[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00499.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
    9::305     9e-55  47%  305 aa  OPPC_BACSU RecName: Full=Oligopeptide transport system permease
   19::320     5e-54  44%  320 aa  DPPC_BACSU RecName: Full=Dipeptide transport system permease
   82::300     3e-44  39%  303 aa  APPC_BACSU RecName: Full=Oligopeptide transport system permease
   68::302     3e-38  33%  303 aa  GSID_SALTY RecName: Full=Glutathione transport system permease
   68::302     3e-38  33%  303 aa  GSID_SALTI RecName: Full=Glutathione transport system permease
   68::302     3e-38  33%  303 aa  GSID_SALPA RecName: Full=Glutathione transport system permease
   68::302     3e-38  33%  303 aa  GSID_SALCH RecName: Full=Glutathione transport system permease
   73::300     8e-38  32%  301 aa  GSID_ERWCT RecName: Full=Glutathione transport system permease
   49::269     3e-34  32%  277 aa  NIKC_ECOLI RecName: Full=Nickel transport system permease protein
   49::269     3e-34  32%  277 aa  NIKC_ECO57 RecName: Full=Nickel transport system permease protein
   83::302     5e-34  32%  303 aa  GSID_SHIFL RecName: Full=Glutathione transport system permease
   83::302     5e-34  32%  303 aa  GSID_SHIF8 RecName: Full=Glutathione transport system permease
   74::295     8e-33  32%  295 aa  DPPC_HAEIN RecName: Full=Dipeptide transport system permease
   83::302     5e-32  32%  302 aa  OPPC_SALTY RecName: Full=Oligopeptide transport system permease
   83::302     5e-32  32%  302 aa  OPPC_ECOLI RecName: Full=Oligopeptide transport system permease
   83::302     5e-32  32%  302 aa  OPPC_ECO57 RecName: Full=Oligopeptide transport system permease
   70::289     2e-31  33%  291 aa  Y4TQ_RHISN RecName: Full=Probable peptide ABC transporter permease
   57::284     2e-31  30%  291 aa  Y1313_MYCBO RecName: Full=Putative peptide transport permease
   57::284     2e-31  30%  291 aa  Y1282_MYCTU RecName: Full=Putative peptide transport permease
   83::302     2e-31  31%  303 aa  GSID_SHISS RecName: Full=Glutathione transport system permease
   83::302     2e-31  31%  303 aa  GSID_SHIBS RecName: Full=Glutathione transport system permease
   83::302     2e-31  31%  303 aa  GSID_ECOL6 RecName: Full=Glutathione transport system permease
   83::302     2e-31  31%  303 aa  GSID_ECOL5 RecName: Full=Glutathione transport system permease
   83::302     2e-31  31%  303 aa  GSID_ECO57 RecName: Full=Glutathione transport system permease
   83::302     3e-31  30%  303 aa  GSID_ECOLI RecName: Full=Glutathione transport system permease
   83::302     4e-31  31%  303 aa  GSID_ECOUT RecName: Full=Glutathione transport system permease
   83::302     4e-31  31%  303 aa  GSID_ECOK1 RecName: Full=Glutathione transport system permease
   65::298     2e-30  30%  302 aa  Y3407_BRUSU RecName: Full=Putative peptide permease protein
   83::302     4e-30  30%  303 aa  GSID_SHIDS RecName: Full=Glutathione transport system permease
   65::298     6e-30  29%  302 aa  Y2550_BRUO2 RecName: Full=Putative peptide permease protein
   65::298     8e-30  29%  302 aa  Y3861_BRUME RecName: Full=Putative peptide permease protein
   65::298     8e-30  29%  302 aa  Y3315_BRUA2 RecName: Full=Putative peptide permease protein
   65::298     8e-30  29%  302 aa  Y3094_BRUAB RecName: Full=Putative peptide permease protein
   84::303     8e-30  33%  304 aa  DPPC_BACPF RecName: Full=Dipeptide transport system permease
   89::308     1e-29  32%  308 aa  AMID_STRR6 RecName: Full=Oligopeptide transport system permease
   89::308     1e-29  32%  308 aa  AMID_STRPN RecName: Full=Oligopeptide transport system permease
   77::293     4e-29  36%  296 aa  Y207_BRUME RecName: Full=Putative peptide transport system permease
   77::293     4e-29  36%  296 aa  Y1093_BRUSU RecName: Full=Putative peptide transport system
   77::293     4e-29  36%  296 aa  Y1051_BRUA2 RecName: Full=Putative peptide transport system
   77::293     4e-29  36%  296 aa  Y1032_BRUAB RecName: Full=Putative peptide transport system
   81::300     2e-27  33%  300 aa  DPPC_ECOLI RecName: Full=Dipeptide transport system permease
   81::300     2e-27  33%  300 aa  DPPC_ECOL6 RecName: Full=Dipeptide transport system permease
   81::300     2e-27  33%  300 aa  DPPC_ECO57 RecName: Full=Dipeptide transport system permease
   90::311     4e-27  29%  311 aa  OPPC_HAEIN RecName: Full=Oligopeptide transport system permease
   71::248     2e-23  33%  294 aa  OPPC_LACLS RecName: Full=Oligopeptide transport system permease
   71::248     2e-23  33%  294 aa  OPPC_LACLA RecName: Full=Oligopeptide transport system permease
  116::337     6e-22  26%  341 aa  YEJE_ECOLI RecName: Full=Inner membrane ABC transporter permease
  146::375     2e-21  32%  376 aa  OPPC_MYCPN RecName: Full=Oligopeptide transport system permease
   52::263     2e-21  26%  276 aa  OPPC2_STAAN RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAAM RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  27%  276 aa  OPPC2_STAAB RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAAW RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAAS RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAAC RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAA8 RecName: Full=Putative oligopeptide transport system
