGNRLAADFITVGGADKQKLIDYS
ATKB_BACCZ      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACC3      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_THEVO      XXXXXXXXXXXXNKVSEYNIIAKSGRAIENAGDIDTIILDKTGTITIGERKAVKFYPNKGISDVEFAKLA
ATKB_LEPIC      AGLLSAIGISGMERLIRFNVISKSGRAIEAAGDIDILLLDKTGTITLGNREARDFYPAKGVDEKYLADVA
ATKB_BACHK      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACC0      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACAH      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_BACAC      XXXXXXXXXXXMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLPVGNETIEQVGKWA
ATKB_LEPIN      AGLLSAIGISGMERLIRFNVISKSGRAIEAAGDIDILLLDKTGTITLGNREARDFYPAKGVDEKYLADVA
ATKB_THEAC      XXXXXXXXXXXXNKVSEYNIIAKSGRAIENAGDIDTIILDKTGTITIGERQAVRMYPNKGVDDKEFYRMC
ATSY_SYNE7      GLATPTAILVATGLAAEQGILVRGGDVLEQLARIKHFVFDKTGTLTQGQFELIEIQPLADVDPDRLLQWA
ATSY_SYNP6      GLATPTAILVATGLAAEQGILVRGGDVLEQLARIKHFVFDKTGTLTQGQFELIEIQPLADVDPDRLLQWA
ATKB_XANCP      XXXXXXXXXXXMNRAMSANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQATVFHPLAGIDRAQLRDAA
ATKB_STAHJ      XXXXXXXXXXXMDRVTQFNILAKSGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLVKAA
ATKB1_ANASP     XXXXXXXXXXXMDRVAQFNVIATSGRAVEVCGDINTLVLDKTGTITLGNRLAEEFIPINGYSVEQLASVA
ATKB_XANAC      XXXXXXXXXXXMNRALSANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQATAFHPLAGVDRVQLRDAA
ATKB_CAUCR      GGLLSAVGIAGMDRLLKVNVLATSGRAVEAAGDVDTLLLDKTGTITFGNRMATEVIPAPGVRPDXXXXXX
ATKB_STAEQ      XXXXXXXXXXXMDRVTQFNILAKSGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLVKAA
ATKB1_STAAR     XXXXXXXXXXXMDRVTQFNILAKSGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLVKAA
ATKB1_STAAN     XXXXXXXXXXXMDRVTQFNILAKSGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLVKAA
ATKB1_STAAM     XXXXXXXXXXXMDRVTQFNILAKSGRSVETCGDVNVLILDKTGTITYGNRMADAFIPVKSSSFERLVKAA
ATKB_STAAB      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMWEKLIVAA
ATKB2_STAAR     XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMMEKLIVAA
ATKB_STAAW      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_STAAS      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_STAAT      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_STAAE      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_STAAC      XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_DEIRA      XXXXXXXXXXXMDRALQANVIAKSGKAVEVAGDVDVLLLDKTGTITIGNRMATKFHPLPGVTXKSIVALA
ATKB2_STAAN     XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB2_STAAM     XXXXXXXXXXXMDRVTQFNVLAKSGRAVEVCGDVDVMILDKTGTITYGNRIASEFLPVNQQMLEKLIVAA
ATKB_RHIME      XXXXXXXXXXXMDRLVRFNVIATSGRAVEAAGDVDTLLLDKTGTITFGNRMASDFLPVPGVTVXXXXXXX
ATKB2_ANASP     XXXXXXXXXXXMDRVAQFNVIATSGRAVEACGDINSLVLDKTGTITFGNRMADEFIPVNSYTVEDVARIA
ATKB_MYCTU      LSAIGIA---GMDRLVQHNVLATSGRAVEAAGDVNTLLLDKTGTITLGNRQATEFVPINGVSAEAVADAA
ATKB_MYCBO      LSAIGIA---GMDRLVQHNVLATSGRAVEAAGDVNTLLLDKTGTITLGNRQATEFVPINGVSAEAVADAA
ATKB_SYNY3      XXXXXXXXXXXMDRVAQFNVVATSGRAVEACGDINTLVLDKTGTITLGNRLAETFLPVNGHSLKEVAAIA
ATKB_STRCO      GALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVSTLLLDKTGTITLGNRQAAEFVPVRGVTXXXXXXXX
ATKB_MYXXA      XXXXXXXXXXXMDRLLRKNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRMATELLPMPGVRMXXXXXXX
ATKB_AGRT5      LSAIGIA---GMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQATDLRPIPGVXXXXXXXXX
ATKB1_LISIN     GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAA
ATKB_HALSA      LAAIRVA---GMTRVTRRNVIAKSGRAVEAAGDLDALILDKTGTITTGERVAQDFHPLGDADDADVVRAS
ATKB_CLOBA      TIGALLSSIGGMSRLNQANVLAMSGRAIEAAGDVDILMLDKTGTITLGNREACEFIPVNGVNENEXXXXX
ATKB_RHILO      LSAIGIA---GMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQATDFRPVKGVTXXXXXXXX
ATKB_PSEAE      XXXXXXXXXXXMDRLVRLNVIAKSGRAVEAAGDVHVLLLDKTGTITFGNRRCSALYAAPGVXXXXXXXXX
ATKB_CLOBB      TIGALLSSIGGMSRLNQANVLAMSGRAIEAAGDVDILMLDKTGTITLGNREACEFIPVNRVDENEXXXXX
ATKB_LISMO      GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAA
ATKB_LISMF      GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAA
ATKB_LISMC      GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAA
ATKB_ENTFA      XXXXXXXXXXXMSRLTKENVIAMSGRAIEAAGDVDVLLLDKTGTITLGNRRASDFLPVHGVSEXXXXXXX
ATKB_YERPY      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPS      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERP3      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_POLSQ      LLSAI-----GVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASNFVAASGVTEAELADIA
ATKB_LISMH      GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAA
ATKB_YERPP      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPN      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPG      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPE      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPB      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_YERPA      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_LISW6      GALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFIPVDGVTEQELADAA
ATKB_PHOLL      TIGGLLSAIGVAGMSRSANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASQFLPVPGITEQRXXXXX
ATKB_CLOP1      GALLSAIGIAGMSRLNQANVLAMSGRAIEAAGDVDILMLDKTGTITLGNRQASEFLPVDGANIXXXXXXX
ATKB_SHIBS      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ANASL      -------------------VIATSGRAVEACGDVNTLVLDKTGTITLGNRLAEEFIPINGHSIEQVASVA
ATKB_YERE8      LVCIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVTEXXXXXXX
ATKB_RALSO      TIGGLLSAIGVAGMSRQANVIATSGRAVEAAGDVDVLLLDKTGTITHGNRQASRFIPAPGVTVKXXXXXX
ATKB_DECAR      AGLLSAIGVAGMSRMMQANVIATSGRAVEAAGDVDVLLMDKTGTITLGNRQASVFLPADGVXXXXXXXXX
ATKB_ECOLU      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKTLANAA
ATKB_HYDS0      XXXXXXXXXXXMDRLFKKNIIALSGRAIEAAGDANVLFLDKTGTITYGDRQAYKLIPVEGVSEEELAMVA
Y1226_METJA     PAVLSITMAIGALNLAKKDAIVKKLVAIEELAGVDILCSDKTGTLTKNQLVCGEIIALNGFSKEDVVLFA
ATKB_SERP5      TIGGLLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVKEXXXXXXX
ATC1_SCHPO      PIIVTVTLALGVLRMSKKRAIIRRLPSVETLGSVNVICSDKTGTLTMNHMTVTKILAAFSLPESEHIELA
ATKB_KLEP3      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASAFLPARGVEERTXXXXX
ATKB_KLEP7      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASAFLPARGVEERTXXXXX
ATKB_ERWT9      TIGGLLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQATQFLPAAGVXXXXXXXXX
ATKB_ECOSM      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO5E      XIPTTLSAIGVAGMSRMLGVVATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO57      XIPTTLSAIGVAGMSRMLGVVATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECOL6      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECOL5      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECO81      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECO27      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECOSE      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO7I      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO24      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_SHISS      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ESCF3      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKTXXXXX
ATKB_ECOLI      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECOHS      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECODH      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECOBW      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO8A      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_ECO55      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ATKB_SALCH      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_ECOLC      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
PMA1_DICDI      PTVLSVTMAIGATQLSKKKAIVSRLASIEELAAMDILCSDKTGTLTLNILTVDEPLPVGDTPKEDIVFHA
ATKB_SHIB3      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTXXXXX
