[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD98850.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "3d19B.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "3d19D.bssp"
#ERROR : Can't open dsspfile "3d19C.bssp"
#ERROR : Can't open dsspfile "1ddzA.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "1djpA.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "1b93B.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "1e9yA.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "3bwnE.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "1bw9A.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3d46A.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "1c1xA.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1c1dA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "1bxgA.bssp"
#ERROR : Can't open dsspfile "3boxA.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"

## Summary of PDB Search
:380
    e-119  48%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-78  47%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-77  47%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    6e-59  27%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    6e-59  32%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    1e-54  43%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    2e-51  36%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    2e-45  25%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    9e-45  24%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    5e-44  12%  3d19B  [x.x.x] CONSERVED METALLOPROTEIN
    6e-44  42%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    8e-44  12%  3d19D  [x.x.x] CONSERVED METALLOPROTEIN
    1e-43  13%  3d19C  [x.x.x] CONSERVED METALLOPROTEIN
    8e-43  13%  1ddzA  [c.53.2 - c.53.2] CARBONIC ANHYDRASE
    1e-42  38%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    8e-41  37%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    2e-36  10%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-35   8%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    3e-35  10%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    4e-35  12%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    1e-34  12%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    6e-33  10%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    8e-33   8%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-32  11%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    5e-32  12%  3e9kA  [x.x.x] KYNURENINASE
    2e-31  11%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-31  11%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-31  10%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    5e-31  11%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    5e-31  11%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-30  11%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    3e-30  10%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    1e-29  11%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-29  10%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    7e-29  10%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    8e-29  14%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    9e-29  14%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    1e-28  11%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-28  12%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    1e-28  11%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    2e-28  11%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-28   8%  1ax4A  [c.67.1] TRYPTOPHANASE
    6e-28  10%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    8e-28   8%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    1e-27   9%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    3e-27  11%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-27   9%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-27   8%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    7e-27   9%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    7e-27  12%  1ecxA  [c.67.1] AMINOTRANSFERASE
    7e-27  11%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-26   9%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    2e-26  11%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-26  11%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-26   8%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-25  10%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-25  12%  1ecxB  [c.67.1] AMINOTRANSFERASE
    2e-25  11%  1eg5B  [c.67.1] AMINOTRANSFERASE
    2e-25  11%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    5e-25   8%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    1e-24  12%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-24  12%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    5e-24   9%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    7e-24  11%  2c44B  [x.x.x] TRYPTOPHANASE
    1e-23  14%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    4e-23   8%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    8e-23  10%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-22  12%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    1e-22   9%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    1e-22  11%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-22  11%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-22  12%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-22  10%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    5e-22  11%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    7e-22  12%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    3e-21  13%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    4e-21  10%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-20   9%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    1e-20   8%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-20  10%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    6e-20  10%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    6e-20  11%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-19   9%  1djpA  [c.88.1] GLUTAMINASE-ASPARAGINASE
