[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for lsal0:ABE00528.1

[Show Plain Result]


## Summary of Sequence Search
    1::463
    3::441     e-151  63%  454 aa  DNAC_BACSU RecName: Full=Replicative DNA helicase;       
   26::467     e-102  48%  471 aa  DNAB_SHIFL RecName: Full=Replicative DNA helicase;       
   26::467     e-102  48%  471 aa  DNAB_ECOLI RecName: Full=Replicative DNA helicase;       
   26::467     e-102  48%  471 aa  DNAB_ECOL6 RecName: Full=Replicative DNA helicase;       
   26::467     e-102  48%  471 aa  DNAB_ECO57 RecName: Full=Replicative DNA helicase;       
   17::455     e-101  44%  457 aa  DNAB_LEIXX RecName: Full=Replicative DNA helicase;       
   26::467     e-100  47%  471 aa  DNAB_SALTY RecName: Full=Replicative DNA helicase;       
   26::467     e-100  47%  471 aa  DNAB_SALTI RecName: Full=Replicative DNA helicase;       
   18::463     2e-97  44%  468 aa  DNAB_HAEIN RecName: Full=Replicative DNA helicase;       
   18::458     6e-97  43%  467 aa  DNAB_PASMU RecName: Full=Replicative DNA helicase;       
   22::458     2e-94  44%  465 aa  DNAB_BUCAP RecName: Full=Replicative DNA helicase;       
    9::454     5e-93  43%  459 aa  DNAB_BUCAI RecName: Full=Replicative DNA helicase;       
   20::456     9e-90  42%  463 aa  DNAB_BUCBP RecName: Full=Replicative DNA helicase;       
   12::394     7e-88  45%  879 aa  DNAB_ANASP RecName: Full=Replicative DNA helicase;       
   18::486     2e-85  40%  494 aa  DNAB_RICCN RecName: Full=Replicative DNA helicase;       
   27::486     3e-84  39%  494 aa  DNAB_RICFE RecName: Full=Replicative DNA helicase;       
   27::486     2e-83  39%  497 aa  DNAB_RICTY RecName: Full=Replicative DNA helicase;       
    6::478     6e-83  40%  486 aa  DNAB_RICPR RecName: Full=Replicative DNA helicase;       
    7::386     1e-82  40%  872 aa  DNAB_SYNY3 RecName: Full=Replicative DNA helicase;       
   24::408     9e-82  43%  874 aa  DNAB_MYCTU RecName: Full=Replicative DNA helicase;       
   24::408     9e-82  43%  874 aa  DNAB_MYCBO RecName: Full=Replicative DNA helicase;       
   15::433     1e-80  40%  438 aa  DNAB_TREPA RecName: Full=Replicative DNA helicase;       
   45::426     3e-79  47%  941 aa  DNAB_RHOMR RecName: Full=Replicative DNA helicase;       
   48::448     1e-77  41%  455 aa  DNAB_ODOSI RecName: Full=Probable replicative DNA helicase;        
   26::489     2e-76  38%  498 aa  DNAB_RICBR RecName: Full=Replicative DNA helicase;       
   11::467     5e-72  38%  486 aa  DNAB_HELPJ RecName: Full=Replicative DNA helicase;       
   11::467     1e-71  37%  488 aa  DNAB_HELPY RecName: Full=Replicative DNA helicase;       
    6::370     1e-56  33%  568 aa  DNAB_PORPU RecName: Full=Probable replicative DNA helicase;        
    3::424     2e-54  34%  458 aa  VG12_BPP22 RecName: Full=Replicative DNA helicase;       
    8::374     7e-53  33%  566 aa  DNAB_PORYE RecName: Full=Probable replicative DNA helicase;        
    8::392     7e-53  35%  599 aa  DNAB_GUITH RecName: Full=Probable replicative DNA helicase;        
   41::452     8e-52  34%  458 aa  GP1D_CHLPS RecName: Full=Probable plasmid replicative DNA helicase;
   14::455     1e-51  35%  468 aa  DNAB_MYCGE RecName: Full=Replicative DNA helicase;       
  338::575     2e-49  46%  576 aa  DNAB_MYCIT RecName: Full=Replicative DNA helicase;       
   25::238     1e-48  45%  604 aa  DNAB_MYCLE RecName: Full=Replicative DNA helicase;       
  176::462     1e-46  41%  473 aa  DNAB_MYCPN RecName: Full=Replicative DNA helicase;       
  150::447     4e-42  39%  451 aa  GP1D_CHLTR RecName: Full=Probable plasmid replicative DNA helicase;
  200::447     2e-37  39%  451 aa  GP1D_CHLMU RecName: Full=Probable plasmid replicative DNA helicase;
    3::423     3e-12  27%  504 aa  YORI_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