   52::263     2e-21  26%  276 aa  OPPC2_STAA3 RecName: Full=Putative oligopeptide transport system
   68::292     2e-21  28%  298 aa  DDPC_ECOLI RecName: Full=Probable D,D-dipeptide transport system
   52::263     3e-21  26%  276 aa  OPPC2_STAAR RecName: Full=Putative oligopeptide transport system
   76::290     2e-18  28%  296 aa  SAPC_SHIFL RecName: Full=Peptide transport system permease protein
   76::290     2e-18  27%  296 aa  SAPC_SALTY RecName: Full=Peptide transport system permease protein
   76::290     2e-18  27%  296 aa  SAPC_SALTI RecName: Full=Peptide transport system permease protein
   76::290     2e-18  28%  296 aa  SAPC_ECOLI RecName: Full=Peptide transport system permease protein
   76::290     2e-18  28%  296 aa  SAPC_ECOL6 RecName: Full=Peptide transport system permease protein
  152::372     8e-17  30%  376 aa  OPPC_MYCGE RecName: Full=Oligopeptide transport system permease
   75::291     1e-08  23%  295 aa  SAPC_HAEIN RecName: Full=Peptide transport system permease protein
  228::323     7e-05  27%  364 aa  YEJB_ECOLI RecName: Full=Inner membrane ABC transporter permease
  228::323     7e-05  27%  364 aa  YEJB_ECO57 RecName: Full=Inner membrane ABC transporter permease
   75::313     7e-05  25%  315 aa  Y209_BRUME RecName: Full=Putative peptide transport system permease
   74::312     7e-05  25%  314 aa  Y1050_BRUA2 RecName: Full=Putative peptide transport system
   74::312     7e-05  25%  314 aa  Y1031_BRUAB RecName: Full=Putative peptide transport system
  178::247     7e-05  30%  308 aa  DPPB_BACSU RecName: Full=Dipeptide transport system permease
   71::193     2e-04  24%  275 aa  TAUC_ECOLI RecName: Full=Taurine transport system permease protein
  181::308     3e-04  27%  314 aa  NIKB_ECOLI RecName: Full=Nickel transport system permease protein
   74::310     4e-04  25%  314 aa  Y1092_BRUSU RecName: Full=Putative peptide transport system
  187::269     4e-04  32%  321 aa  SAPB_SALTY RecName: Full=Peptide transport system permease protein
  187::269     4e-04  32%  321 aa  SAPB_SALTI RecName: Full=Peptide transport system permease protein
  206::332     6e-04  27%  333 aa  DPPB_BACPF RecName: Full=Dipeptide transport system permease
  191::313     6e-04  29%  316 aa  APPB_BACSU RecName: Full=Oligopeptide transport system permease
  187::269     7e-04  31%  321 aa  SAPB_ECOLI RecName: Full=Peptide transport system permease protein
  187::269     7e-04  31%  321 aa  SAPB_ECO57 RecName: Full=Peptide transport system permease protein
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxPDSFEPLAKGEAQDNEKIAAPSLTFTQDVWLRLKKNKGAXXXXXXXXXXXXXAFGSTPFINK
OPPC_BACSU      -----------FEPAA-ANAGDAEKISKKSLSLWKDAMLRFRSNKXXXXXXXXXXXXXXXXXFAPMF---
DPPC_BACSU      --------PDEWFVLNQEKNREADSVKRPSLSYTQDAWRRLKKNKLAMAGLFILLFLFVMAVIG-PFLSP
APPC_BACSU      ----------------------------------------------------------------------
GSID_SALTY      ----------------------------------------------------------------------
GSID_SALTI      ----------------------------------------------------------------------
GSID_SALPA      ----------------------------------------------------------------------
GSID_SALCH      ----------------------------------------------------------------------
GSID_ERWCT      ----------------------------------------------------------------------
NIKC_ECOLI      ----------------------------------------------------------------------
NIKC_ECO57      ----------------------------------------------------------------------
GSID_SHIFL      ----------------------------------------------------------------------
GSID_SHIF8      ----------------------------------------------------------------------
DPPC_HAEIN      ----------------------------------------------------------------------
OPPC_SALTY      ----------------------------------------------------------------------
OPPC_ECOLI      ----------------------------------------------------------------------
OPPC_ECO57      ----------------------------------------------------------------------
Y4TQ_RHISN      ----------------------------------------------------------------------
Y1313_MYCBO     ----------------------------------------------------------------------
Y1282_MYCTU     ----------------------------------------------------------------------
GSID_SHISS      ----------------------------------------------------------------------
GSID_SHIBS      ----------------------------------------------------------------------
GSID_ECOL6      ----------------------------------------------------------------------
GSID_ECOL5      ----------------------------------------------------------------------
GSID_ECO57      ----------------------------------------------------------------------
GSID_ECOLI      ----------------------------------------------------------------------
GSID_ECOUT      ----------------------------------------------------------------------
GSID_ECOK1      ----------------------------------------------------------------------
Y3407_BRUSU     ----------------------------------------------------------------------