ACA1_ORYSJ      PLAVTLSLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVKACICGNIKEVNNPKNA
ATKB_ECOUT      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECOK1      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_ECO45      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVEEKXXXXXX
ATKB_TOLAT      TIGGLLSAIGVAGMSRAANVIATSGRAVEAAGDIDVLLLDKTGTITLGNRQAAAFLPAPGIXXXXXXXXX
ATKB_ENT38      XXXIPTTIGGGVAGMSRANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFLPAPGVDEKTXXXXX
PMA5_ARATH      PSVLSVTMATGSHRLFQQGAITKRMTAIEEMAGMDVLCCDKTGTLTLNKLTVDKNLVAKGVGKEHVFLLA
ATKB_SALSV      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALPB      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALTY      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALNS      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALHS      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALG2      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALEP      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALDC      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALA4      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATKB_SALPK      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERXXXXXX
ATKB_SALPA      XIPTTLSAIGVAGMSRMLGVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERXXXXXX
ACA2_ORYSJ      PLAVTLSLAFAMKKMMNDKALVRQLAACETMGSATVICSDKTGTLTTNRMTVVKACICGNVNNPQTPNMS
ATCL_MYCGE      VTFINVIFALSVQKLTKQKAIIKYLSVIETLGSVQIICTDKTGTLTQNQMKVVDHFCFNSTTQTDLARAL
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     PLAVTLSLAFAMKQLMSDRALVRHLAACETMGSSTCICTDKTGTLTTNHMVVNKVWICENIKERQ-----
PMA7_ARATH      PTVLSVTMAIGAHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLXXXXXENQDAIDTA
ACA5_ORYSJ      PLAVTLSLAFAMKKLMNDKALVRHLSACETMGSAGTICTDKTGTLTTNYMVVDKI---------------
PMA1_AJECA      PXXXXXXXXXXXXYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLAEPYCVSGVDPEDLMLTA
ACA1_ARATH      PLAVTLSLAFAMKKMMNDKALVRNLAACETMGSATTICSDKTGTLTTNHMTVVQAKEVNG--PDAAMKFA
PMA2_ARATH      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVCKGVEKDQVLLFA
ACA7_ARATH      PLAVTLSLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVK----------------
PMA1_NICPL      PTVLSVTMAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIAKGVDADMVVLMA
ACA2_ARATH      PLAVTLSLAFAMKKMMNDKALVRHLAACETMGSATTICSDKTGTLTTNHMTVVKSCICMNV--QDVANKG
ACA6_ORYSJ      -------------------------------------LYDDYNKLTR-----IKVDPFNSVKKKMSVTIQ
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      PLAVTLSLAFAMKKLMNDKALVRHLSACETMGSAGTICTDKTGTLTTNHMVVDKI---------------
ACA4_ARATH      PLAVTLSLAFAMKKLMSDRALVRHLAACETMGSSTCICTDKTGTLTTNHMVVNKVWICDKVQERQ-----
PMA1_SOLLC      PTVLSVTMAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIAKGIDADTVVLMA
PMA1_SCHPO      PXXXXXXXXXXXXYLAEKQAIVQKLSAIESLAGVEVLCSDKTGTLTKNKLSLGEPFTVSGVSGDDLVLTA
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       ----------------------------------------------------------------------
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      XXXXXXXXXXXVIKLGLKKVLVQEMYSVETLARVDMLCLDKTGTITQGKMQVEAVLPLTETYGEEAIATS
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAIPSPDVFLPKVLDLI
AT2B1_PIG       PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQ----------------
AT2B1_HUMAN     PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQ----------------
PMA1_NEUCR      PXXXXXXXXXXXXYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHDPYTVAGVDPEDLMLTA
ATKB_SALTI      ---------------------VTGGRAVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTXXXXX
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSIPAPSALTPKILDLL
AT2B3_HUMAN     PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSIPAPSALTPKILDLL
AT2B1_RAT       PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQ----------------
AT12A_HUMAN     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHL---------------
CTPE_MYCTU      VLMTSIAFAVGVVRLGQRQCLVQELPAIEGLARVDVVCADKTGTLTESGMRVCEVEELDGAGRQESASMQ
CTPE_MYCBO      VLMTSIAFAVGVVRLGQRQCLVQELPAIEGLARVDVVCADKTGTLTESGMRVCEVEELDGAGRQESASMQ
PMA4_NICPL      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNEYVLLLAARASRVENQDAIDAC
AT12A_CAVPO     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSVICSDKTGTLTQNRMTVAHL---------------
PMA9_ARATH      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNEVFVKDLARASRVENQDAIDAC
ATMA_ECOLI      PMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERVLHSA
ATMA_ECO57      PMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERVLHSA
AT2B2_OREMO     PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQLIPDPGVLPPKSLDLL
ATC1_YARLI      PIIVTVTLALGVLRMSRQKAIVRKLPSVETLGSVNVICSDKTGTLTRNHMSCTTC---------WTVDMG
ATCL_MYCPN      ----------------------------------------------------------------------
AT2C2_HUMAN     PIVVMVTLVLGVLRMAKKRVIVKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGL---------
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLQASRLENQDAIDAA
AT2B1_RABIT     PLPVTISLAYSVNEMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMAVVQ----------------
AT12A_RAT       XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHL---------------
PMA1_ARATH      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVASRVENQDAIDAA
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       PIVVMVTLVLGVLRMAKKRVIVKKLPIVETLGCCNVICSDKTGTLTANEMTATQLVTSDG----------
ATMA_SALTY      PMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKPSEHVLHCA
ATCL_SYNE7      PAVITVALAIGTQRMVQRESLIRRLPAVETLGSVTTICSDKTGTLTQNKMVVQQI---------------
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      PXXXXXXXXXXXXYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLLA
ATN5_YEAST      VVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIIPRFG----------
ATN2_YEAST      VVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIIPRFG----------
ATN1_YEAST      VVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIIPRFG----------
AT2C2_MOUSE     PIVVMVTLVLGVLRMAKKRVIVKKLPIVETLGCCNVICSDKTGTLTANEMTATQLVTSDG----------
ECA4_ARATH      EIAVALAVAAGTRKMAQKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMAVSKLV--------------
AT1A_HYDAT      XXXXXXXXXXXXKKMAKKNCLVKHLEAVETLGSTSVICSDKTGTLTQNRMTVAHM---------------
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      PXXXXXXXXXXXXYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSSDDLMLTA
PMA1_CANAL      ----------------------------------------------------------------------
ECA1_ARATH      EIAVALAVAAGTRKMAQKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMAVSKLV--------------
ATP4A_XENLA     LATVTVCLSLTAKRLARKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
AT2C1_RAT       PIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGL---------
AT1A_ARTSF      XXXXXXXXXXXXKRMAKKNCLVRNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     PIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGL---------
AT12A_RABIT     XXXXXXXXXXXXKRVAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHL---------------
ACA8_ARATH      ----------------------------------------------------------------------
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     PIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGL---------
AT2C1_HUMAN     PIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGL---------
AT1A_TAESO      XXXXXXXXXXXXKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
ATP4A_RAT       LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
ATP4A_RABIT     LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
ATP4A_PIG       LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
ATP4A_MOUSE     LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
ATP4A_HUMAN     LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL---------------
ATP4A_CANFA     LATVTVCLSLTAKRLASKNCVVKNLEAVETLGSKSVICSDKTGTLTQNSMTVSNL---------------
