[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00490.1

[Show Plain Result]


## Summary of Sequence Search
    1::197
  195::271     3e-10  39%  380 aa  YXBF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::69      1e-08  33%  210 aa  MTRR_NEIGO RecName: Full=HTH-type transcriptional regulator mtrR;
   11::60      8e-08  42%  194 aa  YVDT_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   11::166     7e-07  24%  195 aa  BETI_KLEP3 RecName: Full=HTH-type transcriptional regulator betI;
   10::81      9e-07  33%  210 aa  TTGR_PSEPU RecName: Full=HTH-type transcriptional regulator
   10::81      9e-07  33%  210 aa  TTGR_PSEPK RecName: Full=Probable HTH-type transcriptional
   10::81      9e-07  33%  210 aa  ARPR_PSEPU RecName: Full=Probable HTH-type transcriptional
    1::51      3e-06  33%  289 aa  YERO_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    3::86      3e-06  30%  218 aa  TETR8_PASPI RecName: Full=Tetracycline repressor protein class H;
    3::86      3e-06  30%  218 aa  TETR4_SALOR RecName: Full=Tetracycline repressor protein class D;
    3::86      3e-06  30%  218 aa  TETR4_ECOLX RecName: Full=Tetracycline repressor protein class D;
    4::139     3e-06  29%  186 aa  ICAR_STAAW RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAS RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAR RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAN RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAM RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAE RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAAC RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::139     3e-06  29%  186 aa  ICAR_STAA8 RecName: Full=Biofilm operon icaABCD HTH-type negative
   10::73      5e-06  30%  215 aa  ACRR_SHIFL RecName: Full=HTH-type transcriptional regulator
   10::73      5e-06  30%  215 aa  ACRR_ECOLI RecName: Full=HTH-type transcriptional regulator
   10::73      5e-06  30%  215 aa  ACRR_ECOL6 RecName: Full=HTH-type transcriptional regulator
   10::81      6e-06  32%  210 aa  MEPR_PSEPU RecName: Full=Probable HTH-type transcriptional
    3::94      1e-05  25%  207 aa  TETR2_ECOLX RecName: Full=Tetracycline repressor protein class B
   14::57      1e-05  41%  194 aa  FADR_BACSU RecName: Full=Fatty acid metabolism regulator protein;
   14::115     1e-05  29%  187 aa  DHAS_LACLA RecName: Full=HTH-type dhaKLM operon transcriptional
   10::60      2e-05  33%  134 aa  TTGW_PSEPU RecName: Full=Uncharacterized HTH-type transcriptional
   11::68      2e-05  33%  202 aa  BETI1_CHRSD RecName: Full=HTH-type transcriptional regulator
    8::121     3e-05  36%  195 aa  Y2936_MYCBO RecName: Full=Uncharacterized HTH-type transcriptional
    8::121     3e-05  36%  195 aa  Y2912_MYCTU RecName: Full=Uncharacterized HTH-type transcriptional
   12::60      3e-05  35%  213 aa  SRPR_PSEPU RecName: Full=HTH-type transcriptional regulator
    7::63      4e-05  32%  195 aa  YDGC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::54      7e-05  31%  189 aa  YVKB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    4::113     7e-05  30%  185 aa  ICAR_STAEQ RecName: Full=Biofilm operon icaABCD HTH-type negative
    4::113     7e-05  30%  185 aa  ICAR_STAEP RecName: Full=Biofilm operon icaABCD HTH-type negative
    5::60      9e-05  32%  207 aa  YTTP_BACSU RecName: Full=Probable HTH-type transcriptional
    6::54      9e-05  33%  185 aa  Y2897_STAA8 RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2658_STAAR RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2593_STAAC RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2578_STAAM RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2515_STAA3 RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2498_STAAW RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2464_STAAS RecName: Full=HTH-type transcriptional regulator
    6::54      9e-05  33%  185 aa  Y2364_STAAN RecName: Full=HTH-type transcriptional regulator
    3::64      1e-04  31%  198 aa  DHAR_MYCSX RecName: Full=HTH-type transcriptional repressor dhaR;
   11::68      1e-04  33%  195 aa  BETI_SHIF8 RecName: Full=HTH-type transcriptional regulator betI;
   11::58      1e-04  35%  202 aa  BETI_ENTS8 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOUT RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOSM RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOSE RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOLU RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOLI RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOLC RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOL6 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOL5 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECOHS RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECODH RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO8A RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO7I RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO5E RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO57 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO55 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO45 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO27 RecName: Full=HTH-type transcriptional regulator betI;