GSID_SHIDS      ----------------------------------------------------------------------
Y2550_BRUO2     ----------------------------------------------------------------------
Y3861_BRUME     ----------------------------------------------------------------------
Y3315_BRUA2     ----------------------------------------------------------------------
Y3094_BRUAB     ----------------------------------------------------------------------
DPPC_BACPF      ----------------------------------------------------------------------
AMID_STRR6      ----------------------------------------------------------------------
AMID_STRPN      ----------------------------------------------------------------------
Y207_BRUME      ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
DPPC_ECOLI      ----------------------------------------------------------------------
DPPC_ECOL6      ----------------------------------------------------------------------
DPPC_ECO57      ----------------------------------------------------------------------
OPPC_HAEIN      ----------------------------------------------------------------------
OPPC_LACLS      ----------------------------------------------------------------------
OPPC_LACLA      ----------------------------------------------------------------------
YEJE_ECOLI      ----------------------------------------------------------------------
OPPC_MYCPN      ----------------------------------------------------------------------
OPPC2_STAAN     ----------------------------------------------------------------------
OPPC2_STAAM     ----------------------------------------------------------------------
OPPC2_STAAB     ----------------------------------------------------------------------
OPPC2_STAAW     ----------------------------------------------------------------------
OPPC2_STAAS     ----------------------------------------------------------------------
OPPC2_STAAC     ----------------------------------------------------------------------
OPPC2_STAA8     ----------------------------------------------------------------------
OPPC2_STAA3     ----------------------------------------------------------------------
DDPC_ECOLI      ----------------------------------------------------------------------
OPPC2_STAAR     ----------------------------------------------------------------------
SAPC_SHIFL      ----------------------------------------------------------------------
SAPC_SALTY      ----------------------------------------------------------------------
SAPC_SALTI      ----------------------------------------------------------------------
SAPC_ECOLI      ----------------------------------------------------------------------
SAPC_ECOL6      ----------------------------------------------------------------------
OPPC_MYCGE      ----------------------------------------------------------------------
SAPC_HAEIN      ----------------------------------------------------------------------
YEJB_ECOLI      ----------------------------------------------------------------------
YEJB_ECO57      ----------------------------------------------------------------------
Y209_BRUME      ----------------------------------------------------------------------
Y1050_BRUA2     ----------------------------------------------------------------------
Y1031_BRUAB     ----------------------------------------------------------------------
DPPB_BACSU      ----------------------------------------------------------------------
TAUC_ECOLI      ----------------------------------------------------------------------
NIKB_ECOLI      ----------------------------------------------------------------------
Y1092_BRUSU     ----------------------------------------------------------------------
SAPB_SALTY      ----------------------------------------------------------------------
SAPB_SALTI      ----------------------------------------------------------------------
DPPB_BACPF      ----------------------------------------------------------------------
APPB_BACSU      ----------------------------------------------------------------------
SAPB_ECOLI      ----------------------------------------------------------------------
SAPB_ECO57      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           STLVKSQPQYANLPAKVPGLDAINGLNGKIKQGGVWVDAYAKNDVPKDKYFYLGTDYLGRSLAQRIIYGT
OPPC_BACSU      -----SRYDYSTT----------NLLNA---------------DKPPSKDHWFGTDDLGRDIFVRTWVGA
DPPC_BACSU      HSVVRQSLTEQNLP---PSAD-----------------------------HWFGTDELGRDVFTRTWYGA
APPC_BACSU      ----------------------------------------------------MGTDKFGRDIFSRILYGA
GSID_SALTY      -----------------------------------YFDYDSLNNGPSLQHWF-GVDSLGRDIFSRVLVGA
GSID_SALTI      -----------------------------------YFDYDSLNNGPSLQHWF-GVDSLGRDIFSRVLVGA
GSID_SALPA      -----------------------------------YFDYDSLNNGPSLQHWF-GVDSLGRDIFSRVLVGA
GSID_SALCH      -----------------------------------YFDYDSLNNGPSLQHWF-GVDSLGRDIFSRVLVGA
GSID_ERWCT      ------------------------------------------NEGPSSAH-WLGVDSLGRDIFSRILMGT
NIKC_ECOLI      -----------------------------------------------DAQHWLGTDHLGRDIFSRLMAAT
NIKC_ECO57      -----------------------------------------------DAQHWLGTDHLGRDIFSRLMAAT