  269::504     6e-09  26%  566 aa  PRIM_BPT3 RecName: Full=DNA primase/helicase;         EC=2.7.7.-;
  261::505     5e-08  23%  566 aa  PRIM_BPT7 RecName: Full=DNA primase/helicase;         EC=2.7.7.-;
   50::206     9e-05  32%  444 aa  RADA_RICCN RecName: Full=DNA repair protein radA homolog;AltName:
  164::394     2e-04  25%  429 aa  K1C18_XENTR RecName: Full=Keratin, type I cytoskeletal 18;AltName:
  129::227     6e-04  27%  646 aa  ABCG4_HUMAN RecName: Full=ATP-binding cassette sub-family G member
    1::463

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNDIMTDNLPPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT
DNAC_BACSU      ---DLLNDRLPPQNIEAEQAVLGAIFLQPSALTLASEVLIPDDFYRMSHQKIYNAMLVLGDRGEPVDLVT
DNAB_SHIFL      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
DNAB_ECOLI      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
DNAB_ECOL6      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
DNAB_ECO57      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT
DNAB_LEIXX      ---DRSPERTPPHDLLAEQSALGGMLLSKDAVADVVEVVRGTDFYIPKHEIVYDAILSLYSHGEPTDVIT
DNAB_SALTY      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVAEDFYTRPHRHIFTEMGRLQESGSPIDLIT
DNAB_SALTI      ---------VPPHSIEAEQSVLGGLMLDNERWDDVAERVVAEDFYTRPHRHIFTEMGRLQESGSPIDLIT
DNAB_HAEIN      --------SIPPHSTEAEQAVLGGIMLSNQHWDGIAERVIADDFYTFQHRLIFTEMEHLMRNQSPIDLIT
DNAB_PASMU      ---------VPPHSLEAEQSVLGGILIHPAHWDSISDMLIADDFYLAAHRVIFQEMENLLRQGKPIDLIN
DNAB_BUCAP      ---------IPPHSLEAEQSVLGGLMLDNEQWDSVSEHVVADDFFSKPHRLIFQEMQQLLDLGHPIDLIT
DNAB_BUCAI      --NQINRLKIPPHSLEAEQSVLGGLMLDNEQWDSVSEHVVADDFFSKPHRLIFQEMQKLLDLGYPIDLIT
DNAB_BUCBP      -----------PNSLEAEQSILGGLMLDNEQWDYISEKISENDFFSLSHQLIFREMKYLLNKGYPIDLIT
DNAB_ANASP      ------SNRLPPQNIEAEEAILGGILLDPEAIGRVSEVLITEAFYISAHRDIYQAALRLHAQGKPTDLLS
DNAB_RICCN      -------DNLPPSNVQAEQMLLGAILTNNELLNYVSEFLRDEHFFEPIHQKIYKAIEKITEKGLTATPIT
DNAB_RICFE      -----------PSNVQAEQMLLGAILTNNELLSYVSEFLRSEHFFEPIHQKIYNAIEKITEKGLIATPIT
DNAB_RICTY      -----------PSNIQAEQMLLGAIITNNELLSYVSEFLRNEHFFEPIHQKIYDAIEKIIEKGLIATPIT
DNAB_RICPR      INND---DNLSPSNIQAEQMLLGAIITNNALLSYVSEFLRNEHFFEPIHQKIYDAIEKIIEKGLIATPIT
DNAB_SYNY3      ---------LPPQNIEAEECILGGILLDPEAMGRIIDLLVVDAFYVKAHRLIYEAMLSLHGQSQPTDLMS
DNAB_MYCTU      ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
DNAB_MYCBO      ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVT
DNAB_TREPA      ---------IPPHNLEAERAVLGAVLLDDSALSTATEQLSASSFYSAAHQRIFQALVELSDLGQRPDILV
DNAB_RHOMR      ---------VPPQAVELEQAVLGAMLIEPEAIPRALEILTPEAFYDGRHQRIFRAIVRLFEQNRGVDLLT
DNAB_ODOSI      -----------------------------------------DAFYFKNHREIYKAILIMYKKNTPIDIVT
DNAB_RICBR      -----------PSNVQAEQMLLGAILTNNELLNYVSEFLRSEHFFEPIHQKIYNGIEVITEKGLIATPIT
DNAB_HELPJ      ------------QNIE--RIVLSGIVLANHKIEEIHSVLEPSDFYYPPHGLFFEIALKLHEVNCPIDENF
DNAB_HELPY      ------------QNIE--RIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENF
DNAB_PORPU      ----------------------------SEDLLKQIEKLSPDFFYFKSNSLVYRAILETVNPIDKIALVS
VG12_BPP22      ------------QDIEASVXXXXXXXXXTPTASDVLATLEPEAFYRKAFEVIRKQARNRNLDGLMVAEEC
DNAB_PORYE      ------------------------------SLLKSVEKISPDFFYFTSTSLLYRAALENVNHAKTKSVRN
DNAB_GUITH      -------------NLKAEKHLIIQILVEKDFFLQIYTKIDTQVFYFQSHQILYRSINILHTKXXXXXXXT
GP1D_CHLPS      -------------------------------------------FKSENHKNIFLLIRDILRDRDTISISL
DNAB_MYCGE      -------------NIEAERRLMQAVAQNSEGIDLIFNKLEPIDFFATPFKLIFQTAKELNNPIEAVKFKL
DNAB_MYCIT      ----------------------------------------------------------------------
DNAB_MYCLE      ----------PPQDLAAEQSVLGGMLLSKDAIADVLERLRSGDFYRPAHQNVYDAILDLYGRGEPADAVT
DNAB_MYCPN      ----------------------------------------------------------------------
GP1D_CHLTR      ----------------------------------------------------------------------