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_MOUSE     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      PSVITTCLALGTRKMAQKNAIVRKLQSVETLGCTTVICSDKTGTLTTNQMSVSE----------------
AT1B_ARTSF      XXXXXXXXXXXXKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A4_MOUSE     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHL---------------
ECA2_ARATH      PAVITTCLALGTRKMAQKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSATEFFTLGG----------
AT2C1_MOUSE     PIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGL---------
AT1A_TORCA      XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A3_RAT       XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A3_OREMO     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A3_MOUSE     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A3_HUMAN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A2_PONAB     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_SHEEP     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_RABIT     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_PONAB     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_OREMO     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE------A
AT1A1_HUMAN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_HORSE     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_CHICK     XXXXXXXXXXXXKRMARKNCLVKNLEAVGTLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_BOVIN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_ANGAN     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A3_CHICK     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A2_CHICK     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A2_BOVIN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A1_XENLA     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTQSG
AT1A1_BUFMA     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTQSG
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      PAVVTVTLAIGVNRMAKRNAIIRKLPAVEALGSATVVCSDKTGTLTENQMTV-QAVYAGG----------
AT1A2_RAT       XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A2_MOUSE     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
AT1A2_HUMAN     XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
PMA2_SOLLC      PTVLSVTMAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVAKGVDADTVVLMA
AT1A1_CATCO     XXXXXXXXXXXXKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHM---------------
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      PTVLSVTMAIGSHKLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVAKGVDKEHVLLLA
AT1A4_RAT       XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHL---------------
AT1A1_PIG       XXXXXXXXXXXXKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWSDNQIHEAD-----
ATC_TRYBB       ----------------------------------------------------------------------
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      EIVVTTTLAVGSKHLSKHKIIVTKLSAIEMMSGVNMLCSDKTGTLTLNKMEIQEFTFEEGNDLKSTLVLA
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      PTVLSVTMAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKYVFARGVDADTVVLMA
ATXA_LEIDO      EIVVTTTLAVGSKHLSKHKIIVTKLSAIEMMSGVNMLCSDKTGTLTLNKMEIQEFTFEEGNDLKSTLVLA
PMA1_DUNBI      PTVLSVTLALGAYKLAREGAIVTRMSAVEEMAGMDVLCSDKTGTLTLNKLSISMVVPVGNMGVDEIMRMG
PMA1_ORYSJ      PTVLSVTMAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVTKGVDKDHVLLLA
ATC1_DUNBI      PAVVTTCLALGTRKMARHNAIVRTLPSVETLGCTTVICSDKTGTLTTNQMSV------------------
PMAX_ARATH      PTVLYVIMVTGSLRLYRTGTITQRITAIEDMAAIDVLCSDKTGTLTLNKLSVDKKVYSKDVEKEQVLLLA
PMA3_ARATH      PTVLSVTMAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKEVYCKGVEKDEVLLFA
PMA4_ARATH      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKEVFMKGVDADTVVLMA
YD56_SCHPO      RVNLDLAKINTESDPNLPGVVVRSSNIPEELGRIEYVLTDKTGTLTQNEMEMKKLVGTMGFSAESMVVQA
ATMB_SALTY      PMIVSSNLAKGAIAMSRRKVIVKRLNAIQNFGAMDVLCTDKTGTLTQDNIFLEHHLDVSGVKSSRVLMLA
AT2A1_MAKNI     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIVKSV---------
AT2A2_CHICK     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
PMA1_DUNAC      PTVLSVTLALGAYKLAREGAIVTRMSAVEEMAGLDVLCSDKTGTLTLNKLSISNVFPVGTMDIPEVMKFG
ATC_ARTSF       PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVFKDIPDDAAPELY
ATC1_DROME      PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLE
ATC1_ANOGA      PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRM---------------
AT2A3_RAT       VITTCLAL--GTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A3_MOUSE     VITTCLAL--GTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
PMA8_ARATH      PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVIEVFPKNMDSDSVVLMAA
ATC1_DROPS      PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRML--------------
AT2A2_HUMAN     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A1_RANES     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVIDKV-EGDVTSLN
AT2A2_RAT       PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A2_RABIT     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A2_PIG       PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A2_MOUSE     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A2_FELCA     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A2_CANFA     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A1_HUMAN     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVD-GDICLLN
PMA10_ARATH     PTVLSVTLAIGSHRLSQQGAITKRMTAIEEMAGMDVLCCDKTGTLT------------------------
AT2A3_HUMAN     VITTCLAL--GTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRM---------------
AT2A1_RAT       PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVD-GDICSLN
AT2A1_CHICK     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIVDKV-EGDVCSLN
ATX9_TETTH      PMLIAITNFVGLKRLKNNQILGQDPNSASQAGRIQTLCFDKTGTLT------------------------
AT2A1_MOUSE     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVD-GDVCSLN
PATS_METJA      -----------------------------------AIVFDSAGTLVK----IMRVI-------KDLKKNK
AT2A1_RABIT     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKM---------------
AT2A1_BOVIN     PAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKM---------------
YH2M_CAEEL      PAAMSVGIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQEIQKV-
CTPI_MYCTU      PLVATLSQLAAAQRLTARGALVRSPRTIEALGRVDTICFDKTGTLTENRLRVVCALPSSTAAEREVLRAA
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       ----------------------------------------------------------------------
AT133_HUMAN     ----------------------------------------------------------------------
AT8B5_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIAESSSPHPIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTG
ATZN_SYNY3      AKAESHSTHPIALSIREAYAQSIAEVADYEEIAGHGIRAVVQNQVVIAGNDRLLHREKIDHDTC--DVAG
CADA_BACSU      AYAELHSQHPIAESVRKAYGKMLXXXXXXXXXXGHGIFAKVNGTEILAGNKKLMEREQIEDVP--DENAG
HMCT_HELPY      SCSQLLSTHPIALSIQKACEEMLKDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQFHIAHSPSKEN--G
HMCT_HELPJ      SCSQLLSTHPIALSIQKACEEMLKDIKNYEELSGMGVKAQCHTDLIIAGNEKMLDQFHIAHSPSPEN--G
HMCT_HELFE      TCAQILSTHPIAISIQKAYKRQCQEVKDYQEIGGLGVQASCHSHLIIAGNDKMLHKYNIPHDTC--SLEG
CADA_BACPF      TALEYRSQHPLASAIMKNITYSDVQVEDFSSITGKGIKGIVNGTTYYIGSPKLFKELLTNNVTTLQNQGK
CADA1_STAAU     TALEYRSQHPLASAIMKNIPYSNVQVEEFTSITGRGIKGIVNGTTYYIGSPKLFKELNVNNVKILQNQGK
CADA_STAAR      TALEYRSQHPLASAIMKNITYSDVRVEDFTSITGRGIQGNIDGTTYYIGSPRLFKELNVNKVKVLQNQGK
CADA2_STAAU     TALEYRSQHPLASAIMKNITYSDVRVKDFTSITGRGIQGNIDGTTYYIGSPRLFKELNVNKVKVLQNQGK
CADA1_LISMO     TALETMSQHPLASAIISNVDYKSIEIDNFSSITGKGVKGEVNGITYYIGXXXXXXXXXXQTYQSLQKQGK
CADA2_LISMO     AALEQLSQHPLASAIIKEMDLTSINVNDFTSITGKGIRGTVDGNTYYVGSPVLFKELLASQVSDLQLKGK
ZOSA_BACSU      YAIETQSSHPLAQAIAESRGVNQSGYISIEETSGFGVMAEVSGAKWKVGKAEMAAQFMKQTASDVIQSGH
AHM3_ARATH      SSTESKSSHPMAAAVV-DYARSVSAVEDYQNFPGEGIYGKIDGKEVYIGNKRIASRAGCLSVPDIDDTKG