GSID_SHIFL      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_SHIF8      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
DPPC_HAEIN      --------------------------------------------------YLLGTDDIGRDILSRIIYGT
OPPC_SALTY      ---------------------------------------------------YFGTDSSGRDLLVRVAIGG
OPPC_ECOLI      ---------------------------------------------------YFGTDSSGRDLLVRVAIGG
OPPC_ECO57      ---------------------------------------------------YFGTDSSGRDLLVRVAIGG
Y4TQ_RHISN      ---------------------------------------------------WFGTDNLGRDVFARTIYGA
Y1313_MYCBO     ---------------------------------------------PPGTKHWLGTNALGQDLLAQTLRGM
Y1282_MYCTU     ---------------------------------------------PPGTKHWLGTNALGQDLLAQTLRGM
GSID_SHISS      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_SHIBS      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECOL6      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECOL5      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECO57      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECOLI      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECOUT      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
GSID_ECOK1      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
Y3407_BRUSU     ------------------------------------IDLMAMNSAPSWKHWF-GTDGVGRDVFARTMEGG
GSID_SHIDS      ---------------------------------------------------WFGVDSLGRDIFSRVLVGA
Y2550_BRUO2     ------------------------------------IDLMAMNSAPSWKHWF-GADGVGRDVFARTMEGG
Y3861_BRUME     ------------------------------------IDLMAMNSAPSWKHWF-GTDGVGRDVFARTMEGG
Y3315_BRUA2     ------------------------------------IDLMAMNSAPSWKHWF-GTDGVGRDVFARTMEGG
Y3094_BRUAB     ------------------------------------IDLMAMNSAPSWKHWF-GTDGVGRDVFARTMEGG
DPPC_BACPF      ---------------------------------------------------WFGTDDFGRDIFTRIVYGA
AMID_STRR6      ---------------------------------------------------WFGTDSNGKSLFDGVWFGA
AMID_STRPN      ---------------------------------------------------WFGTDSNGKSLFDGVWFGA
Y207_BRUME      -----------------------------------------------------GTDNFGRDLWTRVLYGA
Y1093_BRUSU     -----------------------------------------------------GTDNFGRDLWTRVLYGA
Y1051_BRUA2     -----------------------------------------------------GTDNFGRDLWTRVLYGA
Y1032_BRUAB     -----------------------------------------------------GTDNFGRDLWTRVLYGA
DPPC_ECOLI      ----------------------------------------------------LGTDDVGRDVLSRLMYGA
DPPC_ECOL6      ----------------------------------------------------LGTDDVGRDVLSRLMYGA
DPPC_ECO57      ----------------------------------------------------LGTDDVGRDVLSRLMYGA
OPPC_HAEIN      -------------------------------------------------YHFFGTDASGRDLLVRTAIGG
OPPC_LACLS      ----------------------------------------------------LGTDNGGRDIIMMLMISA
OPPC_LACLA      ----------------------------------------------------LGTDNGGRDIIMMLMISA
YEJE_ECOLI      ---------------------------------------------PPSRQNWLGTDANGGDVLARILYGT
OPPC_MYCPN      ----------------------------------------------KNYYPLLGTNGLGVDIWTLLWASM
OPPC2_STAAN     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAAM     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAAB     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAAW     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAAS     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAAC     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAA8     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
OPPC2_STAA3     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
DDPC_ECOLI      --------------------------------------------LPPSAAHWFGTDEVGRDLFSRVLVGS
OPPC2_STAAR     ----------------------------------------------------LGTDDYGRDLFTRIIIGA
SAPC_SHIFL      --------------------------------------------------FFLGTDDLGRDVLSRLLSGA
SAPC_SALTY      --------------------------------------------------FFLGTDDLGRDVLSRLLSGA
SAPC_SALTI      --------------------------------------------------FFLGTDDLGRDVLSRLLSGA
SAPC_ECOLI      --------------------------------------------------FFLGTDDLGRDVLSRLLSGA
SAPC_ECOL6      --------------------------------------------------FFLGTDDLGRDVLSRLLSGA
OPPC_MYCGE      ----------------------------------------------------LGTNGLGIDIWTLLWASV
SAPC_HAEIN      --------------------------------------------------FFFGTDDLGRDILSRLIMGT
YEJB_ECOLI      ----------------------------------------------------------------------
YEJB_ECO57      ----------------------------------------------------------------------
Y209_BRUME      -------------------------------------------------HFDLGRSFLSQPVSQAIAERL
Y1050_BRUA2     -------------------------------------------------HFDLGRSFLSQPVSQAIAERL
Y1031_BRUAB     -------------------------------------------------HFDLGRSFLSQPVSQAIAERL
DPPB_BACSU      ----------------------------------------------------------------------
TAUC_ECOLI      --------------------------------------------------------FMDATLWQHLAASL
NIKB_ECOLI      ----------------------------------------------------------------------
Y1092_BRUSU     -------------------------------------------------HFDLGRSFLSQPVSQAIAERL