   11::68      1e-04  33%  195 aa  BETI_ECO24 RecName: Full=HTH-type transcriptional regulator betI;
    1::65      1e-04  34%  223 aa  YWCC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    7::54      1e-04  33%  185 aa  Y2452_STAAB RecName: Full=HTH-type transcriptional regulator
   17::59      1e-04  37%  207 aa  TETR8_PASMU RecName: Full=Tetracycline repressor protein class H;
   21::89      1e-04  28%  192 aa  BM3R1_BACME RecName: Full=HTH-type transcriptional repressor
   14::59      2e-04  35%  210 aa  TETR7_VIBAN RecName: Full=Tetracycline repressor protein class G;
   11::74      2e-04  29%  220 aa  ENVR_ECOLI RecName: Full=Probable acrEF/envCD operon repressor;
   11::74      2e-04  29%  220 aa  ENVR_ECO57 RecName: Full=Probable acrEF/envCD operon repressor;
   12::65      3e-04  28%  205 aa  YFIR_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   14::67      3e-04  36%  205 aa  Y570_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
   11::72      3e-04  40%  196 aa  BETI_STRM5 RecName: Full=HTH-type transcriptional regulator betI;
   23::64      4e-04  31%  187 aa  Y893_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
   11::58      4e-04  33%  198 aa  BETI_SERP5 RecName: Full=HTH-type transcriptional regulator betI;
    6::54      6e-04  29%  196 aa  YPB3_LACLA RecName: Full=Uncharacterized HTH-type transcriptional
  191::234     6e-04  34%  295 aa  ST1E1_BOVIN RecName: Full=Estrogen sulfotransferase;       
   12::66      6e-04  35%  194 aa  BSCR_BACSU RecName: Full=HTH-type transcriptional repressor bscR;
    2::62      7e-04  28%  196 aa  UIDR_SHIFL RecName: Full=HTH-type transcriptional regulator
    2::62      7e-04  28%  196 aa  UIDR_ECOLI RecName: Full=HTH-type transcriptional regulator
    2::62      7e-04  28%  196 aa  UIDR_ECOL6 RecName: Full=HTH-type transcriptional regulator
    2::62      7e-04  28%  196 aa  UIDR_ECO57 RecName: Full=HTH-type transcriptional regulator
   28::61      7e-04  38%  197 aa  TETC_ECOLX RecName: Full=Transposon Tn10 tetC protein;AltName:
   11::68      7e-04  31%  207 aa  BETI2_CHRSD RecName: Full=HTH-type transcriptional regulator
   24::74      0.001  27%  226 aa  TCMR_STRGA RecName: Full=HTH-type transcriptional regulator
    1::197

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHQNDLRVRKTRAKIKRALIETINEKGFGNLTVSDITERAGINRGTFYIHYKGKQDLLEQLEEAIYSDII
YXBF_BACSU      --QIDRRVVRTREALQKAFLDVLAEKDYAGITISDITRKSNIRRATFYDHYANKEELLQTMIQRSCAEII
MTRR_NEIGO      MRKTKTEALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRGALYWHFKNKEDLFDALFQRICDDI-
YVDT_BACSU      -------------KILQAAIEVISEKGLDKASISDIVKKAGTAQGTFYLYFSSKNALIPAIAE-------
BETI_KLEP3      -----------RRQLIDATLDAINEVGMHDATIAQIARRAGVSTGIISHYFKDKNGLLEATMRDITSQVL
TTGR_PSEPU      --------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
TTGR_PSEPK      --------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
ARPR_PSEPU      --------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
YERO_BACSU      -------MNEKKERIIKTSIRLFAKKGFAATTIQEIASECGISKGAFYLHFKSKEALL------------
TETR8_PASPI     --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
TETR4_SALOR     --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
TETR4_ECOLX     --------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALL----DALAVEIL
ICAR_STAAW      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAS      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAR      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAN      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAM      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAE      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAAC      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ICAR_STAA8      -------------KIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFNNII
ACRR_SHIFL      --------QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESNIG
ACRR_ECOLI      --------QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESNIG
ACRR_ECOL6      --------QETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESNIG
MEPR_PSEPU      --------QETPAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHET--
TETR2_ECOLX     --------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL----DALAIEML