    3e-19  12%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    5e-19   8%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    3e-18  13%  2c44A  [x.x.x] TRYPTOPHANASE
    5e-18  12%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    7e-18  11%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-17   9%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-17   8%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-17   9%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-16  10%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-16  11%  1eg5A  [c.67.1] AMINOTRANSFERASE
    2e-16   9%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-16  13%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    7e-16  10%  2c44C  [x.x.x] TRYPTOPHANASE
    1e-15  11%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    3e-15  11%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    1e-14  13%  1b93B  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
    1e-14  10%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    1e-14  11%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-14  13%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-14   9%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    4e-14  12%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-13  15%  1e9yA  [d.8.1 - b.85.3] UREASE ALPHA SUBUNIT
    6e-13   8%  2btwA  [x.x.x] ALR0975 PROTEIN
    2e-12  11%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-12  12%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-12  14%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    3e-12  13%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-10  12%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-10  18%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-10  12%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    7e-10   9%  2btwB  [x.x.x] ALR0975 PROTEIN
    8e-10   9%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-10   9%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    1e-09  14%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-09  12%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-08  12%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    1e-08  11%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-08  13%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    2e-08  11%  3bwnE  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    2e-08  13%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-08  14%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    7e-08   7%  1bw9A  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    8e-08  12%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    9e-08  12%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-07  15%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-07   4%  3d46A  [x.x.x] PUTATIVE GALACTONATE DEHYDRATASE
    4e-07  14%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    6e-07  13%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    1e-06   7%  1c1xA  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
    1e-06  12%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-06  17%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    3e-06  14%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    3e-06  10%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-06   8%  1c1dA  [c.58.1 - c.2.1] L-PHENYLALANINE DEHYDROGENASE
    1e-05  10%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-05  14%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    1e-05  15%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    1e-05  12%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    1e-05  12%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-05   8%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-05  10%  1c8nA  [b.121.4] COAT PROTEIN
    4e-05  15%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-05  11%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    6e-05  15%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-04  11%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-04  16%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-04  10%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-04   8%  1bxgA  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    7e-04   4%  3boxA  [x.x.x] L-RHAMNONATE DEHYDRATASE
    8e-04  12%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
:380

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFETKLIHGGQSEDQATGAVSISVYRSSTFHQYELGGNPKWEYSRTGNPTRAALEALIADLEGGVXXXX
3e6gA           LSLATLAIHGGQSPDPSTGAVMPPIYATSTYA-----------QSSTHNPTRFAYERCVAALEGGTRAFA
3e6gB           -------------------------------------------HGGTHNPTRFAYERCVAALEGGTRAFA
3e6gD           -----------------------------------------LAIHGTHNPTRFAYERCVAALEGGTRAFA
2cb1A           MEYTTLAVLAGLPEDP-HGAVGLPIYAVAAYGFKTLATGEGYVYARQKDPTAKALEERLKALEGALEAVV
2ctzA           MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYVFKSPLKEFGNIYSRIMNPTVDVLEKRLAALEGGAALAT
3cogD           -HFATQAIHVGQDPEQWTRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