AHM4_ARATH      SSIECKSSHPMAAALI-DYARSVSIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAGTDNVPDIEATMK
COPA_ARCFU      AIAERRSEHPIAEAIVKEHGIELGEPEKVEVIAGEGVVA----DGILVGNKRLMEDFGVXXXXXXXXXXX
ATZN_ECOLI      AAVEQGATHPLAQAIVREAQVAELAIPTAESLVGSGIEAQVNGERVLICAAGKHPADAFTGINELESAGQ
COPA_BACSU      AAAETGSEHPLGEAIVKDKGLEIPKLTRFEAKVGAGILAEAGGKSILVGTRKLMESEQVEXXXXXXXXGK
COPA_STAES      ASAENASEHPLADAIVKDKGLNLLDNDTFKSIPGHGIKATIHQQQILVGNRKLMNDYNIDQLNHYEHLGQ
COPA_STAEQ      ASAENASEHPLADAIVKDKGLNLLDNDTFKSIPGHGIKATIHQQQILVGNRKLMNDYNIDQLNHYEHLGQ
COPB_ARCFU      ASLEARSEHPIAAAIVEEAEKRGFGLTEVEEIPGKGVEGIVNGRRYMVVSPGYIRELGIESVEKLKQQGK
COPA_STAHJ      ASAENNSEHPLATAIVKQHKVNLVNVTNYQTLPGHGIQAIIDDSMLFVGNQKLMHQINIQSIKQMEAEGH
AHM5_ARATH      ASAEASSEHPLAKAIVAQNSGWLLDTSDFSALPGKGIQCLVNEKMILVGNRKLMNAINIPDVEDLEESGK
SILP_SALTY      AAVDKGSQHPLGMAVVKAAQEKIPAVTHFNAPSGKGVSGDVEGQRVVIGNELAMNSIVIDNQKAVADTLT
AHM2_ARATH      SSVESKSSHPMAATIVXXXXXXXXXXXDYQNFPGEGIYGKIDGNDIFIGNKKIASRAGCSTVPEIEXXXX
ATCU2_RHIME     ASLETLSEHPIAEAIVKSKGIATAAVNGFEATPGFGVSGSVSGRQVLVGADRALNGIDVSGFSTEAELLG
AHM7_ARATH      AATEVNSEHPLAKAIVRDDEENPAEACDFVSITGKGVKATVKGREIMVGNKNLMNDHKVXXXXXXXXMAQ
ATCS_SYNY3      ASVEQYSEHPLAEAVVQSQQVSLLEIDNFQAIAGCGVAGQWQGQWIRLGTSNWLTDLGVTGAQQWEKEQK
COPA_SALTI      XXXXXGSSHPLAHAILKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITS
COPA_SALTY      XXXXXGSSHPLAHAILKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITS
ATCU_SINMW      ASLETLSEHPIAEAIVKSRGIATVAVSAFEATPGFGVSGTVSGRRVLVGADRALNGIDITGFADEAERLG
ATCU1_RHIME     ASLEALSEHPIAEAIVKSRGIALVPATDFEATPGFGVRGAVSGLPVQVGADRAFSGVGIDEAERLGNSGK
COPA_ENTHR      YSLEHASEHPLGKAIVAYGAKVGAKTQPITDFVGAGISGTINGVHYFAGTRKRLAEMNLSXXXXXXXXGK
COPA_STAAT      ATAEKDSEHPLAEAIV-NYAKELTETTTFKAVPGHGIEATIDHHYILVGNRKLMADNDIDDLTHYERDGK
COPA_STAAE      ATAEKDSEHPLAEAIV-NYAKELTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAAC      ATAEKDSEHPLAEAIV-NYAKELTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAA8      ATAEKDSEHPLAEAIV-NYAKELTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAA3      ATAEKDSEHPLAEAIV-NYAKELTETTTFKAVPGHGIEATIDHHYILVGNRKLMADNDIDDLTHYERDGK
CTPV_MYCTU      AAVESGSEHPIGAAIVAAAHERIPAANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQHLAAAAVEQEERG
COPA_STAAN      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAAM      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAA9      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAA2      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAA1      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_STAAW      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTYYERDGK
COPA_STAAS      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTYYERDGK
COPA_STAS1      ASAEKGSEHPLADAIV-NYAQKLLDTTDFEAVPGRGIKANISGKNLIVGNRQFMNDENVDIMTQFEKSGK
COPA_STAAR      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
Y290_HAEIN      AAVERQANHPIAKAIVQAAEXKMLEIPTAKMEVGQGIQAELQVGTIKVGKCGLILPKNLEDIWQI----A
COPA_STAAB      ATAEKDSEHPLAEAIV-NYXXXXXXXXXFKAVPGHGIEATIDHHHILVGNRKLMADNDIDDLTHYERDGK
COPA_HELFE      ASLEAQSEHVIAKGIVKEQGIALQEVQEVQAKPGFGIKGVVGDQIIKAGNLEFFNLPNPFG--TLE---G
COPA_ECO57      XXXXXGSSHPLARAILKASDMQLPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDDISAQASQGA
COPA_ECOLI      XXXXXGSSHPLARAILKAGDMQLPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNEQQV-GTKAIESQGA
COPA_YERPE      AALETGSNHPLARAILQRAEGTLATASQFRTLRGLGVSGEVDGIPLLLGNNRLLEEQQIDTIQQQAESGA
ATP7B_MOUSE     AVAEASSEHPLGVAVTKYCKGISCKVSNVEGIVGVGNPPTGEGASVLIGNREWMRRNGLTISSDISDAMQ
ATP7B_SHEEP     GTAEASSEHPLGVAVTRYCKGISCKVSSVESILAQGERAATQTFSVLIGNREWMRRNGLTVTSDVRDTKG
ATP7B_RAT       GTAEASSEHPLGVAVTKYCKGISCKVSNVESILAIGEGTGPQTFSVLIGNREWMRRNGLTISSDISDAMQ
ATP7B_HUMAN     AVAEASSEHPLGVAVTKYCKEELCKVSNVEGILAHSERAVPQTFSVLIGNREWLRRNGLTISSDVSDAMQ
ATCU_RHILV      ASLERGSEHPLAEAIVSGAEERFVEVTGFEAKTGKGVQGIADGTMVALGNSAMLADLGIDPAALSEKTEA
COPA2_HELPY     GSIEKSSEHVIAKGIVKEHNAPLKEMSEVKVKTGFGISADYQGEVIKVGNSEFFNPINALEI----QENG
ATP7A_CRIGR     GTAESNSEHPLGAAVTKYCKGISCKVTNIEGLLPLSNAVDTQQYKVLIGNREWMIRNGLVISNDVDDSMR
COPB_STAAU      ASLESNSNHPLATGIVDFAKGSYATPQEVNNIPGVGLEGTVDNKKLKIVNVSYLDKSNFDQFTNLAQQGN
COPB_STAAR      ASLESNSNHPLATGIVDFAKGSYATPQEVNNIPGVGLEGTVDNKKLKIVNVSYLDKSNFDQFTNLAQQGN
ATU2_YEAST      KATESISDHPVSKAIIRYCDGNCNKALNAEYVLGKGIKCQVNGNTICIGNEALIDALKKSGINSNVDQGN
COPA3_HELPY     GSIEKSSEHVIAKGIVKERNAPLKEMSEVKVKTGFGISADYQGEIIKVGNSEFFNPIN-----TLEKENG
COPA1_HELPY     NSIEKSSEHVIAKGIVKEHNAPLKEMSEVKVKTGFGISADYQGEIIKVGNSEFFNPIN-----TLEQENG
CTPA_MYCTU      ATVEAASEHSV-XXXXXXXXXXXXXXXXXXXIPGRGVSGTVSGRAVRVGKPSWIGSSNMRAARRHAESLG
FIXI_RHILV      GLA-AHSRHPLSRALVRDTETAPISFDRVTEIPGGGLEARNGADIYRLGNAAF--ACGTSFVPRTADSPF
CTPC_MYCLE      ASSEIHSRHPLAEAVIRSTEERHISIPPHEELVGLGMRTWADGRTLLLGSPSLLSKTASEWVDKLRHQTE
ATU2_SCHPO      KASESSSEHPIGKAITE----KASEFTDVSEIEGVDVVLRWKERTFHLGNSLLLEHNNVDXXXXXXXXXG
COPB_ENTHR      GALEAHANHPLAIGILKEKKITPYQAQEQKNLAGVGLEATVEDKDVKIINEKEAKRLGLERLKNYEAQGN
COPA_HELPJ      XXXXXXXXHVIAKGIVEYAKERNAPLKDISEVFGISAKVDYQGEIIKVGNSEFFNPIN-----TLEKENG
FIXI_BRAJA      GRLALSSHHPXXXXXXXXXXXRSPIVGAVEE-AGQGVRADVDGAEIRLGRPSFCGAEALVGDGTRLDPEA
ATCS_SYNE7      ASLENYSEHPLAEAIVRYGEATLSTVTDFEAIPGSGVQGQVEGIWLQIGTQRWLGELGIETSADWEAAGK
COPA_HELPY      XXXXXXXXHVIAKGIVKEHNAPLKEMSGVKVKTGFGISADYQGEIIKVGNSEFFNPIN-----TLEKENG
COPA_VIBCH      XXXXXXSEHPLAKAIAKQRNISPVEISQFTNQRGRGLLADYQNQTVLVGSLAFMQEQGIDAESTLEKFAA
CTPA_MYCLE      ATVESASEHAVALAIAAS-TTHREPVANFRAVPGHGVSGTVAERAVRVGKPSIASRCNSTTLVTAELRGE
AHM1_ARATH      AAMEKGTTHPIGRAVVDHSVGKDLPVESFEYFPGRGLTATVNGRKASLGSIEFITSLSEDESKQIKDAVN
COPB_STAAT      ASLESQSNHPLAISIVKSKNVSFTNPQDVNNIPGVGLEGLIDNKTYKITNVSYLHKLNYDDFTKLAQQGN
COPB_STAA3      ASLESQSNHPLAISIVKSKNVSFTNPQDVNNIPGVGLEGLIDNKTYKITNVSYLHKLNYDDFTKLAQQGN
CTPC_MYCTU      ASSEIHSRHPLAEAVIRSTEERRISIPPHEELVGLGMRTWADGRTLLLGSPSLLSKKASEWVDKLRRQAE
CTPC_MYCBO      ASSEIHSRHPLAEAVIRSTEERRISIPPHEELVGLGMRTWADGRTLLLGSPSLLSKKASEWVDKLRRQAE
COPB_STAES      ASLESQSNHPLAISIVKSKNVSFTNPQDVNNIPGVGLEGLIDNKTYKITNVSYLHKLNYDDFTKLAQQGN
AHM6_ARATH      AAVESNTTHPVGKAIVKAARARNCQTMKAEEEPGSGAVAIVNNKRVTVGTLEWVKRHGATGNSLLEINNQ
ATP7A_MOUSE     GTAESNSEHPLGAAVTKYCKGISCKVTNIEGLL------HKSNLKIEENNIKNASLVQIDAINEQSSTSS
ATP7A_RAT       GTAESNSEHPLGAAVTKYCKGISCKVTNIEGLL------HKSNLKIEENNIKNASLVQIDAINELSNAVN
COPB_STAEQ      ASLESQSNHPLAISIVKSKNVSFTNPQDVNNIPGVGLEGLIHNKTYKITNVSYLDEYDNDLFIKLAQQGN
CTPB_MYCTU      AAVESASEHAMAAAIVAASPXXXXXXXXXXXXXXXXXKPSWITRTTPCHDAALVS-ARLDGESRGE----
CTPB_MYCBO      AAVESASEHAMAAAIVAASPXXXXXXXXXXXXXXXXXKPSWITRTTPCHDAALVS-ARLDGESRGE----
COPB_STAHJ      ASLESQSNHPLAISIVKSKNVSFTNPQDVNNIPGVGLEGLIDNKTYKITNVSYLDEYDNDLFIKLAQQGN
CTPB_MYCLE      XXXXXXXXXXXXXXIVAAY-ADPRPVADFVAFAGCGVSGVVAEHHVKIGKPSWVTRVLXXXXXXXXXXXX
CTPD_MYCTU      XXXXXXXXHPLGRAIVAEARRRIPPAKDFRAVPGCGVHALVGNDFVEIASPQSYRXXXXXXXXXXXXXXX
CTPD_MYCBO      XXXXXXXXHPLGRAIVAEARRRIPPAKDFRAVPGCGVHALVGNDFVEIASPQSYRXXXXXXXXXXXXXXX
FIXI_RHIME      AIAVHSR-HPIAVAIQNSAGAASPIAGDIREIPGAGIEVKTEDGVYRLGS----RDFAVGGSG--PDGRQ
ATP7A_HUMAN     ASNEQSSTS--SSMIIDAQISNALNAQQYKVLIG-------NREWMIRNGLVINNDVN-DFMTEHERKGR
ATKB_BACC7      AISSVLDETPEGRSVIESYNRELARMSGVDLQDGTKVRVQSQGGTIPKDVNQKADFISKEG--------G
ATKB2_LISIN     ILASIQDNTPEGKSIVKDLLKEDLDTNDIRENQFIEFTAQTRMSGVDLADGTRIRKKNIGGVNNISKLGG
ATU1_YEAST      GLTEGIK-HPVSMAILKEKGVSAQNVSNTKAVTGKRVETSYSGLKLQGGNCRWLGHNNDPDVRKALEQGY
ATKB_THETN      LISSLKDLTPEGRSIVAKAPDDILEGAEVVEMSGLNLK---DGTIVRKGSYKVKEYIGEKGGSIPDDLDG
CTPG_MYCTU      XXXXXRSEHPXXXXXXXXXXXXXXXXXXXXXPGAXXXXXXXXXXXXXXXPGWLDAAELADHVACMQQAGA
CTPG_MYCBO      XXXXXRSEHPXXXXXXXXXXXXXXXXXXXXXPGAXXXXXXXXXXXXXXXPGWLDAAELADHVACMQQAGA
ATKB_BACCN      ALSSVLDETPEGRSVMKGFSYNVSK-EEIGEFVPFKAETRMSGMDLKSGEKVRKGAVGIDWVQSIAKEGG
ATKB_BACCR      AISSVLDETPEGRSVIEYVQGK--SISYNRELAEQGEFVPFKAETRMSGDLQDGTKVRKGAVGSISKEGG
ATKB_BACWK      AISSVLDETPEGRSVIESYNREIARMSGVDLQDGTKVRKGAVGAVISQGGM-IPKDVN-QKADLISKEGG