FADR_BACSU      -----------------AAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISL---------
DHAS_LACLA      ----------TQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFE---NDFA
TTGW_PSEPU      --------KETRQRIIDAALEVFVAQGVPDATLDQIARKAGVTRGAVYWHFNGKLEVLQ-----------
BETI1_CHRSD     -----------RRQLIQATLETIDDVGLADATIARIAKRAGVSAGIISHYFGGKDGLLESAMRQILWDL-
Y2936_MYCBO     ------RREETVARLLQASIDTIIEVGYARASAAVITKRAGVSVGALFRH--------------------
Y2912_MYCTU     ------RREETVARLLQASIDTIIEVGYARASAAVITKRAGVSVGALFRH--------------------
SRPR_PSEPU      ----------TRQRIIDAALEVFVAQGVSDATLDQIARKAGVTRGAVYWHFNGKLEVLQ-----------
YDGC_BACSU      ---------ESRKRLLKAAANEFSVRGFHDAKVSEIVKKAGFTQPSFYLYFQSK--------EAIFAELI
YVKB_BACSU      -------MRPTNKRILDAAMQLLVKKGYRATTTKEIAEKANVSEATIFRNFKNKQGLVEAL---------
ICAR_STAEQ      -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
ICAR_STAEP      -------------KIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFI
YTTP_BACSU      ----------TKDKIIESAVMLFNQKGFSGTSVREIAKSADVNVAHISYYFKGKGGLMEHLVSEFY----
Y2897_STAA8     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2658_STAAR     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2593_STAAC     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2578_STAAM     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2515_STAA3     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2498_STAAW     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2464_STAAS     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
Y2364_STAAN     --------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
DHAR_MYCSX      -----------RTPVRQHLVEVFLERGYSGSAVQDITAAAEVPKGSFYNHFESKEAFGGQVLQEFFSDL-
BETI_SHIF8      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ENTS8      -----------RRQLIDATLSTINDVGINDATIAQIARRAGVSAGIISHYFKDKNGLLE-----------
BETI_ECOUT      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOSM      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOSE      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOLU      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOLI      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOLC      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOL6      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOL5      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECOHS      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECODH      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO8A      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO7I      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO5E      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO57      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO55      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO45      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO27      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
BETI_ECO24      -----------RRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQL-
YWCC_BACSU      -------MKKNKFQIKRAGVNLLIDRAYDPVSVEDISRAAGYSKGAFYVHFVSKDDFLLYLLE-------
Y2452_STAAB     ---------ENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDL-------------
TETR8_PASMU     ----------------------LNEVGIEGLTTRNVAQKIGVEQPTLYWHVKNKRALLDALAETI-----
BM3R1_BACME     ------------------------ERGFDATTMPMIAENAKVGAGTIYRYFKNKESLVNELFQQHVNEFL
TETR7_VIBAN     -------------------LELLNEVGMDSLTTRKLAERLKVQQPALYWHFQNKRALLDALPEAM-----
ENVR_ECOLI      ---------KTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNELQQPSLRELI
ENVR_ECO57      ---------KTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNELQQPSLRELI
YFIR_BACSU      ---------KRQAEILEAAKTVFKRKGFELTTMKDVVEESGFSRGGVYLYFSSTEEMFRRIIE-------
Y570_HAEIN      -----------RALVDAAFNQLSAEKSFSNLSLREVAREAGIAPTSFYRHFSDMDELLEMVDEA------
BETI_STRM5      -----------REQLIRATFQTIDEIGMADATVATIAKKAGLSSG-IVAHYFGDKDILRELKEAV-----
Y893_HAEIN      -------------------------EGLNQLSMLKLAKEANVAAGTIYLYFKNKDELLEQFAHRVFS---
BETI_SERP5      -----------RQQLIDATLAAVNEVGMHDATIAQIARRAGVSNGIISHYFKDKNGLLE-----------
YPB3_LACLA      -------LRNTKEKILTATEQLIYKKGYTGTSINDILDETATGKGQFYYYFDSKKE--------------
ST1E1_BOVIN     ----------------------------------------------------------------------
BSCR_BACSU      --------------IMKASVSLFTERGFDATTIPMIAERAHVGTGTIYRYFDSK----ETLVNVLFQESI
UIDR_SHIFL      MDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAI---------
UIDR_ECOLI      MDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAI---------
UIDR_ECOL6      MDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAI---------
UIDR_ECO57      MDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAI---------
TETC_ECOLX      ------------------------EKGYQAVSIDEISGKALVTKGAFYHHFKNKKQLL------------
