[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00459.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
  139::232     3e-05  27%  401 aa  HUTI_PSEF5 RecName: Full=Imidazolonepropionase;       
   96::180     4e-04  31%  353 aa  XYNA_PENCH RecName: Full=Endo-1,4-beta-xylanase;       
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLNLAKSNLIIVDID
HUTI_PSEF5      -------------------------------------------------------GLDLASERKILRVIR
XYNA_PENCH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFIDGVDLLSDFVVTSPSTNY
HUTI_PSEF5      RLGEELPVSVRSTCLAAHALPPEYAERSDA---YIEHICSDMLPALAAEGLVDAVDAFCEYLAFSPEQVE
XYNA_PENCH      ----------------------------------------------------------SDYFVEFAETNG


                         +         .         .         .         .         *         .:210
query           KILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYRRYYTGYLIDEIVNGVDAGNRNNWIASIFGK
HUTI_PSEF5      RVFIAAQQLGLP----------------------------------------------------------
XYNA_PENCH      KLIRGHTLVWHSQLPSWVSSITDKTTL-TDVMKNHITTVMKQYKGKLYADVVNEIDGTLRDSVFSRVLGE


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HUTI_PSEF5      ----------------------------------------------
XYNA_PENCH      ----------------------------------------------