GP1D_CHLMU      ----------------------------------------------------------------------
YORI_BACSU      ------------QDKQAIIQVLGSILKDPTILSESNKYITSDDFPSRFHSILFFAMSNLFHQGEVLNDVE
PRIM_BPT3       ----------------------------------------------------------------------
PRIM_BPT7       ----------------------------------------------------------------------
RADA_RICCN      ----------------------------------------------------------------------
K1C18_XENTR     ----------------------------------------------------------------------
ABCG4_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSL
DNAC_BACSU      VTSELANTDLLEEVGGISYLTDIANSVPTAANIEYYAKIVEEKSILRRLIRTATTIAQDGYTREDEVEDL
DNAB_SHIFL      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAPQGRTSED----L
DNAB_ECOLI      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAPQGRTSED----L
DNAB_ECOL6      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAPQGRTSED----L
DNAB_ECO57      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISSYADIVRERAVVREMISVANEIAPQGRTSED----L
DNAB_LEIXX      VTDELTKLGELSRAGGAEYLHTLTSLVPTAANAGYYANIVAEKALLRRLVEAGTRITQMGYKAEGEVLDL
DNAB_SALTY      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVRDMIAVAHEIADQGRNSDE----L
DNAB_SALTI      LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVRDMIAVAHEIADQGRNSDE----L
DNAB_HAEIN      LDQALRSRGVSDEVGGFAYLAELSNNTPNAINILAYADIVREKAILRELISVGNRIAENSYSPKQDIKLI
DNAB_PASMU      LYEFLREKNLSEDVGGFAYLAELSKNTPSVSNIVSYAAIVRDRAILRDLISVSNDVAQSCYTTKGEVKDI
DNAB_BUCAP      LSESLEQKGKLESVGRFSYLAELSKNTPSTANIIAYADIIRERAIVREMILVANKI---ANAGYDTQEEL
DNAB_BUCAI      LSESLEQKGKLESVGRFSYLAELSKNTPSTANITAYADIVRERAIVREMILVANKI---ANAGYDTQEEL
DNAB_BUCBP      LSESLEQKGKLEYIGRFAYLAELSKNVPSTANITTYADIVRERSMVRXXXXXXXXXXQAGYDPRGKTSQL
DNAB_ANASP      VTSWLTDNELLTRIGGRNKLATLVDRTVSAVNIDALAGLVMEKYLRRQLIKAGNEIVHLGYETEKELPIV
DNAB_RICCN      LRSMLTQDELFQEVEGAEYLAKLITMSMMVINPLDYGKIIYDLAIKRNLINIGEEVVNNAYNSSLEVEAK
DNAB_RICFE      LRSMLTQDELFQEIEGAEYLAKLITMSMMVINPVDYGKIIYDLAIKRNLINIGEEVVNDAYNSSLEIEAR
DNAB_RICTY      LRSMLTQDALFQEIEGVEYLAKLITMSMMVINPIDYGKIIYDLAIKRNLINIGEEVVNNAYNASLAVAAK
DNAB_RICPR      LRSMLTQDALFKEIEGEGYLAKLITMSMMVINPIDYGKIIYDLAIKRNLINIGEEVVNNAYNSSLAVAAK
DNAB_SYNY3      VSSWLQDHHHFEAIGGMVKLTQLLDRTISAVNIDRFAALIMDKYLRRQLIAAGHDIVDLGYETSKELETI
DNAB_MYCTU      VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQXXXXXXXXXXXX
DNAB_MYCBO      VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQXXXXXXXXXXXX
DNAB_TREPA      LSEHLRSCEALDFVGGSAYVASLTDAVPSAANVEYYTRIVCDAAMRRSLLKVARIITAEAFNDTVSGNIV
DNAB_RHOMR      VTEELRRTGELEQAGDTIYLSELTTRVASAANVEYHARIIAEK-LLRRMIEVMTLLVGRAYDPAADAFEL
DNAB_ODOSI      LNTFLQNQGLLPKIGGIKVLIELVNQLPNLVYLEEYIRIIQDKYVRRSLIKLGYEAINSGYITNISLEEI
DNAB_RICBR      LRSMLANDELFHEMEGAEYLAKLVTMSMMVINPIDYGKIIYDLAIKRYLINIGEEVVNDAYNSEFEAKEQ
DNAB_HELPJ      IRQKMPKDKQISEDDLVAIFAASPID-----NIEAYVEEIKNASIKRKLFTLANTIREQALESAQKSSDI
DNAB_HELPY      IRQKMPKDKQIKEEDLVAIFAASPID-----NIEAYVEEIKNASIKRKLFGLANTIREQALESAQKSSDI
DNAB_PORPU      LLTALNTNNLIRQLGRLETIMKLIENSPASNIIYEYSKVILDNYVKRLLLKSGDSLCLISCSKKQITQSV
VG12_BPP22      GDEYATA------------VMMTARSCPSAANLKGYAGMVADSYQRRQVLQLLDEMREPISNGTLDASGA
DNAB_PORYE      FFINLKNEKMIQDLNELNEVFSLIEQAPLSDTISEYSAVVIDNYIKRLLLACGDSLCLISCSKQLIEQKN
DNAB_GUITH      VINYLITLNDRDNF--------------RILNINDSLKVLLDNFIRRELQNSCAKIVSLTFNFNLSVETL
GP1D_CHLPS      IWEEIKRRN-LDKSMDVSYLIHMSQNADIPIDLDHHIDFLHEKNLLKEFLDSSFQDFTRYPNRRSPY-TL
DNAB_MYCGE      DANDQSTKSELEILFTKILLIRLP---PNQTEIKTLVDVVKKASIFRRLQQFAKRVYNEEFKLKED---R
DNAB_MYCIT      ----------------------------------------------------------------------
DNAB_MYCLE      VAAEXXXXXXXXXXXXAPYLHTLISTVPTAANAGYYAGIVAEKALLRRLVEAGTRVVXXXXXXXXXXXXX
DNAB_MYCPN      ----------------------------------------------------------------------
GP1D_CHLTR      ----------------------------------------------------------------------