ATKB_BACC4      AISSVLDETPEGRSVIEYVQGKSTRMSGVDLQDGTKVRVESQGGTIPKDVNQKADLISKEG--------G
ATKB_BACC2      AISSVLDETPEGRSVIEYVQGKSTRMSGVDLQDGTKVRVESQGGTIPKDVNQKADLISKEG--------G
ATKB_CLOAB      VMCSLKDDTPEGKSIVKKYESAQTRMSGIKLENGTAVKGAYDAIKKRVQELKGVIPKDLDAVNKVAKLGG
ATKB_BACCZ      AISSVLDETPEGRSVIEYVQAK--SISYNRELAEQGEFVPFKAETRMSGDLRDGTKVRKGAVSSISKEGG
ATKB_BACC3      AISSVLDETPEGRSVIESYNREIARMSGVDLQDGTKVRKGAVGSVIEWVRSQTIPKDVNQKADFISKEGG
ATKB_THEVO      AMSSYYDQTKEGLSIFELAKKQGAEISKDDEFIPFSSETKFSGDTVIKGSLKLKEKFQVADCKEISMRGG
ATKB_LEPIC      QLSSLADETPEGRSIVSEMEGEFIPFSASTKMSGVNLKKEGKGDSIRNYLHTLGQKISAETIQTISQRGS
ATKB_BACHK      AISSVLDETPEGRSVIESYNRELARMSGVDLQDGTKVRKGAVGSVIEWVRSQTIPKDVNQKADFISKEGG
ATKB_BACC0      AISSVLDETPEGRSVIESYNKELARMSGVDLQDGTKVRKGAVGSVIEWVKSQTIPKDVNQKADFISKEGG
ATKB_BACAH      AISSVLDETPEGRSVIESYNRELARMSGVDLQDGTKVRKGAVGSVIEWVRSQTIPKDVNQKADFISKEGG
ATKB_BACAC      AISSVLDETPEGRSVIESYNRELARMSGVDLQDGMKVRKGAVGSVIEWVRSQTIPKDVNQKADFISKEGG
ATKB_LEPIN      QLSSLADETPEGRSIVSEMEGEFIPFSASTKMSGVNLKKEGKGDSIRNYLHTLGQKISAETIQTISQRGS
ATKB_THEAC      ALASFYDQTKEGISILNLARSNGITVSEEDSFIPFSSETKYSGDYIIKGSLALKEKFHVADCKEISMRGG
ATSY_SYNE7      AALEADSRHXXXXXXXXXXXXXXXXXSDRQQVPGLGVSGTCDGRSLRLGNPTWVQ------VATAKLPTG
ATSY_SYNP6      AALEADSRHXXXXXXXXXXXXXXXXXSDRQQVPGLGVSGTCDGRSLRLGNPTWVQ------VATAKLPTG
ATKB_XANCP      MLASLADPTPEGKSIVKRQQGAVAVEPEDAHFIAFTAQTRMSGVDLAGRNIRIVAYVQAQGATVSPELNG
ATKB_STAHJ      YESSIADDTPEGRSIVKAYKQHIDLLQEVGEYIPFTAETRMSGVKFTTREVSMVKRVKEAGVKGVSKKGG
ATKB1_ANASP     WAASVFDDTPEGKSIVRLAEKLGIRYDNLAQAVEFSAKTRMSGTNLPGGRVRSRNGQTIPELDAVSQQGG
ATKB_XANAC      MLASLADPTPEGKSIVKRQQGAIAVEAEGGDFIAFTAQTRMSGVDIGGRSIRIVAYVQAQGATVSPELQG
ATKB_CAUCR      XXXXXXDETPEGRSIIE-----LARNAGLALEAPEGATADHQGRTLGLEPQSIPTELSV-AVDRIARSGG
ATKB_STAEQ      YESSIADDTPEGRSIVKAYKQHIDLPQEVGEYIPFTAETRMSGVKFTTREVSMVKRVKEAGVKGVSKKGG
ATKB1_STAAR     YESSIADDTPEGRSIVKAYKQHIDLPQEVGEYIPFTAETRMSGVKFTTREVSMVKRVKEAGVKGVSKKGG
ATKB1_STAAN     YESSIADDTPEGRSIVKAYKQHIDLPQEVGEYIPFTAETRMSGVKFTTREVSMVKRVKEAGVKGVSKKGG
ATKB1_STAAM     YESSIADDTPEGRSIVKAYKQHIDLPQEVGEYIPFTAETRMSGVKFTTREVSMVKRVKEAGVKGVSKKGG
ATKB_STAAB      YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESICMVSSKGG
ATKB2_STAAR     YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESIMDVSSKGG
ATKB_STAAW      YMSSIYDDTPEGKSIVKDIDGTYKTFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_STAAS      YMSSIYDDTPEGKSIVKDIDGTYKTFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_STAAT      YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_STAAE      YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_STAAC      YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_DEIRA      RQLGVDAPEPAGAEFIEDFPGTSIRKGAGSRISAL---AQERGGQLPPELAAITDEVSRQG--------A
ATKB2_STAAN     YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB2_STAAM     YMSSIYDDTPEGKSIVKDIDGTYKPFTAETRMSGIITNSVFKGAPNSMINLVKQQQLNIESLMDVSSKGG
ATKB_RHIME      XXXXXXXXTPEGRSIVALATGEFGRGASIDAVVPFTAETRLSGDSVGLSDSKIPQEFR-QAVDKVARTGG
ATKB2_ANASP     KLASLFDETPEGKSIVKAEKYKILADVNLNQAEGVEFSAKTRMSGTNLPNGKQVRKGAVDAIERVSLLGG
ATKB_MYCTU      QLSSLADETPEGRSIVKDEFGLRARMSGVDLAEVSGIRRIRKGXXXXVGHPTEEVGAIVDGISSGGGTPL
ATKB_MYCBO      QLSSLADETPEGRSIVKDEFGLRARMSGVDLAEVSGIRRIRKGXXXXVGHPTEEVGAIVDGISSGGGTPL
ATKB_SYNY3      LAASIFDTTPEGKSIVRLAEKMGATLDQQAEGVEFSARTRMSGTDLPDGSE--VRKGAVDAIGKVSHLGG
ATKB_STRCO      XXXXXXXXTPEGRSIVKEKYG--LRERHQGELVGIGFTAQTRMSGVDADGRKVRKGVRERGGSGTEDADG
ATKB_MYXXA      XXXXXXDETPEGRSIVKMRPRELQ--AHHATFVPFTAQTRMSGCDLVDPHPRSIRKGAVDAIVTIGDAGG
ATKB_AGRT5      XXXXXXXXTPEGRSIVKEKYGIRARMSGVD-FEGASIRAYVDGGALQHGNAALALKTETDATRAIEDIAG
ATKB1_LISIN     QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQGNTIRKGAADAVRAVSANGVSKVAGAGG
ATKB_HALSA      YQSSLYDETTEGRSIVKDEPGDSVDVSVTLDAEGLSFSAETRMSGIDLSDGTEIRKGAVDAVNAISESGG
ATKB_CLOBA      XXXXXXXETPEGRSIVVGIRGRNIRESNMEFIPFTAKTVNYNNSEIRKGAAETVKDYVIEVVARISNKGG
ATKB_RHILO      XXXXXXXXTPEGRSIVKEKYGIRARMSGV-DIDGSSVRKGAVDSVLAHVNQSTVNSDTIRDLQAIADSGG
ATKB_PSEAE      XXXXXXDDTPEGKSIVE-YLRILHPIEEPEELTPIAFSAETRLSGVD-WNGQVYRKGAVDAVDKIAQSGG
ATKB_CLOBB      XXXXXXXETPEGRSIVVGIRGRNIRESNMEFIPFTAKTVNYNNSEIRKGAAETVKDYVIEIVARISNKGG
ATKB_LISMO      QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQENTIRKGAADAVRAVTANGVSKVAGAGG
ATKB_LISMF      QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQENTIRKGAADAVRAVTANGVSKVAGAGG
ATKB_LISMC      QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQENTIRKGAADAVRAVTANGVSKVAGAGG
ATKB_ENTFA      XXXXXXXXTAEGRSIVKERFNLREREFQQSEVKFIDFSADYRGDVIRKGAADTMKKVQSKGVDKIARAGG
ATKB_YERPY      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPS      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERP3      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_POLSQ      QLASLADETPEGRSIVAKQKFNITRMSGVDEQIRKGAASAIQKHIESLGGHFPQEVLK--AVDDVSRRGS
ATKB_LISMH      QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQENTIRKGAADAVRAVTANGVSKVAGAGG
ATKB_YERPP      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPN      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPG      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPE      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPB      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_YERPA      XXXXXXXETPEGRSIVHSLNATFIPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATKB_LISW6      QLSSIADETAEGRSIVAEMHAEFVPFTATTRMSGI----DYQENTIRKGAADAVRTVTANGVSKVAGAGG
ATKB_PHOLL      XXXXXXXETPEGRSIVRSLNATFVPFSAMTRMSGVNVRMIRKGAVIEANHGKFPEAVEI-LVQTVARKGG
ATKB_CLOP1      XXXXXXXXTPEGRSIVKEQFGIRGRSSSNAKFIEFTAKVDFNGDEIRKGSAESIKKYITEKVEEIARKGG
ATKB_SHIBS      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ANASL      WVASVFDDTPEGKSIVRRYDLDPNQAQGVERMSGTNLPGGREARKGAVGNGRITPELDV-AYEQVSQQGG
ATKB_YERE8      XXXXXXXETPEGRSIVHSLNATFVPFSAQTRMSGVNVRMIRKGAVDAISNQGHFPRAVEDAVESVARTGG
ATKB_RALSO      XXXXXXDETPEGRSIVRSQPVFVTRMSGINVALGDAAHQIRKGDAIRTHVTVLAGRFPEAVLAAVEDVAG
ATKB_DECAR      XXXXXXXXTPEGRSIVVLAKQRFTRMSGV-DMAGRQVR-KGAADAIRKHVEALGGKFSVSGVDEVARRGS
ATKB_ECOLU      QLASLADETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_HYDS0      HMASIGDTTAEGKSILKDY--KVIEFDASTRISGVDTKNEHYRKGSSDAIEKYVSSFNLDKVEEVAKEGG
Y1226_METJA     ALASREEDADAIDMAILNEAKKLGLMEKIKDPVIKRTEAEVTNDKVSKGAPQILDLCNADKVEEIVDALG
ATKB_SERP5      XXXXXXXXTPEGRSIVQALNATFVPFSAQTRMSGVNVRMIRKGAVDAIRRHVESNQGHFDLVASVARTGG
ATC1_SCHPO      ALCNNSKVHNKADSILAGFPVDVARISEVSERKYMSVAVQYNSSKMNF--MKGATEQVLSSCAYFSDQDG
ATKB_KLEP3      XXXXXXXETPEGRSIVVLAKQRFLRERDLQSLHATFVTAQTRMSGINI-DQRMIRKGSVDAIRRHVEANG
ATKB_KLEP7      XXXXXXXETPEGRSIVVLAKQRFLRERDLQSLHATFVTAQTRMSGINI-DQRMIRKGSVDAIRRHVEANG
ATKB_ERWT9      XXXXXXXXTPEGRSIVNSMGATFIPFSAQTRMSGVNVRAIRKGAADAVRRYIDSNGGQFPGVDRVARAGG
ATKB_ECOSM      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO5E      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO57      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOL6      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOL5      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO81      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO27      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOSE      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO7I      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO24      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_SHISS      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHIEANG
ATKB_ESCF3      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHIEANG
ATKB_ECOLI      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOHS      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECODH      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOBW      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO8A      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHIEANG
ATKB_ECO55      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHIEANG
ATKB_SALCH      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_ECOLC      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
PMA1_DICDI      FLACSEGEDQDANEIVKHYPFNPEKAMGLVNANGKQFKTAKGAPQIEADNYKQVGEAVEKEIENLADRGY
ATKB_SHIB3      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ACA1_ORYSJ      SDLCSELPETVVKSIFNNTGGEVTETALLEFALSLGGNFKAKRDETKIVKMEPFNRAHCKGASEIMDETG
ATKB_ECOUT      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECOK1      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_ECO45      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVEANG
ATKB_TOLAT      XXXXXXDETPEGRSIVVLAKQRFLREHDIHALGATFVPFSAQTRMSGVNHDRMIRKGSVDAVEDVAKTGG
ATKB_ENT38      XXXXXXXETPEGRSIVILAKQRFLRQRDVQSLQATFVTAQTRMSGINIQD-RMIRKGSVDAIRRIEANNG
PMA5_ARATH      IVGMLADPNPVDKRTALTYDGNWHRASKPEQILNLDVRRKVHGDKFAERGLRSLAVARQEVLEKKKDAPG
ATKB_SALSV      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALPB      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALTY      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALNS      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALHS      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALG2      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALEP      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALDC      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALA4      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALPK      XXXXXXXETPEGRSIVILAKQRFLRERDMQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATKB_SALPA      XXXXXXXETPEGRSIVILAKQRFLRERDMQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ACA2_ORYSJ      SNFPEVAVETLLESIFNNTSGEVVRMSTILELPGGGYRAHCKGEIVLAACDKFIDELDDKTSSKLNDIIK
ATCL_MYCGE      CLCKTGDPTEIARSIVKGAPDVLLEVKNIENLLGQGLR------TLAVA-LKVLYKFDQNDQKQIDELEN
ATC1_DICDI      ----------------------------------------------------------------------
ACA13_ARATH     ----------------------------------------------------------------------
ACA11_ARATH     ----------------------------------------------------------------------
PMA7_ARATH      IVSMLSDPKPANRRTALTYEGKMHRVSKPEEILDMAHNKLEIKEKVHATIDKFAERLRSLGLAYQEVPDG
ACA5_ORYSJ      ----------------------------------------------------------------------
PMA1_AJECA      CLAASRKKYPRAKSVLTQYKVEFHPFDPVSKKVSAVVLSP-QGERITVKGAPLSVLKTVEEDHPIPDEVD
ACA1_ARATH      SGIPESAVKLLLQSIFTNTGGEI--------VVGKGNKTEILG---------------------------
PMA2_ARATH      AMASRADPNPVDKRTALTYSGNWHRVSKPEQILELAKAS----NDLSKKVLSIIDKYAERGLRSLAVARQ
ACA7_ARATH      ----------------------------------------------------------------------
PMA1_NICPL      ARASRTENNPTDKRTALTYEGKMHRVSKPEQILNLAHKSDIERRVHAVIDKFAERGLRSLGVAYQEVPEG
ACA2_ARATH      SSLQSEIPESAVKLLIQSIFNN------------------------------------------------
ACA6_ORYSJ      TFCKGASEIILEQNTIHNTDGNIVPLSEMQKHNVLNIINSFASEALRTLCIAFKDMDEFPNDQPISDDGY
ACA3_ORYSJ      ----------------------------------------------------------------------
ACA4_ORYSJ      ----------------------------------------------------------------------
ACA4_ARATH      ----------------------------------------------------------------------
PMA1_SOLLC      ARASRADPNPTDKRTALTYEGKMHRVSKPEQILNLAHKSDIERRVHTVIDKFAERGLRSLGVAYQEVPEG
PMA1_SCHPO      CLAASRKRKGLDAKALKNYPGPRSMLTKYKVIVSKKVTAYVQGTRITLKTVEEDHPIPEDVLSAYKDKVG
ACA12_ARATH     ----------------------------------------------------------------------
AT2B4_RAT       ----------------------------------------------------------------------
ATC3_SCHPO      ----------------------------------------------------------------------
EXP7_STRPN      YMAHSEDKNPTAQAIRQRFVGDVAMISNLPELEGLG--------TVFLGAPEMLLDSEVPEAREALERGS
ATC1_YEAST      ----------------------------------------------------------------------
AT2B4_HUMAN     VNGISINSAYTSKILPPEKEGGLPRVGNKTECALLGFVTDLKQDYQAVRNEVPEEKLKVYTFNSVRKSMS
AT2B1_PIG       ----------------------------------------------------------------------
AT2B1_HUMAN     ----------------------------------------------------------------------
PMA1_NEUCR      CLAKSLKYYPRAKSVLSKYKVLQFHPFDPVSKKVVAVVESPQGERITVKGAPLFVLKTVEEDHPIPEEVN
ATKB_SALTI      XXXXXXXETPEGRSIVILAKQRFLRERDVQSLHATFVTAQSRMSGINIDN-RMIRKGSVDAIRRHVESNG
ATC2_SCHPO      ----------------------------------------------------------------------
AT2B3_RAT       VHAISINSAYTTKILPPEKEGALPRVGNKTECALLGFILDLKRD--------------------------
AT2B3_HUMAN     VHAISINSAYTTKILPPEKEGALPRVGNKTECALLGFVLDLKRD--------------------------
AT2B1_RAT       ----------------------------------------------------------------------
AT12A_HUMAN     ----------------------------------------------------------------------
CTPE_MYCTU      AIAEAFHSPPIGAPDVLLDPASVA-ARQAERIGAQGLRAQAPGQVTPVALVVLEQKVRPDARETLD----
CTPE_MYCBO      AIAEAFHSPPIGAPDVLLDPASVA-ARQAERIGAQGLRAQAPGQVTPVALVVLEQKVRPDARETLD----
PMA4_NICPL      MVGMLADPNPVDKRTALTYPEQILDLCNAKEDVRRKVHS-------------MMDKYAERGLRSLAVARR
AT12A_CAVPO     ----------------------------------------------------------------------
PMA9_ARATH      IVGMLGDPNPVDKRTAITYNGNWHRVSQIIELCNLREDASKRAHDI-------IDKFADRGLRSLAVGRQ
ATMA_ECOLI      AVLEGTDEES-ARSLASRWQKSVVVAENTEEILNVCSQVRHNGEIVPLDDIMLRDTLNRQGLRVV--AVA
ATMA_ECO57      AVLEGTDEES-ARSLASRWQKSVVVAENTEEILNVCSQVRHNGEIVPLDDIMLRDTLNRQGLRVV--AVA
AT2B2_OREMO     VNAISINSAYTTKILPPDKEGGLPKVGNKTECGLLGLVLELKRDYQPIRNQIPEEKLKVYTFNSVRKSMS
ATC1_YARLI      DLANAVTLKP-GQSHTEADPKAVAALKNSVSLANM----------LKVGNLCNNSKFNREAGHLVGNATD
ATCL_MYCPN      ------------------------------------------------------------------ENTQ
AT2C2_HUMAN     ----------------------------------------------------------------------
AT12A_MOUSE     ----------------------------------------------------------------------
PMA11_ARATH     IVGMLADPNPTDKRTALTYDGKMHRVSKPEQILNLANRAEIERRVHAVIDKFAERGLRSLAVAYQEVPEG
AT2B1_RABIT     ----------------------------------------------------------------------
AT12A_RAT       ----------------------------------------------------------------------
PMA1_ARATH      MVGMLADPNPVDKRTALTYDGNWHRVSKPEQILDLAARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEK
ATC2_YEAST      ----------------------------------------------------------------------
AT2C2_RAT       ----------------------------------------------------------------------
ATMA_SALTY      NLLDTAVLEGVDETAARQLSGRVAEDSNVHQLVCKGALQEHNGDIVPLDDKRVTDTLNRQGLRVVAVATK
ATCL_SYNE7      ----------------------------------------------------------------------
AT2B2_RAT       ----------------------------------------------------------------------
AT2B2_MOUSE     ----------------------------------------------------------------------
AT2B2_HUMAN     ----------------------------------------------------------------------
PMA1_KLULA      ASRKKKGLDAIDKAFLKSYPRAKAALTKVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEEHPIENYEN
ATN5_YEAST      ----------------------------------------------------------------------
ATN2_YEAST      ----------------------------------------------------------------------
ATN1_YEAST      ----------------------------------------------------------------------
AT2C2_MOUSE     ----------------------------------------------------------------------
ECA4_ARATH      --------------------------------------ATYDGSEDHPAHQQLLNPSNYSSIES------
AT1A_HYDAT      ----------------------------------------------------------------------
AT12A_BUFMA     ----------------------------------------------------------------------
PMA1_ZYGRO      AFLKSLAQYPKAKGALTKYKVEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIENYEN
PMA1_CANAL      --------HPIPEDVHENYQNTVAEFAS-RGFRSLGVRKRGEGHWEILGIMPCMDPPRDDTAATVNEARR
ECA1_ARATH      --------------------------------------ATYDGSEDHPAHQQLLNPSNYSSIES------
ATP4A_XENLA     ----------------------------------------------------------------------
AT2C1_RAT       ----------------------------------------------------------------------
AT1A_ARTSF      ----------------------------------------------------------------------