BETI2_CHRSD     -----------RQQLIKATMAAIDEVGLAEATVMRIARHAGVSAGIISHYFGGKDGLLEATMRQILTDL-
TCMR_STRGA      ------KLRRTRDQLIREALELFLAQGYEHTTVEQIAEAVEVHPRTFFRHFASKEEV-------------


                         .         .         *         .         .         .         .:140
query           QLFHDNGTISSATSYEDLNRQFFQKFSAYIYGERYFILAIVLGNGDPMFYHKIKQILTRELLKRMEYLGI
YXBF_BACSU      ----DHLTIASS----------------------------------------------------------
MTRR_NEIGO      ----------------------------------------------------------------------
YVDT_BACSU      ----------------------------------------------------------------------
BETI_KLEP3      NRLHALPDGSASQRLQAIVGGNFDETQISSAAMKAWLAFWASSMHQPMLY-RLQQVSSRRLLSNLVY---
TTGR_PSEPU      ---HDH--LARASESED-----------------------------------------------------
TTGR_PSEPK      ---HDH--LARASESED-----------------------------------------------------
ARPR_PSEPU      ---HDH--LARASESED-----------------------------------------------------
YERO_BACSU      ----------------------------------------------------------------------
TETR8_PASPI     ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
TETR4_SALOR     ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
TETR4_ECOLX     ARHHDYSLPAAGESWQSFLRNNAMSF--------------------------------------------
ICAR_STAAW      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAS      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAR      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAN      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAM      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAE      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAAC      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ICAR_STAA8      MMNQNKSNYSIDALY-----QFLFEF-IFDIEERYIRMYVQLSNTPEEFIQDLNQSLSKEIAKFYDESKI
ACRR_SHIFL      EL--------------------------------------------------------------------
ACRR_ECOLI      EL--------------------------------------------------------------------
ACRR_ECOL6      EL--------------------------------------------------------------------
MEPR_PSEPU      ---HDH--LARASESED-----------------------------------------------------
TETR2_ECOLX     DRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHR------------------------------------
FADR_BACSU      ----------------------------------------------------------------------
DHAS_LACLA      ELINDNNEXXXXXRYLDENQIFYQKIFVIDKNFEHFFL--------------------------------
TTGW_PSEPU      ----------------------------------------------------------------------
BETI1_CHRSD     ----------------------------------------------------------------------
Y2936_MYCBO     --FETMGDFMAATAYEVLRRQLFTKQVAEIPADRPALPAITAGSTNAVLYELMVAARTDEKLK-------
Y2912_MYCTU     --FETMGDFMAATAYEVLRRQLFTKQVAEIPADRPALPAITAGSTNAVLYELMVAARTDEKLK-------
SRPR_PSEPU      ----------------------------------------------------------------------
YDGC_BACSU      TDFH------------------------------------------------------------------
YVKB_BACSU      ----------------------------------------------------------------------
ICAR_STAEQ      DFLDDNYSI-------DGLYQFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
ICAR_STAEP      DFLDDNYSI-------DGLYQFLFKF-IFDVDERYIKLYVQLSSAPEALNSEIKHHL-------------
YTTP_BACSU      ----------------------------------------------------------------------
Y2897_STAA8     ----------------------------------------------------------------------
Y2658_STAAR     ----------------------------------------------------------------------
Y2593_STAAC     ----------------------------------------------------------------------
Y2578_STAAM     ----------------------------------------------------------------------
Y2515_STAA3     ----------------------------------------------------------------------
Y2498_STAAW     ----------------------------------------------------------------------
Y2464_STAAS     ----------------------------------------------------------------------
Y2364_STAAN     ----------------------------------------------------------------------
DHAR_MYCSX      ----------------------------------------------------------------------
BETI_SHIF8      ----------------------------------------------------------------------
BETI_ENTS8      ----------------------------------------------------------------------
BETI_ECOUT      ----------------------------------------------------------------------
BETI_ECOSM      ----------------------------------------------------------------------
BETI_ECOSE      ----------------------------------------------------------------------
BETI_ECOLU      ----------------------------------------------------------------------
BETI_ECOLI      ----------------------------------------------------------------------
BETI_ECOLC      ----------------------------------------------------------------------