GP1D_CHLMU      ----------------------------------------------------------------------
YORI_BACSU      IDGYLKDYDIFHDNKGLEYI-EKIQELAVVENFDYHYKRLKKFSLLRELIDPKEQEKMQEQFDKKSIDEI
PRIM_BPT3       ----------------------------------------------------------------------
PRIM_BPT7       ----------------------------------------------------------------------
RADA_RICCN      ----------------------------------------------------------------------
K1C18_XENTR     ----------------VKYEAEMAIRMSVEGDITGLRKLIDDTNVSREIESLKEELIFLKKNHQDDVTEL
ABCG4_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILA
DNAC_BACSU      LSEAEKTIMEVAQRKNTSAFQNIKDVLVQTYDNIEQLHNRKGDITGIPTGFTELDRMTAGFQRNDLIIVA
DNAB_SHIFL      LDLAESRVFKIAESRKDEGPKNIADVLDATVARIEQLFQQPHDVTGVNTGYDDLNKKTAGLQPSDLIIVA
DNAB_ECOLI      LDLAESRVFKIAESRKDEGPKNIADVLDATVARIEQLFQQPHDVTGVNTGYDDLNKKTAGLQPSDLIIVA
DNAB_ECOL6      LDLAESRVFKIAESRKDEGPKNIADVLDATVARIEQLFQQPHDVTGVNTGYDDLNKKTAGLQPSDLIIVA
DNAB_ECO57      LDLAESRVFKIAESRKDEGPKNIADVLDATVARIEQLFQQPHDVTGVNTGYDDLNKKTAGLQPSDLIIVA
DNAB_LEIXX      VNNAQAEIYSVTGTQEVEDYVPLTEAVTVAIDEIEASKHKDGSMTGVPTGFTELDELTNGLHPGQMIIVA
DNAB_SALTY      LDLAESRVFQIAENRANKGPKSIDQILDATVARIEQLFQQPHDVTGVDTGYQDLNKKTAGLQRSDLIIVA
DNAB_SALTI      LDLAESRVFQIAENRANKGPKSIDQILDATVARIEQLFQQPHDVTGVDTGYQDLNKKTAGLQRSDLIIVA
DNAB_HAEIN      LDEAEREVFAIAEKRTTSGPQNVINVLESTIEKIDILSENHSGVTGVTTGFTDLDKKTAGLQPSDLIIVA
DNAB_PASMU      LDEAERKVFAISEKRTTSGPQNICAILEKTIDRIELLSKTENGITGVSTGFDALDKKTAGLQPSDLIIVA
DNAB_BUCAP      LDYAESSVFKIAEKRFKSGPKNIEQILDETVTSIEKLFLSPNDVTGINTGYQDLNKKTSGLQPSELIIIA
DNAB_BUCAI      LDYAESSVFKIAEKRFKSGPKNVEQILDETVASIEKLFLSPHDVTGINTGYQDLNKKTSGLQRSELIIIA
DNAB_BUCBP      LNLAESKILSISEQQKNSGPKNIEELLDITLANIEKLNTPYKGITGINTGYQDLNNKTSGLQPSDLIIIA
DNAB_ANASP      LDQAEQKVFGVTQERPQSGLVHIADTLINNFQEIEERNQGIA-LPGIPCGFYDLDAMTSGFQRSDLIIVA
DNAB_RICCN      IEHAEAKLYDLSEGLNEKSFTKIGISISESLASINRAMKNNDHIIGISTGLIDLDNKLCGFHNSDLIILA
DNAB_RICFE      IEHAEAKLYDLSESLNEKSFTRIGIPISESLASINRAMKNNDHVIGISTGLLDLDNKLFGFHNSDLLILA
DNAB_RICTY      IEHAEAKLYDLAEGLNEKSFTQVGISIAESLASINKAMKNNDHVIGISTGLLDLDNKLFGFHNSDLIILA
DNAB_RICPR      IEYAEAKLYDLTEGLNEKSFTKVGISISESLASINRAMKNNDHVIGISTGLLDLDNKLFGFHNSDLIILA
DNAB_SYNY3      FDESEQKIFRLTQSRPQAGLVPLSETLVNTFIELDKLHEKLSS-PGVETQFYDLDAMTGGLQRADLIILA
DNAB_MYCTU      XXXAQAEIYDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMVIVA
DNAB_MYCBO      XXXAQAEIYDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMVIVA
DNAB_TREPA      LETAQREIYDLTNARRVATFKLLKNLIPDLVNTIETRYRNQSDLVGIATGLTALDNLTGGFQNSELIVIG
DNAB_RHOMR      LDEVEAEIFRLSDVHLRKAARSMNEVVKETLERLEAIHGRPGGITGVPSGFHQLDALTGGWQRGDLIIIA
DNAB_ODOSI      LISLEKQMFSLTEIKNQDVFSSV-DLFSQILLELKYKSSKPV-LAGLSSGFYDLDSLTQGFQKSDLIIIA
DNAB_RICBR      IERAESKLYDLSEGINEKSFTKXXXXXXXXXXXXNRAMKNNDHVIGISTGLIDLDSKLFGFHNSDLVILA
DNAB_HELPJ      LNAVEREVYALLNGSTIEGFRGIKEVLESTMNLITENQRKSLKVTGIPTGFVQLDNYTSGFNQGSLVILG
DNAB_HELPY      LGAVEREVYALLNGSTIEGFRNIKEVLESAMDLITENQRKSLEVTGIPTGFVQLDNYTSGFNKGSLVIIG
DNAB_PORPU      ITSVASQLTIAYEILEDEGTYTLAEIFASLLVSLDTKKKISIN-SGIFSGFWQLDLITNGFQKSDLIIIA
VG12_BPP22      MDELVKRLSSIRKPRNEVKPVRLGEIINDYTDTLDRRLRNGEESDTLKTGIEELDAITGGMNAEDLVIIA
DNAB_PORYE      ITSIVSQLTKAYEILDEKDTQTLATILANLLVHLDTRKKISIN-SSILSGFTELDSITQGFKKSDLIILA
DNAB_GUITH      LQKSNLLISNINTYNKKVSLKSISQLLLETILEIDKKTNRS---THVLTGFFDLDHILVGLQKSDLIIIA
GP1D_CHLPS      IDQFKERLDDIYEKTSSSGENGKASVIAQIRHRYDYRSRHKIDVDGLPTGYSSIDEHSIILSRGNFVVIA
DNAB_MYCGE      FEGYLQAIQDDFVKIIHSAFSNIDEIANQEEALIKKVHRGELIISGLSSGFLKLDQLTSGWKPGELIVIA
DNAB_MYCIT      ------------------------------------------------------------------LYLA
DNAB_MYCLE      XXRAQAEIYDVAECRLSENYVPLEDLLQPTMDDLDAIASNGGISRGAPTGFTELDEVTNGLHPGQMIIVA
DNAB_MYCPN      ------------------------EIVREEEELIPKVYRGELTVKGLKSGFYPLDQLTSGWKEGELIVVA
GP1D_CHLTR      LDSAIAKTFSIRSARGRS----IYDIFSQSIGVLARIKKQNSFFDAFPTGYKDIDDKGVILAKGNFVIIA