SAPB_SALTY      ----------------------------------------------------------------------
SAPB_SALTI      ----------------------------------------------------------------------
DPPB_BACPF      ----------------------------------------------------------------------
APPB_BACSU      ----------------------------------------------------------------------
SAPB_ECOLI      ----------------------------------------------------------------------
SAPB_ECO57      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KVSLIVALVATFFDLTVGVAYGIISGWKGGRVDNVMQRIIEIISSIPNXXXXXXXXXXXKPGMTSIILAI
OPPC_BACSU      RISIFIGVAAAVLDLLIGVIWGSISGFRGGRTDEIMMRIADILWAVPSXXXXXXXXXXXPKGLFTIIIAM
DPPC_BACSU      RISLFVGVMAALIDFLIGVIYGGVAGYKGGRIDSIMMRIIEXXXXXXXXXXXXXXXXXXXXXXXTIIVAL
APPC_BACSU      RVSLLVGFASVVGSILIGTVLGALAGYFRGIVDAVIMRVVDIVLSIPDIFLLITLVTIFKPGVDKLILIF
GSID_SALTY      QISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAV
GSID_SALTI      QISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAV
GSID_SALPA      QISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAV
GSID_SALCH      QISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAV
GSID_ERWCT      RISLAAGIFSVLVGMMIGTTLGLLAGYYEGWADRIIMRICDVLFAFPGILLAIAVVAIMGSGMANVVVAV
NIKC_ECOLI      RVSLGSVMACXXXXXXXXXXXXXSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAI
NIKC_ECO57      RVSLGSVMACXXXXXXXXXXXXXSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAI
GSID_SHIFL      QISLXXXXXXXXXXXXXXTLLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_SHIF8      QISLXXXXXXXXXXXXXXTLLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
DPPC_HAEIN      RISVFAGFIIVLLSCAFGTSLGLISGYYGGVXXXXXXXXXXXXXXXPNLLLTIVVVSILEPSLANATLAI
OPPC_SALTY      RISLMXXXXXXXXXXXXXTXXXXXXXXXXXKIDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAI
OPPC_ECOLI      RISLMXXXXXXXXXXXXXTXXXXXXXXXXXKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAI
OPPC_ECO57      RISLMXXXXXXXXXXXXXTXXXXXXXXXXXKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAI
Y4TQ_RHISN      RISLIVGLLSAVCAAVCGLLIGVIAGYSR-TFDNIIMRVMDGLMSIPTFLLAIALLSLTGPGIGILIVAI
Y1313_MYCBO     QKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWVVDLLLVVPSFILIAIVTPRTKANIMFLVLLL
Y1282_MYCTU     QKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWVVDLLLVVPSFILIAIVTPRTKANIMFLVLLL
GSID_SHISS      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_SHIBS      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECOL6      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECOL5      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECO57      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECOLI      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECOUT      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLSMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
GSID_ECOK1      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLSMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
Y3407_BRUSU     RIXXXXXXXXXXXXTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVI
GSID_SHIDS      QISLXXXXXXXXXXXXXXXXXXXXXXYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAV
Y2550_BRUO2     RIXXXXXXXXXXXXTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVI
Y3861_BRUME     RIXXXXXXXXXXXXTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVI
Y3315_BRUA2     RIXXXXXXXXXXXXTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVI
Y3094_BRUAB     RIXXXXXXXXXXXXTAIGFLIGAISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVI
DPPC_BACPF      RLSLQVGFFAVTGALIFGTTLGLIAGYYGRWIDMLISRIFDIMLAFPSXXXXXXXXXXXGPSLQNALIAI
AMID_STRR6      RNSILISVIATVINLXXXXXXXXXXXXSKS-VDRVMMEVYNVISNIPPLLIVIVLTYSIGAGFWNLIFAM
AMID_STRPN      RNSILISVIATVINLXXXXXXXXXXXXSKS-VDRVMMEVYNVISNIPPLLIVIVLTYSIGAGFWNLIFAM
Y207_BRUME      QVSLWIGLTXXXXXXXXXXXXXXXXXWYR-RFDTLLMRVMDALMAFPXXXXXXXXXXXXXPHLSSVIIAL
Y1093_BRUSU     QVSLWIGLTXXXXXXXXXXXXXXXXXWYR-RFDTLLMRVMDALMAFPXXXXXXXXXXXXXPHLSSVIIAL
Y1051_BRUA2     QVSLWIGLTXXXXXXXXXXXXXXXXXWYR-RFDTLLMRVMDALMAFPXXXXXXXXXXXXXPHLSSVIIAL
Y1032_BRUAB     QVSLWIGLTXXXXXXXXXXXXXXXXXWYR-RFDTLLMRVMDALMAFPXXXXXXXXXXXXXPHLSSVIIAL
DPPC_ECOLI      RXXXXXXXXXXXXXXIMGVILGLIAGYFGGLVDNIIMRVVDIMXXXXXXXXXXXXXXIFGPSIGNAALAL
DPPC_ECOL6      RXXXXXXXXXXXXXXIMGVILGLIAGYFGGLVDNIIMRVVDIMXXXXXXXXXXXXXXIFGPSIGNAALAL
DPPC_ECO57      RXXXXXXXXXXXXXXIMGVILGLIAGYFGGLVDNIIMRVVDIMXXXXXXXXXXXXXXIFGPSIGNAALAL
OPPC_HAEIN      RISLLVGIAGAFISVTIGTIYGAISGYVGGKTDMLMMRFLEILSSFPFMFFVILLVTLFGQNXXXXXXXX
OPPC_LACLS      RNSFNIAFAVTLITLVVGNILGVITGYFGGRFDLIFMRFTDFVMILPSMMIIIVFVTIIRFNSWSLIGII
OPPC_LACLA      RNSFNIAFAVTLITLVVGNILGVITGYFGGRFDLIFMRFTDFVMILPSMMIIIVFVTIIRFNSWSLIGII
YEJE_ECOLI      RISVLFGLMLTLCSSVMGVLAGALQGYYGGKVDLWGQRFIEVWSGMPTLFLIILLSSVVQPNFWWLLAIT
OPPC_MYCPN      AKSLWIAIVVALVSMVFGTIYGAIAGSFVGRADNIMSRIIEIIDLVPSILWIIVLGATFRFGGVKVIFTL
OPPC2_STAAN     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAAM     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAAB     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIVIALASFFQPSLWNLVISI
OPPC2_STAAW     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAAS     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAAC     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAA8     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