BETI_ECOL6      ----------------------------------------------------------------------
BETI_ECOL5      ----------------------------------------------------------------------
BETI_ECOHS      ----------------------------------------------------------------------
BETI_ECODH      ----------------------------------------------------------------------
BETI_ECO8A      ----------------------------------------------------------------------
BETI_ECO7I      ----------------------------------------------------------------------
BETI_ECO5E      ----------------------------------------------------------------------
BETI_ECO57      ----------------------------------------------------------------------
BETI_ECO55      ----------------------------------------------------------------------
BETI_ECO45      ----------------------------------------------------------------------
BETI_ECO27      ----------------------------------------------------------------------
BETI_ECO24      ----------------------------------------------------------------------
YWCC_BACSU      ----------------------------------------------------------------------
Y2452_STAAB     ----------------------------------------------------------------------
TETR8_PASMU     ----------------------------------------------------------------------
BM3R1_BACME     QCI-ESGLANERDGYRDGFHHIFE----------------------------------------------
TETR7_VIBAN     ----------------------------------------------------------------------
ENVR_ECOLI      Q---------------------------------------------------------------------
ENVR_ECO57      Q---------------------------------------------------------------------
YFIR_BACSU      ----------------------------------------------------------------------
Y570_HAEIN      ----------------------------------------------------------------------
BETI_STRM5      ----------------------------------------------------------------------
Y893_HAEIN      ----------------------------------------------------------------------
BETI_SERP5      ----------------------------------------------------------------------
YPB3_LACLA      ----------------------------------------------------------------------
ST1E1_BOVIN     -----------------------------------------------LFYEDMKENIRKEVMKLLEFLGR
BSCR_BACSU      QRF-------------------------------------------------------------------
UIDR_SHIFL      ----------------------------------------------------------------------
UIDR_ECOLI      ----------------------------------------------------------------------
UIDR_ECOL6      ----------------------------------------------------------------------
UIDR_ECO57      ----------------------------------------------------------------------
TETC_ECOLX      ----------------------------------------------------------------------
BETI2_CHRSD     ----------------------------------------------------------------------
TCMR_STRGA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KMSDEIPHEYIEEYAIGSMLNLSIYWLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YXBF_BACSU      ---------------------------------------------------------
MTRR_NEIGO      ---------------------------------------------------------
YVDT_BACSU      ---------------------------------------------------------
BETI_KLEP3      EFRRELPREQAQEAGYGLAALIDGLWL------------------------------
TTGR_PSEPU      ---------------------------------------------------------
TTGR_PSEPK      ---------------------------------------------------------
ARPR_PSEPU      ---------------------------------------------------------
YERO_BACSU      ---------------------------------------------------------
TETR8_PASPI     ---------------------------------------------------------
TETR4_SALOR     ---------------------------------------------------------
TETR4_ECOLX     ---------------------------------------------------------
ICAR_STAAW      KMTKE----------------------------------------------------
ICAR_STAAS      KMTKE----------------------------------------------------
ICAR_STAAR      KMTKE----------------------------------------------------
ICAR_STAAN      KMTKE----------------------------------------------------
ICAR_STAAM      KMTKE----------------------------------------------------
ICAR_STAAE      KMTKE----------------------------------------------------
ICAR_STAAC      KMTKE----------------------------------------------------
ICAR_STAA8      KMTKE----------------------------------------------------
ACRR_SHIFL      ---------------------------------------------------------
ACRR_ECOLI      ---------------------------------------------------------
ACRR_ECOL6      ---------------------------------------------------------
MEPR_PSEPU      ---------------------------------------------------------