GP1D_CHLMU      ---------------------------------------------GLPTGYQDIDSKGVILANGNFVIIA
YORI_BACSU      LTAYEMKIVDIKEKFRTSGINELLDSFEES-PDIG-VPLNSEMLTSIFRGSRKRSSITGGGKTRNMVADA
PRIM_BPT3       -----------------------------SLKDRVKEAMTSEDAVGLLDGCQGLNDRTLGARGGEVVMVT
PRIM_BPT7       ----------------------IPDGVVSALSLRERIREHSEESVGLLSGCTGINDKTLGARGGEVIMVT
RADA_RICCN      --------------------------------DFDKLSGHVTEQLRIPTPIGEFNRVLGGLVLGSAILIG
K1C18_XENTR     QAQVARSAVTVEVDAPKS--QDLGKIMTELRAQYDGLAQKNRD--DVEKWYQKVDEHTVQVNLDTEALHS
ABCG4_HUMAN     -------------------------------------------VNGRPRELRTFRKMSCYIMQDDMLL--


                         .         .         .         +         .         .         .:280
query           ARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVA
DNAC_BACSU      ARPSVGKTAFALNIAQNVATKTDESVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGNLTEEDWGKLTMA
DNAB_SHIFL      ARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGT
DNAB_ECOLI      ARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGT
DNAB_ECOL6      ARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGT
DNAB_ECO57      ARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGT
DNAB_LEIXX      ARPALGKSTLALDFARAAAIKHDLPTIFFSLEMGRSEIAMRLLSAEATVPLQHMRKGTVDNRDWTTIAAT
DNAB_SALTY      ARPSMGKTTFAMNLCENAAMLQDKPVLIFSLEMPGEQIMMRMLASLSRVDQTRIRTGQLDDEDWARISGT
DNAB_SALTI      ARPSMGKTTFAMNLCENAAMLQDKPVLIFSLEMPGEQIMMRMLASLSRVDQTRIRTGQLDDEDWARISGT
DNAB_HAEIN      ARPSMGKTTFAMNLCENAAMASEKPVLVFSLEMPAEQIMMRMIASLARVDQTKIRTGQLDEIEWNKIASV
DNAB_PASMU      ARPSMGKTTFAMNLCENAALKSDKPVLVFSLEMPAEQIMMRSLASLSRVDQTKIRTGQLDQSDWSKIGST
DNAB_BUCAP      ARPSMGKTTFAMNLCENAAMLYDKPVLIFSLEMPGEQIMMRMLASLSRVNQARIRTGQLNDEDWSRMSGT
DNAB_BUCAI      ARPSMGKTTFAMNLCENAAMLYDKPVLIFSLEMPGEQIMMRMLASLSRVNQARIRTGQLNNEDWARISTX
DNAB_BUCBP      ARPSMGKTTFAMNICENIAMTYKKPVLIFSLEMSGEQIMMRMLSSLSRVNQEKLRTGQLNDEDWARISST
DNAB_ANASP      GRPSMGKTAFCLNLANNIAATMKLPVAVFSLEMSKEQLVQRLLASEAQIESGYLRSGRLSQTQWEPLSRA
DNAB_RICCN      GRPSMGKTAFAINLALNACNNMRLSVGFFSLEMSSEQLTTRLLSMCAEIDSTSLRTGILGEEKYNRLRKE
DNAB_RICFE      GRPSMGKTAFAINLALNACNNMRLSVGFFSLEMSSEQLTTRLLSMCAEIDSTSLRTGILGEEKYNRLRKE
DNAB_RICTY      GRPSMGKTAFAINLALNTCNNMRLSVGFFSLEMSSEQLTTRLLSLCAEIDSTSLRTGMLSEEKYNRLRKE
DNAB_RICPR      GRPSMGKTAFAINLALNTCNNMRLSVGFFSLEMSSEQLTTRLLSLCAEIDSTALRTGMLSEDKYNRLRKE
DNAB_SYNY3      GRPSMGKTAFGLGIAANIAKNQNLPVAIFSLEMSKEQLALRLVASESLIDSNRLRTGHFSQAEFEPLTAA
DNAB_MYCTU      ARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLXXXXXXXXXXXXWTRLARR
DNAB_MYCBO      ARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLXXXXXXXXXXXXWTRLARR
DNAB_TREPA      ARPSMGKTALAMTMASNIAIRQRIPTAFFSLEMSNLLLMQRLIAAESGVSATNLRKGLLQLSDFGRIQNA
DNAB_RHOMR      ARPSMGKTAFALS-CRNAALHPGTGVAIFSLEMGAEQLAQRLLTAEAASMPRRTRTGV----SWP----A
DNAB_ODOSI      GRPSMGKTAFCLNIATNIVKKYKLPILFFSLEMSKEQLAYRLLSAEALINPMRLRNGHLNKKDWLKLHRI
DNAB_RICBR      GRPAMGKTXXXXXIKNKRDNEEVQSVGFFSLEMSSEQLTTRLLSMSAGIDSTTLRTGMINEANYNRLRKE
DNAB_HELPJ      ARPSMGKTSLMMNMVLS-ALNDDRGVAVFSLEMSAEQLALRALSDLTSINMHDLESARLDDDQWENLAKC
DNAB_HELPY      ARPSMGKTSLMMNMVLS-ALNDDRGVAVFSLEMSAEQLALRALSDLTSINMHDLESGRLDDDQWENLAKC
DNAB_PORPU      GRPSMGKTAFAINITRHIIKTSQYYVILFSLEMSTEQLLRRILAQECHLNSQKIQSGQLTNVEWQRIVEE
VG12_BPP22      ARPGMGKTELALKIAEGVASGVRRGVLIFSMEMSAIQVVERGIAGAGMMSVSVLRNSRMDDEGWARVASG
DNAB_PORYE      GRPSMGKTAFAINITRYVINQKRSYVILFSLEMSTEQLLRRILAQECNLNGQKIQSGQLNNDEWQYVIQK
DNAB_GUITH      GRPSMGKTAFMLSLVRNVADIQSFPIVIFSLEMSSKQLIYRLISNETNIATSRLREGNISISEWEILNRA
GP1D_CHLPS      ARPAMGKTAFAIDIALNLVLEQGKAVGFISLEMSPNQIVERIISNLSETSCEQLKRGNFSRDVLSKIESI
DNAB_MYCGE      ARPGRGKTALLINFMASAAKQIDPKVLFFSLEMRNREIYQRHLMHESQTSYT-LTNRQRINNVFEELMEA
DNAB_MYCIT      SRAMVPNSTLGLDFLRSCSIKHRMASVIFSLEMSKSEIVMRLLSAEAKIKLADMRSGRMSDEDWTRLARR
DNAB_MYCLE      ARPGVGK-ALALD--------------IFSLEMSKSEIVMRLLSAEAKIKLADMRSGRMTDDDWTRLARR