AT1A1_CANFA     ----------------------------------------------------------------------
ACA10_ARATH     ----------------------------------------------------------------------
AT2C1_BOVIN     ----------------------------------------------------------------------
AT12A_RABIT     ----------------------------------------------------------------------
ACA8_ARATH      ----------------------------------------------------------------------
ATCL_BACSU      ----------------------------------------------------------------------
AT2C1_PONAB     ----------------------------------------------------------------------
AT2C1_HUMAN     ----------------------------------------------------------------------
AT1A_TAESO      ----------------------------------------------------------------------
ATP4A_RAT       ----------------------------------------------------------------------
ATP4A_RABIT     ----------------------------------------------------------------------
ATP4A_PIG       ----------------------------------------------------------------------
ATP4A_MOUSE     ----------------------------------------------------------------------
ATP4A_HUMAN     ----------------------------------------------------------------------
ATP4A_CANFA     ----------------------------------------------------------------------
PMA2_YEAST      ----------------------------------------------------------------------
ATC_PLAFK       ----------------------------------------------------------------------
AT1A1_RAT       ----------------------------------------------------------------------
AT1A1_MOUSE     ----------------------------------------------------------------------
ACA9_ARATH      ----------------------------------------------------------------------
ECAP_SOLLC      ----------------------------------------------------------------------
AT1B_ARTSF      ----------------------------------------------------------------------
AT1A4_MOUSE     ----------------------------------------------------------------------
ECA2_ARATH      ----------------------------------------------------------------------
AT2C1_MOUSE     ----------------------------------------------------------------------
AT1A_TORCA      ----------------------------------------------------------------------
AT1A3_RAT       ----------------------------------------------------------------------
AT1A3_OREMO     ----------------------------------------------------------------------
AT1A3_MOUSE     ----------------------------------------------------------------------
AT1A3_HUMAN     ----------------------------------------------------------------------
AT1A2_PONAB     ----------------------------------------------------------------------
AT1A1_SHEEP     ----------------------------------------------------------------------
AT1A1_RABIT     ----------------------------------------------------------------------
AT1A1_PONAB     ----------------------------------------------------------------------
AT1A1_OREMO     DTTENQSGTSFDRS--------SATWANLSRIAGLCNRAVFLADQSNIPILK------------------
AT1A1_HUMAN     ----------------------------------------------------------------------
AT1A1_HORSE     ----------------------------------------------------------------------
AT1A1_CHICK     ----------------------------------------------------------------------
AT1A1_BOVIN     ----------------------------------------------------------------------
AT1A1_ANGAN     ----------------------------------------------------------------------
PMA1_YEAST      ----------------------------------------------------------------------
AT1A4_HUMAN     ----------------------------------------------------------------------
AT1A3_CHICK     ----------------------------------------------------------------------
AT1A2_CHICK     ----------------------------------------------------------------------
AT1A2_BOVIN     ----------------------------------------------------------------------
AT1A1_XENLA     ASFDKSSP--------------------------------------------------------------
AT1A1_BUFMA     ASFDKSSP--------------------------------------------------------------
ATNA_DROME      ----------------------------------------------------------------------
ATA1_SYNY3      ----------------------------------------------------------------------
AT1A2_RAT       ----------------------------------------------------------------------
AT1A2_MOUSE     ----------------------------------------------------------------------
AT1A2_HUMAN     ----------------------------------------------------------------------
PMA2_SOLLC      ARASTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPTDKRTALTYGKMHRVSKLNLHNKSDIERRVH
AT1A1_CATCO     ----------------------------------------------------------------------
PMA6_ARATH      ----------------------------------------------------------------------
PMA1_WHEAT      ARA-------------------------------------------------------------------
AT1A4_RAT       ----------------------------------------------------------------------
AT1A1_PIG       ----------------------------------------------------------------------
ATC_TRYBB       ---------------------------------------------------KAVQHVRLNDPATFEDVES
CTPF_MYCTU      ----------------------------------------------------------------------
CTPF_MYCBO      ----------------------------------------------------------------------
ATXB_LEIDO      ALA-------------------------------------------------------------------
PMA2_SCHPO      ----------------------------------------------------------------------
PMA3_NICPL      ARA-------------------------------------------------------------------
ATXA_LEIDO      ALA-------------------------------------------------------------------
PMA1_DUNBI      ALANTVTEEPIDMVLWESYP--------------------------------------------------
PMA1_ORYSJ      ARA-------------------------------------------------------------------
ATC1_DUNBI      ----------------------------------------------------------------------
PMAX_ARATH      ARA-------------------------------------------------------------------
PMA3_ARATH      ARA-------------------------------------------------------------------
PMA4_ARATH      ARA-------------------------------------------------------------------
YD56_SCHPO      CIQNYSTPIPLSKTLVRNLVLALSLCHNVTPSKGHDGVVSYQ----------------------------
ATMB_SALTY      SSSQSGARNVMDRAILRFGEGRIA-------------------------------ELTIEGMLTFLDSAG
AT2A1_MAKNI     ----------------------------------------------------------------LEDSTK
AT2A2_CHICK     ----------------------------------------------------------------LEDSSN
ECA3_ARATH      ----------------------------------------------------------------------
AT2A3_CHICK     ----------------------------------------------------------------LHDST-
PMA1_DUNAC      ALANIITEEPIDMVLWESYPNDKITIATVLEIATGRVFRVLKGSP-QVVLAKAWNAQALDGPEKIKEYAG
ATC_ARTSF       QFELTGSTYPIGETFMQGQKINAADYDAVKEI--------------------------------------
ATC1_DROME      FEMTGSTYEPIGEVFLNGQRIKAADYDTLQEL--------------------------------------
ATC1_ANOGA      ----------------------------------------------------------------LNDSTK
AT2A3_RAT       ----------------------------------------------------------------------
AT2A3_MOUSE     ----------------------------------------------------------------------
PMA8_ARATH      RASRIENQDAIDASIV------------------------------------------------------
ATC1_DROPS      ----------------------------------------------------------------------
AT2A2_HUMAN     ----------------------------------------------------------------LEDSAN
AT2A1_RANES     EFTITGSTYAPEGDVQKN----------------------------------------------------
AT2A2_RAT       ----------------------------------------------------------------LEDSAN
AT2A2_RABIT     ----------------------------------------------------------------LKDSAN