TETR2_ECOLX     ---------------------------------------------------------
FADR_BACSU      ---------------------------------------------------------
DHAS_LACLA      ---------------------------------------------------------
TTGW_PSEPU      ---------------------------------------------------------
BETI1_CHRSD     ---------------------------------------------------------
Y2936_MYCBO     ---------------------------------------------------------
Y2912_MYCTU     ---------------------------------------------------------
SRPR_PSEPU      ---------------------------------------------------------
YDGC_BACSU      ---------------------------------------------------------
YVKB_BACSU      ---------------------------------------------------------
ICAR_STAEQ      ---------------------------------------------------------
ICAR_STAEP      ---------------------------------------------------------
YTTP_BACSU      ---------------------------------------------------------
Y2897_STAA8     ---------------------------------------------------------
Y2658_STAAR     ---------------------------------------------------------
Y2593_STAAC     ---------------------------------------------------------
Y2578_STAAM     ---------------------------------------------------------
Y2515_STAA3     ---------------------------------------------------------
Y2498_STAAW     ---------------------------------------------------------
Y2464_STAAS     ---------------------------------------------------------
Y2364_STAAN     ---------------------------------------------------------
DHAR_MYCSX      ---------------------------------------------------------
BETI_SHIF8      ---------------------------------------------------------
BETI_ENTS8      ---------------------------------------------------------
BETI_ECOUT      ---------------------------------------------------------
BETI_ECOSM      ---------------------------------------------------------
BETI_ECOSE      ---------------------------------------------------------
BETI_ECOLU      ---------------------------------------------------------
BETI_ECOLI      ---------------------------------------------------------
BETI_ECOLC      ---------------------------------------------------------
BETI_ECOL6      ---------------------------------------------------------
BETI_ECOL5      ---------------------------------------------------------
BETI_ECOHS      ---------------------------------------------------------
BETI_ECODH      ---------------------------------------------------------
BETI_ECO8A      ---------------------------------------------------------
BETI_ECO7I      ---------------------------------------------------------
BETI_ECO5E      ---------------------------------------------------------
BETI_ECO57      ---------------------------------------------------------
BETI_ECO55      ---------------------------------------------------------
BETI_ECO45      ---------------------------------------------------------
BETI_ECO27      ---------------------------------------------------------
BETI_ECO24      ---------------------------------------------------------
YWCC_BACSU      ---------------------------------------------------------
Y2452_STAAB     ---------------------------------------------------------
TETR8_PASMU     ---------------------------------------------------------
BM3R1_BACME     ---------------------------------------------------------
TETR7_VIBAN     ---------------------------------------------------------
ENVR_ECOLI      ---------------------------------------------------------
ENVR_ECO57      ---------------------------------------------------------
YFIR_BACSU      ---------------------------------------------------------
Y570_HAEIN      ---------------------------------------------------------
BETI_STRM5      ---------------------------------------------------------
Y893_HAEIN      ---------------------------------------------------------
BETI_SERP5      ---------------------------------------------------------
YPB3_LACLA      ---------------------------------------------------------
ST1E1_BOVIN     KASDELVDKIIKHTSFQEMKN------------------------------------
BSCR_BACSU      ---------------------------------------------------------
UIDR_SHIFL      ---------------------------------------------------------
UIDR_ECOLI      ---------------------------------------------------------
UIDR_ECOL6      ---------------------------------------------------------
UIDR_ECO57      ---------------------------------------------------------
TETC_ECOLX      ---------------------------------------------------------
BETI2_CHRSD     ---------------------------------------------------------
TCMR_STRGA      ---------------------------------------------------------