DNAB_MYCPN      ARPGRGKTALLINFLQGAVNDSEKFLLFFSLEMRNREIYQRHLMLESQVNYT-LTSRQRLANVYDDLIKA
GP1D_CHLTR      ARPSIGKTALAIDMAINLAVTQQRRVGFLSLEMSAGQIVERIIANLTGISGEKLQRGDLSKEELFRVEEA
GP1D_CHLMU      ARPSIGKTXXXXXXXXXXXXHQRRRVGFLSLEMSAGQIVERIISNLTGVSGEKLQRGSLSEEEIFCIEEA
YORI_BACSU      CRLSATE-LYDPKKKEWVSNPWSESSTVISTEMMAEELQSLALAYISSVEEKKILRNTINEKEKQLVRKA
PRIM_BPT3       SGSGMGKSTFVRQQALAWGKRMGKRVGLAMLEESVEDTIQDMM----GLN-NKVRLRQSDEVK--KAIAE
PRIM_BPT7       SGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRSDSLKREIIENGKFDQWFDE
RADA_RICCN      GDPGIGKSTLLLQLA-------------------ASNFASKMNCGEESLDQIKLRAIRLNLTNYNTDILA
K1C18_XENTR     AKSSV----------------TDLRRTVQSLEIELESLRNQKASLEGTLHDTEAR-----------YAME
ABCG4_HUMAN     --PHL-TVLEAMMVSANLKLSEKQEVK--------KELVTEILTALGLMSCSHTRTALLSGGQRKRLAIA


                         .         *         .         .         .         .         +:350
query           MGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA
DNAC_BACSU      MGSLSNSGIYIDDTPGIRVSEIRAKCRRLKQESG-LGMILIDYLQLIQGSSKDNRQQEVSEISRELKSIA
DNAB_SHIFL      MGLLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRPALSDNRTLEIAEISRSLKALA
DNAB_ECOLI      MGLLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRPALSDNRTLEIAEISRSLKALA
DNAB_ECOL6      MGLLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRPALSDNRTLEIAEISRSLKALA
DNAB_ECO57      MGLLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRPALSDNRTLEIAEISRSLKALA
DNAB_LEIXX      RGRINDAPLYIDDSPNMTLVEIRAKCRRL-KQRVGLKMVIIDYLQLMSGKRVESRQQEVSEFSRALKLLA
DNAB_SALTY      MGLLEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMIDYLQLMRPSLSDNRTLEIAEISRSLKALA
DNAB_SALTI      MGLLEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMIDYLQLMRPSLSDNRTLEIAEISRSLKALA
DNAB_HAEIN      VGMFKQNNLFIDDSSGLTPTDVRSRARRVYRENGGLSMIMVDYLQLMRAAFSDNRTLEIAEISRSLKALA
DNAB_PASMU      MGLFANKNLYIDDSSGLTPTELRSRARRVYRENGGLSLIMVDYLQLMRAPGADNRTLEIAEISRSLKALA
DNAB_BUCAP      INVLKKKNIYIDDSSALTPSEVRSRARRIYRENKGLTLIMVDYLQLMRPSLSDNRTLEIAEISRTLKALA
DNAB_BUCAI      XXXXXXXXXYIDDSSALTPSEVRSRARRIYRENNGLTLIMVDYLQLMRPSLSENRTLEIAEISRTLKALA
DNAB_BUCBP      INLLKKKNMYIDDSSTLTPSEMRSRSRKIYRENNGLSLIMVDYLQLIKPSLIGNRTLEIAEISRMLKSLA
DNAB_ANASP      ISMLSEMPIFIDDTPNITVTQMRSQARRLQAEQGELGLIVIDYLQLMEGGG-DNRVQELSKITRSLKGLA
DNAB_RICCN      ANTLSELQFFIDDTPALSISAIRTRARRM-KRKHNLGILFIDYLQLIRGVSKENRVSEISEITQGLKAIA
DNAB_RICFE      ANTLSELQFFIDDTPALSISAIRTRARRM-KRKHNLGILFIDYLQLIRGVSKENRVSEISEITQGLKAIA
DNAB_RICTY      ANTLSELQFFIDDTPALSISAIRTRARRM-KRKHNLGILFIDYLQLIRGVSKENRVNEISEITQGLKAIA
DNAB_RICPR      ANTLSELQFFIDDTPALSISAIRTRARRM-KRKHNLGILFIDYLQLIRGVSKENRVNEISEITQGLKAIA
DNAB_SYNY3      MGTLSSLPIYIDDTASISVTQMRSQVRRLSEQKGPLGMVLIDYLQLMEGGS-DNRVQELSKITRSLKGLA
DNAB_MYCTU      MSEISEAPLFIDDSPNLTMMEIRAKARRL-RQKANLKLIVVDYLQLMTSGKKESRQVEVSEFSRHLKLLA
DNAB_MYCBO      MSEISEAPLFIDDSPNLTMMEIRAKARRL-RQKANLKLIVVDYLQLMTSGKKESRQVEVSEFSRHLKLLA
DNAB_TREPA      AGEMYDAPLYIVDVPNMKLLDLRAVARRLCVQE-KIQIIFVDYLGLIVADNPAPRYEQFAAISQSLKSLA
DNAB_RHOMR      RRPLSDAPIFIDDTPSLGVLELRAKCRRL-KAEHDIGLVIVDYLQLMQASHNANREQEIAQISRSLKALA
DNAB_ODOSI      IKNLSSLPFFIDDTPNLSIQAIRSKVKKLLFEQNTIGLVVIDYLQLMQSSTLKSRVQELSQITRSLKNIA
DNAB_RICBR      AIALSELSFFIDDTPALTISAIRTRARRM-KRKHNLGILFVDYLQLIRGVSKDNRVNEVSEITQGLKAIA
DNAB_HELPJ      FDHLSQKKLFFYDKSYVRMDQIRLQLRKLKSQHKELGIAFIDYLQLMSGNKAKERHEQIAEISRELKTLA
DNAB_HELPY      FDHLSQKKLFFYDKSYVRIEQIRLQLRKLKSQHKELGIAFIDYLQLMSGSKAKERHEQIAEISRELKTLA
DNAB_PORPU      SKILANLNFYIDDSAEISCDIIKVKVKLLRLQGKKIKLIIIDYLQLLQESKKENRSQELSLITRSLKILA
VG12_BPP22      MKLLAELDVWVVDASRLSVEEIRSISERHKQEHPNLSLIMADYLGLIEKPKAERNDLAIAHISGSLKAMA
DNAB_PORYE      SKTLANLNLYIDDSAKISTDTIKTKVKFFKLQGKNIELIIIDYLQLLQESRQDNRSQELSLITRSLKILA
DNAB_GUITH      MTILSNLNIYLDDENNLDVLDIQSKLASLQQIYGDIGLIVIDYLQLLQYKEKSSRHIELSYITRYLKLIA