OPPC2_STAA3     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
DDPC_ECOLI      QQSILAGLVVVAIAGMIXXXXXXXXXXXXXXXXXXXXXXXXXXLSIPSLVLTMALAAALGPSLFNAMLAI
OPPC2_STAAR     RSXXXXXXXXXXXXXXXXXXXXXFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISI
SAPC_SHIFL      APTVGGAFVVTLAATICGLVLGTFAGATHGLRSAVLNHXXXXXXXXXXXXXXXXVVAFAGPSLSHAMFAV
SAPC_SALTY      APTVGGAFIVTLAATLCGLVLGVVAGATHGLRSAVLNHXXXXXXXXXXXXXXXXVVAFAGPHLSHAMFAV
SAPC_SALTI      APTVGGAFIVTLAATLCGLVLGVVAGATHGLRSAVLNHXXXXXXXXXXXXXXXXVVAFAGPHLSHAMFAV
SAPC_ECOLI      APTVGGAFVVTLAATICGLVLGTFAGATHGLRSAVLNHXXXXXXXXXXXXXXXXVVAFAGPSLSHAMFAV
SAPC_ECOL6      APTVGGAFVVTLAATICGLVLGTFAGATHGLRSAVLNHXXXXXXXXXXXXXXXXVVAFAGPSLSHAMFAV
OPPC_MYCGE      AKSLWXXXXXXXXXMVFGTIYGAVAGFVGHMADNIMSRIIEIIDIVPSILWIIVLGATFRFGGVKVIFTL
SAPC_HAEIN      RYTLGSALLVVFSVXXXXXXXXXXXXXXXXXXXRFVGHIFDAFLSLPILLIAVVISTLMEPAMFATLLAI
YEJB_ECOLI      --------------------------------------------------------------ITLPVLAT
YEJB_ECO57      --------------------------------------------------------------ITLPVLAT
Y209_BRUME      PVTISLALLAFAITIPVGIIMGVVAAYRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLRSLILPL
Y1050_BRUA2     PVTISLALLAFAITIPVGIIMGVVAAYRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLRSLILPL
Y1031_BRUAB     PVTISLALLAFAITIPVGIIMGVVAAYRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLRSLILPL
DPPB_BACSU      --------------------------------------------------------------------AL
TAUC_ECOLI      TRIMLALFAAVLFGIPVGIAMGLSPTVRG-----ILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLI
NIKB_ECOLI      -------------------------------------------------------------------VSI
Y1092_BRUSU     PVTISLALLAFAITIPVGIIMGVVAAYRDSWFDMGVMSLALLGVSVPSFWLAILAVILFSVTLRSLILPL
SAPB_SALTY      ------------------------------------------------------------------VLTL
SAPB_SALTI      ------------------------------------------------------------------VLTL
DPPB_BACPF      -------------------------------------------------------------------IAL
APPB_BACSU      ---------------------------------------------------------------------L
SAPB_ECOLI      ------------------------------------------------------------------VITL
SAPB_ECO57      ------------------------------------------------------------------VITL


                         .         .         .         +         .         .         .:280
query           AISSWTTMARMIRAETLSLKTQEYVLAARTLGESPTKIAWKHLVPNLSSIIIIQTMYTIPSAIFFEAFLS
OPPC_BACSU      TITGWINMARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPTAIFTEAFLS
DPPC_BACSU      TVTGWVGMARIVRGQVLQIKNYEYVLASKTFGAKTFRIIRKNLLPNTMGAIIVQMTLTVPAAIFAESFLS
APPC_BACSU      CLTGWTTTARLVRGEFLSLRSREYVLAAKTIGTKTHKIIFSHILPNALGPIIVSATLKVGSVILAESALS
GSID_SALTY      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_SALTI      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_SALPA      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_SALCH      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ERWCT      AIFSIPAFARLVRGNTLVLKQLTYIESARSMGANDWTILFRHILPGSVSSIVVFFSMRIGMSIITAASLS
NIKC_ECOLI      ALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMS
NIKC_ECO57      ALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMS
GSID_SHIFL      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_SHIF8      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
DPPC_HAEIN      AVVSIPSYVRLTRAAMMNEKNRDYVTSSKVAGAGILRLMFIVILPNCLAPLIVQMTMGISNAILELATLG
OPPC_SALTY      GMVSWLDMARIVRGQTLSLKRKEFIEAAQVGGVSTASIVIRHIVPNVLGVVVVYASLLVPSMIXXXXXXX
OPPC_ECOLI      GMVSWLDMARIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMIXXXXXXX
OPPC_ECO57      GMVSWLDMARIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMIXXXXXXX
Y4TQ_RHISN      AIPETPAVTXXXXXXXXXXXXXPYVEAALCGGARLPRVLWRHILPSTIPPLMVQSATVCASAIMTEAGLS
Y1313_MYCBO     AGFGWMISSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNVASXXXXXXXXXXXXXXXXETGLS
Y1282_MYCTU     AGFGWMISSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNVASXXXXXXXXXXXXXXXXETGLS
GSID_SHISS      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_SHIBS      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECOL6      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECOL5      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECO57      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECOLI      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECOUT      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
GSID_ECOK1      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLS
Y3407_BRUSU     ALLSWPVLSRMIRAXXXXXXXXXFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLS
GSID_SHIDS      AIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASLS
Y2550_BRUO2     ALLSWPVLSRMIRAXXXXXXXXXFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLS
Y3861_BRUME     ALLSWPVLSRMIRAXXXXXXXXXFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLS
Y3315_BRUA2     ALLSWPVLSRMIRAXXXXXXXXXFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLS
Y3094_BRUAB     ALLSWPVLSRMIRAXXXXXXXXXFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLS
DPPC_BACPF      AIVNVPIFGRLVRSKVISLREEEFIMAAKAQGMKNGRIIFHHILPNSLAPIIVQATLGFGTXXXXXXXXX