AT2A2_PIG       ----------------------------------------------------------------LEDSAN
AT2A2_MOUSE     ----------------------------------------------------------------LEDSAN
AT2A2_FELCA     ----------------------------------------------------------------LEDSAN
AT2A2_CANFA     ----------------------------------------------------------------LEDSAN
AT2A1_HUMAN     EFSITGSTYAPEGEVLKN----------------------------------------------------
PMA10_ARATH     ----------------------------------------------------------------------
AT2A3_HUMAN     ----------------------------------------------------------------------
AT2A1_RAT       EFSITGSTYAPEGEVLKN----------------------------------------------------
AT2A1_CHICK     EFSITGSTYAPEGDVLKN----------------------------------------------------
ATX9_TETTH      ----------------------------------------------------------------------
AT2A1_MOUSE     EFSITGSTYAPEGEVLKN----------------------------------------------------
PATS_METJA      FICNSQTVDIVDKKIIKEDPLKVVDKENPEKLISVEIGISYCNPPINREGIELQEPLNILKRYEVETGYG
AT2A1_RABIT     ----------------------------------------------------------------------
AT2A1_BOVIN     ----------------------------------------------------------------LDDSTK
YH2M_CAEEL      ----------------------------------------------------------------------
CTPI_MYCTU      ARA-STQPH-------------------------------------------------------------
PGP2_SULSO      ----------------------------------------------------------------------
YPDA_BACST      ----------------------------------------------------------------------
PGP_METKA       ----------------------------------------------------------------------
SYH_BACFN       -------------------------------------REFYQCDADVVGSDSLLNEVELQIVDTVFTRFG
AT133_HUMAN     ---------------------------------------------IALAHRKLESKLTWHKVQNISRDA-
AT8B5_MOUSE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ
ATZN_SYNY3      TVVHLAVDGRYGGYILIADEIKEDAVQAIRDLKRMGVEKTVMLTGDSEIVAQSVAQQIGLDAFVAELLPE
CADA_BACSU      TIVHVAVDQRYXXXXXXXXXXXXXXXXXVADLKSLGIKQTAMLTGDSKQTGEAVGKQLGIGEVYAELLPQ
HMCT_HELPY      TIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKVQGIENFCILSGDRKSATESIAQTLGC-EYHASLLPE
HMCT_HELPJ      TIVHVAFNQTYIGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIARTLGC-EYHASLLPE
HMCT_HELFE      TIVHVAVDGKHIGYIVVADTLKDNAKECLDGLKHAGIEHMCILSGDHEYSTKRVAKELDCP-YYANLLPE
CADA_BACPF      TAMIIGTEKEILAVIAVADEVRESSKEILQKLHQLGIKKTIMLTGDNKGTANAIGGQVGVSDIEAELMPQ
CADA1_STAAU     TAMIIGTEKTILGVIAVADEVRETSKNVIQKLHQLGIKQTIMLTGDNQGTANAIGTHVGVSDIQSELMPQ
CADA_STAAR      TAMIIGTDQTILGVIAVADEVRETSKNVIQKLHQLGIKQTIMLTGDNQGTAEAIGAHVGVSDIQSELMPQ
CADA2_STAAU     TAMIIGTDQTILGVIAVADEVRETSKNVILKLHQLGIKQTIMLTGDNQGTAEAIGAHVGVSDIQSELLPQ
CADA1_LISMO     TAMLFGTESNILAIIAVADEVRESSKEVIAQLHKLGIAHTIMLTGDNNDTAQFIGKEIGVSDIKAELMPE
CADA2_LISMO     TAMLFGTNQKLISIVAVADEVRSSSQHVIKRLHELGIEKTIMLTGDNQATAQAIGQQVGVSEIEGELMPQ
ZOSA_BACSU      TIVFVKKDDQIAGCIALKDQIRPEAKEVMEELNRLGI-KTAMLTGDHEDTAQAIAKEAGMTTVVAECLPD
AHM3_ARATH      TIGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGI-KIAMLTGDNHAAAMHAQEQLGMDIVRAELLPE
AHM4_ARATH      TIGYIYMGAKLTGSFNLLDGCRYGVAQALKELKSLGI-QTAMLTGDNQDAAMSTQEQLELDIVHSELLPQ
COPA_ARCFU      XXVIVARNGRVEGIIAVSDTLKESAKPAVQELKRMGI-KVGMITGDNWRSAEAISRELNLDLVIAEVLPH
ATZN_ECOLI      TVVLVVRNDDVLGVIALQDTLRADAATAISELNALGVKGV-ILTGDNPRXXXXXXGELGL-EFKAGLLPE
COPA_BACSU      TVMLVSIDGEAAGLVAVADTIKDTSRKAVARLKELGLD-VIMMTGDNRRTAEAIAKEAGIANIIAEVLPE
COPA_STAES      TAMMIAVDNQINGIIAVADTVKNDAKQAIKELRNMNID-VVMLTGDNNRTAQTIAKQVGIEHVIAEVLPE
COPA_STAEQ      TAMMIAVDNQINGIIAVADTVKNDAKQAIKELRNMNID-VVMLTGDNNRTAQTIAKQVGIEHVIAEVLPE
COPB_ARCFU      TVVFILKNGEVSGVIALADRIRPESREAISKLKAIGI-KCMMLTGDNRFVAKWVAEELGLDDYFAEVLPH
COPA_STAHJ      TVMLIAYDGKLRGMIAVADTVKASAKEAIQQLSSMNIRTV-MLTGDNERTAKAIAKEVGIDQVIAGVLPE
AHM5_ARATH      TGVIVAYNGKLVGVMGIADPLKREAALVVEGLLRMGVRPI-MVTGDNWRTARAVAKEVGIEDVRAEVMPA
SILP_SALTY      TVIYVATDGHLAGLIAISDPVKATTPDALKALRQAGI-RIVMLTGDNQLTAEAVARKLGIDEVEAGILPD
AHM2_ARATH      XXXXXXXXERLAGFFNLSDACRSGVSQAMAELKSLGI-KTAMLTGDNQAAAMHAQEQLGLDVVHGDLLPE
ATCU2_RHIME     SPLYAAIEGRLAAIVAVSDPVKETTPQAIRSLHELGL-KVAMITGDNRRTAEAIARKLGIDEVVAEVLPE
AHM7_ARATH      TGILVSINSELIGVLSVSDPLKPSAREAISILKSMNIKSI-MVTGDNWGTANSIAREVGIDSVIAEAKPE
ATCS_SYNY3      TVIWLAVDTEVKALLAIADAIKPSSPQVVQALKKLGL-SVYMLTGDNQATAQAIADTVGIRHVLAQVRPG
COPA_SALTI      TPVLLAIDGKAAALLAVRDPLRSDSIAALERLHNAGY-RLVMLTGDNPTTANAIAKEAGIDEVIAGVLPD
COPA_SALTY      TPVLLAIDGKAAALLAVRDPLRSDSIAALERLHNAGY-RLVMLTGDNPTTANAIAKEAGIDEVIAGVLPD
ATCU_SINMW      SPLYAAIDGRLAAIVAVSDPVKESTPQAIKSLHALGL-KVAMVTGDNRRTAEAIAKKLGIDEVVAEVLPE
ATCU1_RHIME     SPLYAAIDGRLAAIIAVSDPIKDTTPQAIKALHDLGL-KVAMITGDNRRTADAIARQLGIDEVVAEVLPD
COPA_ENTHR      TVMFLANEEQVLGMIAVADQIKEDAKQAIEQLQQKGVD-VFMVTGDNQRAAQAIGKQVGIDHIFAEVLPE
COPA_STAAT      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAAE      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAAC      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAA8      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAA3      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
CTPV_MYCTU      RTXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLPQ
COPA_STAAN      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAAM      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAA9      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAA2      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAA1      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAAW      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAAS      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_STAS1      TAMLIAINQEYRGMVAVADTVKDSTATAIKQLHDLNI-KVVMLTGDNERTAQAIANEVGIDTIIAQVLPE
COPA_STAAR      TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
Y290_HAEIN      SIVAVSINDEPIGAFALTDTLKNDSLHAIQRLQQQNID-VVIMSGDQQSVVDYIAKQLGIKKAFGKLTPR
COPA_STAAB      TAMLIAVNYSLTGIIAVADTLKNHAKDAIKQLHDMGIE-VAMLTGDNKNTAQAIAKQVGIDTVIADILPE
COPA_HELFE      IQVFVGTETQILGVVVLADSLKEGSKEAISELKALGV-KTTLLSGDNLENVRALATQLGIQDYHAQAKPE
COPA_ECO57      TPVLLAVDGKAVALLAVRDPLRSDSVAALQRLHKAGY-RLVMLTGDNPTTANAIAKEAGIDEVIAGVLPD
COPA_ECOLI      TPVLLAVDGKAVALLAVRDPLRSDSVAALQRLHKAGY-RLVMLTGDNPTTANAIAKEAGIDEVIAGVLPD
COPA_YERPE      TPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGY-SLVMLTGDNPITANAIAKEAGIDRVIAGVLPD
ATP7B_MOUSE     TAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVD-VALITGDNRKTARAIATQVGINKVFAEVLPS
ATP7B_SHEEP     TAILVAIDGVLCGMIAVADSVKQEAALAVHTLKSMGVD-VVLITGDNRKTARAIATQVGINKVFAEVLPS
ATP7B_RAT       TAILVAIDGVLCGMIAIADAVKPEAALASITLKSMGVD-VALITGDNRKTARAIATQVGINKVFAEVLPS
ATP7B_HUMAN     TAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVD-VVLITGDNRKTARAIATQVGINKVFAEVLPS
ATCU_RHILV      TVMFVVFDGALAGLVAVADRIKPTTAAAIQALHDSGL-KIIMATGDNERTARAVAKSLGIDEVRADVLPE
COPA2_HELPY     ILVFVGKEDELLGAFVLEDLPKKGVKEHIAQIKKLGI-NTFLLSGDNRENVKKCALELGIDGYISNAKPQ
ATP7A_CRIGR     PAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLE-VVLMTGDNSKTARSIASQVGITKVFAEVLPS
COPB_STAAU      SISYLIHDRQVIGIIAQGDKIKESSKQMVSDLLSRNITPV-MLTGDNKEVAQTVAEELGISDVHAQLMPE
COPB_STAAR      SISYLIHDRQVIGIIAQGDKIKESSKQMVSDLLSRNITPV-MLTGDNKEVAQTVAEELGISDVHAQLMPE
ATU2_YEAST      TVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETY-MITGDNNSAAKRVAREVGIENVYSDVSPT
COPA3_HELPY     ILVFVGKEDELLGVFVLEDLPKKGVKEHIAQIKNLGI-NTFLLSGDNRENVKKCALELGIDGYISNAKPQ
COPA1_HELPY     ILVLVAINDELLGAFVLEDLPKKGVKEHVAQIKNLGI-NTFLLSGDNRENVKKCALELGIDGYISNAKPQ
CTPA_MYCTU      TAVFVEVDGEPCGVIAVADAVKDSARDAVAALADRGL-RTMLLTGDNPESAAAVATRVGIDEVIADILPE
FIXI_RHILV      SEVVLSKNGVDLARFFFDDTLRPGACEAIDRLDAAGLETL-IVSGDRQTVVDNTAHALGIDRALGSLTPK
CTPC_MYCLE      TPLLFAVDGTLVGLISLRDEVRPEAAEVLTKLRASGVRRIVMLTGDHPDIAKAVATELGIDEWRAEVMPE
ATU2_SCHPO      TCVRIAIDGQFVGFLGCMDQVRPDSYQTVSALKQLG-KKVCLLTGDQKATARRVAQGLEISDVYAEAVPS
COPB_ENTHR      TVSFLVVSDKLVAVIALGDVIKPEAKEFIQAIKEKNIIPV-ML