GP1D_CHLPS      GTKLKGTHFFICDNKSTDLNTLIDQARELRENQG-IDALFIDYLQLIGSSKKENRQNEIAEISRQLRKLA
DNAB_MYCGE      SSRIKNLPIKLFDYSSLTLQEIRNQITEVSKTS-NVRLVIIDYLQLVNALKNNTRQQEVTMISQSLKAFA
DNAB_MYCIT      MSEISEAPLYIDDSPNLTMMEIRAKARRL-RQKADLRLVVVDYLQLMSSGKKESRQLEVSEFSRQLKLLA
DNAB_MYCLE      MSEISEAPLYIDDSPNLTMMEIRAKARRL-RQKTNLKLVVVDYLQLMSGKRFESRQVEVSEFSRHLKLLA
DNAB_MYCPN      SEVLRDLPIKIFDYSTITLDEIRAQITEVSKTN-NVKLVVIDYLQLVKNSYNISRQQEVTMISKSLKSFA
GP1D_CHLTR      GETVRESHFYICSDSQYKLNLIANQIRLLRKED-RVDVIFIDYLQLINSSVGENRQNEIADISRTLRGLA
GP1D_CHLMU      GNTIRDSHLYICSDNQYKLNLI-ANQIRLLKRDDRVDVIFIDYLQLINSSVGENRQNEIADISRTLRGLA
YORI_BACSU      AKVLQESNIWFEHLPDFNIQEIE---RTIEKNKNNVEYVYFDYIEMSKKSGVNLREDQILLLSDKLKGLC
PRIM_BPT3       DGRFDEDELFGDDTDSFAEAEADRLLAKLAYMRTGLGVIVLDHISIVVSASEESDERKIDRLMTKLKGFA
PRIM_BPT7       L--FGNDTFHLYDS--FAEAETDRLLAKLAYMRSGLGVIILDHISIVVSASGESDERKIDNLMTKLKGFA
RADA_RICCN      ATNLENI-----------IASIEAN-------KNNIDLIVIDSIQTITTKELSSPPGTVSQIANELVNYA
K1C18_XENTR     LEMLGGTAMAME----AELVQVRSDCQRQQQEKMKLEAEIHTYRRLLEGDGSFDLQDAV-----------
ABCG4_HUMAN     LELVNNPPVMFFDEP-------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLN
DNAC_BACSU      RELQVPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYY--------------DXXX
DNAB_SHIFL      KELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_ECOLI      KELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_ECOL6      KELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_ECO57      KELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_LEIXX      KELQVPVIALSQLNRGPEQRADKLPALSDLRESGSIEQDADVVVLLHRESAYEKD--------------N
DNAB_SALTY      KELQVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_SALTI      KELQVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEYHENSDLK------------
DNAB_HAEIN      KELQVPVVALSQLNRTLEQRGDKRPVNSDLRESGSIEQDADLIMFIYRDEVY--------------NDNS
DNAB_PASMU      KELEVPVIALSQLNRTLENRADKRPVNSDLRESGSIEQDADLIMFIYRDEVYNEN--------------S
DNAB_BUCAP      KELQVPVIALSQLNRSLEQRSDKRPVNSDLRESGSLEQDADLIMFIYRDEYHENSDFK------------
DNAB_BUCAI      KELQVPVIALSQLNRSLEQRSDKRPVNSDLRESGSLEQDADLIMFIYRDEIYNE---------------N
DNAB_BUCBP      KELKIPIIALSQLNRSLEQRRDKRPINSDLRESGSLEQDADLIMFIYRDEYHEHTDLK------------
DNAB_ANASP      RELSVPVIALSQLSRGVEARTNKRPMLSDLRESGCLTGDS------------------------------
DNAB_RICCN      KELNIPVIALSQLSRAVELREDKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAAGDAKHADKLN
DNAB_RICFE      KELNIPVIALSQLSRAVELREDKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAAGDAKHADKLN
DNAB_RICTY      KELNIPVIALSQLSRAVELREDKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAAGDAKHADKLN
DNAB_RICPR      KELNIPVIALSQLSRAVELREDKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPVAGDAKHADKLN
DNAB_SYNY3      REINAPVIALSQLSRAVESRTNKRPMMSDLRESGCISGDS------------------------------
DNAB_MYCTU      KELEVPVVAISQLNRGPEQRTDKKPMLADLRESGCLTASTRIL---------------------------
DNAB_MYCBO      KELEVPVVAISQLNRGPEQRTDKKPMLADLRESGCLTASTRIL---------------------------
DNAB_TREPA      RELDIPIVALSQVGRPAE---GSAPNLADIRGSGAIEQDADVVMFLHRD----RNET-------------
DNAB_RHOMR      KELNVPVVALSQLSRAVETRGDKRPQLSDLRESGCLAGD-------------------------------
DNAB_ODOSI      REFNVPVIALSQLSRNVENRIIKRPILSDLRESGSIEQDADLVLMLYRDQYY-----NSNNENDEQLDI-
DNAB_RICBR      KELNIPVIALSQLSRAVELREDKRPMLSDLRESGSIEQDADIVMFIYREEYYSRKEKHAEKYAEWQDNMS
DNAB_HELPJ      RELEIPIIALVQLNRSLENRDDKRPILSDIKDSGGIEQDADIVLFLYRGYIYQKKEGKVEEAQELHLKVN
DNAB_HELPY      RELEIPIIALVQLNRSLENRDDKRPILSDIKDSGGIEQDADIVLFLYRGYIYQKKEGKIEEAQELYLKVN
DNAB_PORPU      RELNLPILVLSQLNRNLESRHNKRPLLSDLRESGCISKFSHIM---------------------------
VG12_BPP22      KDLKTPVISLSQLSRDVEKRPNKRPTNADLRDSGSIEQDADSIIMLYREAVYDENSSAAP----------
DNAB_PORYE      KDLSLPILALSQLNRNLETRSDKRPLLSDLRESGCISKFNYLQTSLY-----------------------
DNAB_GUITH      KDFNLPLVVLSQLSRNVEFRLNKRPILSDLKESGCLSYATNQPYFLKSDN--------------------