AMID_STRR6      SVTTWIGIAFMIRVQILRYRDLEYNLASRTLGTPTLKIVAKNIMPQLVSVIVTTMTQMLPSFISYEAFLS
AMID_STRPN      SVTTWIGIAFMIRVQILRYRDLEYNLASRTLGTPTLKIVAKNIMPQLVSVIVTTMTQMLPSFISYEAFLS
Y207_BRUME      TSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLS
Y1093_BRUSU     TSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLS
Y1051_BRUA2     TSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLS
Y1032_BRUAB     TSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLS
DPPC_ECOLI      TFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALG
DPPC_ECOL6      TFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALG
DPPC_ECO57      TFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALG
OPPC_HAEIN      XXXXXXXXXXXVRGQTLSLKNKEFVEAAIVCGVPRRQIILKHIIPNVLGLVAVYASLEVPXXXXXXXXXX
OPPC_LACLS      SIFSWIGTTRLIRARTMTEVNRDYVQASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLS
OPPC_LACLA      SIFSWIGTTRLIRARTMTEVNRDYVRASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLS
YEJE_ECOLI      VLFGWMSLVGVVRAEFLRTRNFDYIRAAQALGVSDRSIILRHMLPNAMVATLTFLPFILCSSITTLTSXX
OPPC_MYCPN      IFVFWTWPAATTRIYILKNKDTEYIQAARTLGAKQIRIIFVHMLPVVTGRLAVVFVSLIPAVIGYEASLV
OPPC2_STAAN     TVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAAM     TVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAAB     TIIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAAW     TLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAAS     TLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAAC     TLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAA8     TLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
OPPC2_STAA3     TLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
DDPC_ECOLI      AIVRIPFYVRLARGQALVVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQASLDIGSAILMAATLG
OPPC2_STAAR     TVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPIRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLS
SAPC_SHIFL      WLALLPRMVRSIYSMVHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALG
SAPC_SALTY      WLALLPRMVRSVYSMVHDELEKEYVIAARLDGATTLNILWFAILPNITAGLVTEITRALSMAILDIAALG
SAPC_SALTI      WLALLPRMVRSVYSMVHDELEKEYVIAARLDGATTLNILWFAILPNITAGLVTEITRALSMAILDIAALG
SAPC_ECOLI      WLALLPRMVRSIYSMVHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALG
SAPC_ECOL6      WLALLPRMVRSIYSMVHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALG
OPPC_MYCGE      IFVFWTWPATTTRIYILKNKDTEYIQAAKTLGAHQIRIIFVHMLPVVFGRLAVVFVSLIPAVIGYEASLV
SAPC_HAEIN      LPYFIHTIYRAIQKEL----EKDYVVMLKLEGISNQALLKSTILPNITVIYIQEVARAFVIAVLDISALS
YEJB_ECOLI      VIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFIEVMFS
YEJB_ECO57      VIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFIEVMFS
Y209_BRUME      ALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYLIGGSVVIEQIFA
Y1050_BRUA2     ALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYLIGGSVVIEQIFA
Y1031_BRUAB     ALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYLIGGSVVIEQIFA
DPPB_BACSU      AVGPMAIIARLTRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALRN-ALMPVITVLGTLVASILTGSFV-
TAUC_ECOLI      YLAIFAPVAMSALAGVKSVQ-QVRIRAAQSLGASRAQVLWFVILP-------------------------
NIKB_ECOLI      AFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMIMHIGELIGGTMIIENIFA
Y1092_BRUSU     ALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYLIGGSVVIEQIFA
SAPB_SALTY      SVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIFSTMLTL--AMITEMVFS
SAPB_SALTI      SVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIFSTMLTL--AMITEMVFS
DPPB_BACPF      GTIPMAIIARMTRSSMLEVLRSDYIRTVNAKGSGQGVVIYKHALKNVLTVVGLQTGNLLGGAILTETIFS
APPB_BACSU      ATADMAGLTRYTRSNMLDVLNQDYIRTARAKGFKENRVLFKHGLRNALLPVITIFGLMIPSSVVVEQIFT
SAPB_ECOLI      SVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIFSTMLTL--AMITEMVFS
SAPB_ECO57      SVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPPVIFSTMLTL--AMITEMVFS


                         .         *         .         .         .         .         +:350
query           FIGIGITAPETSLGVLLNEGQKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPKTRR
OPPC_BACSU      YLGLGVPAPLASWGTMASDGLPALTYYPWRLFFPAGFICITMFGFNVVGDGLRDALDPKLRK
DPPC_BACSU      FLGLGIQAPFASWGVMANDG------LPWRLFFPAFFISLTMYAFNVLGDGLQDALDPKLRR
APPC_BACSU      YLGFGIQPPIASWGNMLQDAQ-NFTVMIQAWWYPGLFILMTVLCFNFVGDGLRDALDPK---
GSID_SALTY      FLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_SALTI      FLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_SALPA      FLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_SALCH      FLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ERWCT      FLGLGAQPPMPEWGAMLNEARSDMVIAPHVAIFPSLAIFLTVLAFNLLGDGLRDALDPKLK-
NIKC_ECOLI      FLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALFISVMAFNLVGDALRDHLDP----
NIKC_ECO57      FLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALFISVMAFNLVGDALRDHLDP----
GSID_SHIFL      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_SHIF8      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
DPPC_HAEIN      FLGIGAKPPTPELGTMLSEARGFMQAANWLVTIPGLVILSLVLAFNLMGDGLRDALDPKLKQ
OPPC_SALTY      XXXXXTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPKDR-