GP1D_CHLPS      VELQIPVVCLSQLSRKVEDRGDKRPMLSDLRDSGQIEQDADVILFLHRKDYYSQEATK------------
DNAB_MYCGE      KEFNTPIIAAAQLSRRIEERKDSRPILSDLRESGSIEQDADMVLFIHR----------TNDDKKEQEEEN
DNAB_MYCIT      KELEVPVVAISQLNRGPEQRTDKKPMLSDLRESGSLEQDADMVILLNRPDAFERDDPRG-----------
DNAB_MYCLE      KELELPVVAISQLNRSPEQRTDKKPMLSDLRESGSLEQDADVVILLHRPDAFDRDDPRG-----------
DNAB_MYCPN      KEFNVPIIAAAQLSRRIEERKDSRPILSDLRESGSIEQDADMVLFIHR---------VKDEDSENQEAIH
GP1D_CHLTR      SELNIPIVCLSQLSRKVEDRANKVPMLSDLRDSGQIEQDADVILFI------NRKESSS-----------
GP1D_CHLMU      AELNIPIVCLSQLSRKVEDRANKVPMLSDLRDSGQIEQDADVILFINR---------------------K
YORI_BACSU      NKYDVYMMSATQLNGDWKEAWLKGQVISYLRGSKAIADKTD-----------------------------
PRIM_BPT3       KSTGVVLVVICHLKKGKAHEEGRAVSITDLRGSGALRQLSDTIIALERN---------------------
PRIM_BPT7       KSTGVVLVVICHLKNPDKGKEEGRPVITDLRGSGALRQLSDTIIALERN---------------------
RADA_RICCN      KQNNIIIL--------------------------------------------------------------
K1C18_XENTR     ----------------------------------------------------------------------
ABCG4_HUMAN     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQExxx
DNAC_BACSU      XXXXXXXXXXAKQRNGPVGTVSLAFVKEYNKFVNL--------
DNAB_SHIFL      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_ECOLI      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_ECOL6      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_ECO57      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_LEIXX      PRAGEADLIVAKHRNGPTKTVKVAFQGMYSRFADMA-------
DNAB_SALTY      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_SALTI      ---GIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQ----
DNAB_HAEIN      EDKGVAEIIIGKQRNGPIGRVRLKFNGQFSRFDNLAEQRE---
DNAB_PASMU      EDKGVAEIIIGKQRNGPIGRVRLAFRGQFSRFDNLA-------
DNAB_BUCAP      ---GVAEIIIGKQRNGPIGTICLTFNGHWSRFDN---------
DNAB_BUCAI      SDLGIAEIIIGKQRNGPIGTVRLTFNGHWSRFDNYS-------
DNAB_BUCBP      ---GIAEIIIGKQRNGPIGTIKLTFNGHWSRFDNYS-------
DNAB_ANASP      -------------------------------------------
DNAB_RICCN      KVYNIADIIVAKHRNGPVGNVPLYYDSQFSKFGNL--------
DNAB_RICFE      KVYNIADIIVAKHRNGPVGNVPLYYDSQFSKFGNL--------
DNAB_RICTY      KVYNIADIIIAKHRNGPVGNISLYYDSQFSKFGNL--------
DNAB_RICPR      KVYNIADIIIAKHRNGPVGNVSLYYDSQFSKFGNL--------
DNAB_SYNY3      -------------------------------------------
DNAB_MYCTU      -------------------------------------------
DNAB_MYCBO      -------------------------------------------
DNAB_TREPA      ----ETQLILAKQRNGPIGTVELEFQASFTRF-----------
DNAB_RHOMR      -------------------------------------------
DNAB_ODOSI      -----TELILAKQRNGPIGTIQLKFDANYTKF-----------
DNAB_RICBR      KAHNITDIIIAKHRSGPVGNVQLFYDSQYSKFVNL--------
DNAB_HELPJ      EEIEEAEIIVAKNRNGATGTVYTRFNAPFTRYEDM--------
DNAB_HELPY      EEIEEAEIIVAKNRNGATGTVYTRFNAPFTRYEDM--------
DNAB_PORPU      -------------------------------------------
VG12_BPP22      ----FAEIIVTKNRFGSLGTV-------YQRFCN---------
DNAB_PORYE      -------------------------------------------
DNAB_GUITH      -------------------------------------------
GP1D_CHLPS      ---GLSEIIVGKNRHGSVFSTTLRFNSCTGKFT----------
DNAB_MYCGE      TNLFEVELILEKNRNGPNGKVKLNFRSDTSSF-----------
DNAB_MYCIT      ---GEADFILAKHRNGPTKTVTVAHQLHLSRFANMA-------
DNAB_MYCLE      ---GEADLILAKHRNGPTKTVTVAHQLHLSRFTNMA-------
DNAB_MYCPN      NNIFQVELILEKNRSGPTGKVQFDFQSDVSTF-----------
GP1D_CHLTR      ----NCEITVGKNRHGSVFSSVLHFDPKISKFSAI--------
GP1D_CHLMU      ETSPNCEITVGKNRHGSVFSTVLQFDPKTSKFSAI--------
YORI_BACSU      -------------------------------------------
PRIM_BPT3       -------------------------------------------
PRIM_BPT7       -------------------------------------------
RADA_RICCN      -------------------------------------------
K1C18_XENTR     -------------------------------------------
ABCG4_HUMAN     -------------------------------------------