OPPC_ECOLI      XXXXXTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPKDR-
OPPC_ECO57      XXXXXTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPKDR-
Y4TQ_RHISN      FIGVGVPSEIPSWGNMIANSRLFLAIAPLTIFAPGLCLAVTVLAVNLLGDGLRDMFDPRSKR
Y1313_MYCBO     FLGFGIQPPDVSLGTLIADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASR-
Y1282_MYCTU     FLGFGIQPPDVSLGTLIADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASR-
GSID_SHISS      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_SHIBS      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECOL6      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECOL5      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECO57      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECOLI      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECOUT      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
GSID_ECOK1      FLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPKIK-
Y3407_BRUSU     FLGLGVPPPAASWGNMLNAARSTLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPR---
GSID_SHIDS      FLGLGAQPPTPEWGAMLDEARADMVIAPHVAVFPVLAIFLTVLAFNLLGDGLRDALDPKIK-
Y2550_BRUO2     FLGLGVPPPAASWGNMLNAARSTLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPR---
Y3861_BRUME     FLGLGVPPPAASWSNMLNAARSTLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPR---
Y3315_BRUA2     FLGLGVPPPAASWSNMLNAARSTLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPR---
Y3094_BRUAB     FLGLGVPPPAASWSNMLNAARSTLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPR---
DPPC_BACPF      XXXXXXXXPMPEWGKMLSDSRQFIQSAPWTVLFPGFSIMLVVLGFNMIGDGLRDALDPKMK-
AMID_STRR6      FFGLGLPITVPSLGRLISDYSQNVTTNAYLFWIPXXXXXXXXXXXFVVGQNLADASDPRTHR
AMID_STRPN      FFGLGLPITVPSLGRLISDYSQNVTTNAYLFWIPXXXXXXXXXXXFVVGQNLADASDPRTHR
Y207_BRUME      FLGIGTPPPHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLK-
Y1093_BRUSU     FLGIGTPPPHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLK-
Y1051_BRUA2     FLGIGTPPPHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLK-
Y1032_BRUAB     FLGIGTPPPHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLK-
DPPC_ECOLI      FLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ
DPPC_ECOL6      FLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ
DPPC_ECO57      FLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ
OPPC_HAEIN      XXXXXTQEPMSSWGALLSDGAAQMEVSPWLLIXXXXXXXXXXXXXXXIGDGLRDALDPKDR-
OPPC_LACLS      FLGFGLPAGTPSLGTMINE-------------------------------------------
OPPC_LACLA      FLGFGLPAGTPSLGTMINE-------------------------------------------
YEJE_ECOLI      XXXXXXXXXXXXXXXXXXQGKNNLQ-APWLGITAFLSVAILLSLLIFIGEAVRDAFDP----
OPPC_MYCPN      FLGLK-PATEVGLGALLNQSSGNIALITSSI----VSFAILTVSTRVFANALNDAIDPRVIR
OPPC2_STAAN     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAAM     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAAB     FIGLGSQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAAW     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAAS     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAAC     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAA8     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
OPPC2_STAA3     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
DDPC_ECOLI      FIGLGAQQPSAEWGAMVANGR---NYVLDQWWYPGAAILLTAVGFNLFGDGIRDLLDPK---
OPPC2_STAAR     FIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRD--------
SAPC_SHIFL      FLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRA-------
SAPC_SALTY      FLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAITLSVLLVNLLGDGIRRA-------
SAPC_SALTI      FLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAITLSVLLVNLLGDGIRRA-------
SAPC_ECOLI      FLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRA-------
SAPC_ECOL6      FLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRA-------
OPPC_MYCGE      FLGLK-PATDIGLGALLNQSSDNVALILSSI----VSFAVLTVAARTFANALNDAIDPR---
SAPC_HAEIN      FISLGAQRPTPEWGAMIKDSLELLYLAPWTVLLPGFAXXXXXXXXXXXXNGLTKAIN-----
YEJB_ECOLI      LNGLGLLGYEATV-------------------------------------------------
YEJB_ECO57      LNGLGLLGYEATV-------------------------------------------------
Y209_BRUME      LPGLGRLLVQAILARDLPVVQGTMLFLGF-----------LFVAINVLVDILYTIADPRVR-
Y1050_BRUA2     LPGLGRLLVQAILARDLPVVQGTMLFLGF-----------LFVAINVLVDILYTIADPRVR-
Y1031_BRUAB     LPGLGRLLVQAILARDLPVVQGTMLFLGF-----------LFVAINVLVDILYTIADPRVR-
DPPB_BACSU      --------------------------------------------------------------
TAUC_ECOLI      --------------------------------------------------------------
NIKB_ECOLI      WPGVG----RYAVSAIFNRDYPVIQCF-------TLMMVVVFVVCNLIVDLLNAALDPRIRR
Y1092_BRUSU     LPGLGRLLVQAILARDLPVVQGTMLFLGF-----------LFVAINVLVDILYTIADPR---
SAPB_SALTY      WPGLG---------------------------------------------------------
SAPB_SALTI      WPGLG---------------------------------------------------------
DPPB_BACPF      WPGI---------------GRYIFEAINYRD-YPVIVVATIFVLINLFVDLLYSYIDPRIK-
APPB_BACSU      WPGLG----------------KLFVDSAFQRDYPVIISAVLVVVGNLIADILYAIVDPR---
SAPB_ECOLI      WPGLG---------------------------------------------------------
SAPB_ECO57      WPGLG---------------------------------------------------------