1cs1A           -KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGAGAVL
1cl1B           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
1cl1A           -KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVL
3d19B           ----------------------------------------------------------------------
3cogB           -HFATQAIHVGQPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLA
3d19D           ----------------------------------------------------------------------
3d19C           ----------------------------------------------------------------------
1ddzA           LEKKFIELEAKLVAQPAGQAMPGKSNIFANNEAWRLANGQSPEYLWIGCADSRVPANQLLDLPAGQCIHS
1e5eB           MTPATACIHANPQKDQ-FGAAIPPIYQTSTFVNRFAGQESGYIYTRLGNPTVSNLEGKIAFLEKTEACVA
1e5eA           MTPATACIHANPQKDQTSTFVFDNCQQGGNRFAGQESGYI---YTRLGNPTVSNLEGKIAFLEKTEACVA
3bwnD           -----FVVNLDHGDTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAA
3d19A           -------------------------------------------VTSVMFVERSLNEIRFWSRIMK-----
2c7tA           --------------------------------VFQSNRWAISGYWTGEESMERKFAKAFADFNGVPYCVP
3d19E           --------------------------------------------------ERSLNEIRFWSRIMK-----
2dgmE           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
3bwnA           IPMSDFVVNLDHGDTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAA
2c81A           -------------------------------------------YWTGEESMERKFAKAFADFNGVPYCVP
3ecdC           -----------------------------------QGSVLTNKYAEGYDEVEALAIERVKRLFNAGHANV
3e9kA           ----------------SLGLQPKMVKTYLEEELDKWAKIAAEVGKRPWITGDESIVGLMKDIVGALMNAL
2dgkA           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
2dgmB           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
1ejiA           -NRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYIDELELCQKRALQAYHLDPQCWGVNVQ
3bcxA           -------------------------------------------GWLTTGRFNDAFEKKLGEYLGVTTTSG
3ecdD           -----------------RQQSQVELIASENISRAVLDAQGSVLTNKYADEVEALAIERVKRLFNAGHANV
1b9hA           -------------------------------------------WWRMGGDEVNSFEREFAAHHGAAHALA
3ecdA           -------ILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGADEVEALAIERVKRLFNAGHANV
2dgkC           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
3bcxB           -ELVAQYAETAMAPKPFEAGKSVVPPSGKVIGTKELQLEASLDGWLTTGRFNDAFEKKLGEYLGSSANLL
3dr7B           ----------------------------------ECMDTT---WISSVGRFIVEFEKAFADYCGVKHAIA
3caiA           ----------------------------------RSGASTVGAHPS-ARRSAAVLDAAVADLVNALGADR
3b8xB           -------------------------------------------KMFTMGEYVKQYETQFAKTFGSKYAVM
2dgmA           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
3b8xA           -------------------------------------------KMFTMGEYVKQYETQFAKTFGSKYAVM
1c0nA           --FSVDAVRADFPVLSREVNGLPLAYLDSAASAQHGYAAVAHTLSAQATEKMENVRKRASLFINARSAEE
3ecdB           ------------------------------------VLTNKYAEGYADEVEALAIERVKRLFNAGHANVQ
1ax4A           -------------------------------------------EAYAGSRNYYDLKDKAKELFNYPAHQG
2ch2A           -------------------------------------------FHAELFRTMDEVKDGLRYIFQTTMCVS
3bb8A           -ELVAQYAETAMAPKPFEAGKSVVPPSGKVIGTLQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVTTTSG
3bn1C           -------------------------------------------WISSVGRFIVEFEKAFADYCGVKHAIA
2dgmC           ----------------------------------------NMVADLWHAPAPKNGQAVGTNTIGSSEACM
3dr4D           ----------------------------------ECMDTT---WISSVGRFIVEFEKAFADYCGVKHAIA
3dr4B           ----------------------------------ECMDTT---WISSVGRFIVEFEKAFADYCGVKHAIA
2ch1A           -----KFTPPASLRNPLIIPEKIMMGPGPSNTNTVLSN-----FHAELFRTMDEVKDGLRYIFQTTMCVS
1ecxA           -------------------------------------PNSAHGMGIEANLHMEKAREKVAKVLGVFTSCA
1b9iA           -------------------------------------------WWRMGGDEVNSFEREFAAHHGAAHALA
3bn1D           ----------------------------------ECMDTT---WISSVGRFIVEFEKAFADYCGVKHAIA
3bwnB           ------------------------------------LMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAA
3bcaA           --------LGNCGVGEREGRVASALVARRHYRFIHGIGQPKAAGSSLLNKITNSLVLNVIKLAGVVPMAT
1b8gB           -------------------------------FAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFNHLVL
3bwnF           --------------TAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAA
1ecxB           -------------------------------------PNSAHGMGIEANLHMEKAREKVAKVLGVFTSCA
1eg5B           --------------------------------YREKYGNPNSAHGGIEANLHEKAREKVAKVLGVSPSEI
1c4kA           ----------------PAGREFYDFFGETVFRADLCNADVALGDLLIHEGPAVAAEKHAARVYNATYFVL
1c7gA           -------------------------------------------EAYAGSENFYHLEKTVKELFGFKHIVP
3bc8A           -------FLGNCGVGEREGRVASALVARRHYRFIHIGRQPKAAGSSLLNKITNSLVLNVIKLAGVVPMAT
2dr1A           -----------------------------------MFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVP
2a7vA           -------------------------------------------RGLELIASENFCSRAALEALGKYSEGV
2c44B           ----------------------------------------RGDEAYSGSRSYYALAESVKNIFGYGAEQI
2aeuA           LRLEKARKIILE---ILNEKGRDALYDLSGLSGDEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDDKCVG
1bj4A           -------LELIASENFASRAVLEALGSLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCW
3dr4A           ----------------------------------ECMDTT---WISSVGRFIVEFEKAFADYCGVAIACN
3b46A           ----------------------------------------------------------------------
2e7jA           ------------------------------------------QALLEWPPIHDFIHNQLPKFLGCDVARV
2dr1B           -----------------------------------MFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVP
2bwnD           -----------------------------------------TRNISGTTAYHRRLEAEIAGLHQKEAALV
3bcbA           --MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGAVQPKAAGSSLLNKITNSLVLNVIKLAGVVVPMA
3dc1D           -------------------------------------------LKQLQIKLHNPPTIHYPPSQGQMDLCV
3bwoA           -------------------------------------------MTNLCWFLEPELEDAIKDLHGVVGNAA
2dkjA           -------------------------------------GARYYGGCEVIDRVESLAIERAKALFGAANVQP
3bn1A           -------------------------------------------WISSVGRFIVEFEKAFADYCGVAIACN
3bwoC           -----FVVNLDHGDTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAA
2cy8A           -----------------------------------------VQYAASHPLEVRWAERIVAAFPSIRKLRF
1b8gA           --------GLAENQLCFDLLESWLAKNPEAAFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHL
2bkwA           ------------------------------------------EFVSIFQRVLKNTRAVFKSAAASLAGSG
2bwnB           -----------------------------------------TRNISGTTAYHRRLEAEIAGLHQKEAALV
2bwnA           -------------------------------------GSGGTRNISGTTAYHRRLEAEIAGLHQKEAALV
1djpA           -DVDGIVITHGTDTLEETAYVVVGSMRPGTLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINI
3b46B           ----------------------------------------------------------------------
2cfbA           -------------------------------------LEKGTSFGAPCLLENILAEMVIAAVPSVEMVRF
2c44A           ----------------------------------------------------------------------
3dr4C           -------------------------------------------WISSVGRFIVEFEKAFADYCGVKHAIA
2bwoA           ------------------------VLAAMHEALEAVGAGSGTRNISGTTAYHRRLEAEIAGLHQKEAALV
3e77A           ----------------------------SVLEMSHRS----SDFAKIINNTENLVRELLAVPDNYKVIFL
3e77C           ----------------------------SVLEMSHRS----SDFAKIINNTENLVRELLAVPDNYKVIFL
3dc1B           --------------------------MKRALQYSPSAGIPESWLKQLQIKLHNPPTIHYPPSQGQMDLCV
3dydA           -----TMISLSIGDTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKD
1eg5A           --------------------------------YREKYGNPNSAHGGIEANLHEKAREKVAKVLGVTSCAT
3e77B           ----------------------------SVLEMSHRS----SDFAKIINNTENLVRELLAVPDNYKVIFL
2aevA           -------------NEKGRDALYDLSGLSGGFLIDEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKC
2c44C           ----------------------------------------RGDEAYSGSRSYYALAESVKNIFGYQYTIP
1dfoB           -------IELIASENYTSPRVMQAQGSQLTNKYAEGYGKRYYGGCEYVDIVEQLAIDRAKELFGAANVQP
2e54A           -------------------------------------------SNLFWNRPQMELAELLSKNTFGGKVFF
1b93B           ----------------------------------------------------------------------
1eghA           ---------------------------------------------------------ELTTRTLPARKHI
1dtyA           ----------------------------------------------------------------------
2bwoD           -----------------------------------------TRNISGTTAYHRRLEAEIAGLHQKEAALV
1agxA           HTDKPIVLVGSMRPSTALSADGPLNLYSAVALASSNEAKNKGVMVLMNDSIFAARDVTKGINIHTHAFVS
2bwpA           -----DITVWC-GNDYLGMGQHPVVLAAMHEALEAVGAGSGTRNISGTTAYHRRLEAEIAGLHQKEAALV
1e9yA           --------------------------------------------------LHYAGELAKKRKEKGIKLNY
2btwA           ----------------------------------------------------------------------
3cq6A           -------------------------------------------LNRYPERDAVELRDELAAYITKQTGVA
2bwoB           -----------------------------------------TRNISGTTAYHRRLEAEIAGLHQKEAALV
1cj0A           -------------------------YPGQRYYGGTEHIDELETLCQ-----KRALQAYGLDPQCWGVNVQ
2bwnE           ------------------------VLAAMHEALEAVGAGSGTRNISGTTAYHRRLEAEIAGLHQKEAALV
3cq5A           -------------------------------------------LNRYPERDAVELRDELAAYITKQTGVA
2bwpB           -------------------------------------GSGGTRNISGTTAYHRRLEAEIAGLHQKEAALV
3bh1C           ----------------------------------------------------------------------
2btwB           ----------------------------------------------------------------------
1bjwA           -------------------------------------------IPELREALAEKFRRENGLSVTPEETIV
1bjnA           ----------------------------SVMEVSHRG----KEFIQVAEEAEKDFRDLLNVPSNYKVLFC
1cj0B           -------------------------YPGQRYYGGTEHIDELETLCQ-----KRALQAYGLDPQCWVNVQP
3dzzA           -----------------------------------------ESVPAEYYKAVADWEEIEHRARPKEDWCV
3e2yA           ----------------------------------------------------------------------
3bv0B           ------------------------------ITPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRR
3bh1D           ----------------------------------------------------------------------
3bwnE           ----------------------------------------------------------------------
3cq5B           -------------------------------------------LNRYPERDAVELRDELAAYITKQTGVA
1ay4B           -----------------------------------------TTKTYAGLSGEPEFQKAMGELILGTLATV
1bw9A           ----------------------------------------------------------------------
1ajsA           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3d46A           ----------------------------------------------------------------------
3d6kD           ----------------------------------------------------------------------
3dxvA           -------------------------------------------LSASNAPAVTLAERLLASFPGEWFGHS
1c1xA           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
2e7uA           ----------------------------------------------------------------------
2eh6A           -------------------------------QVEKLLHVSNLYEN---PWQEELAHKLVKHFWTEGKVFF
1ariA           -------------------AEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPG
1c1dA           ----------------------------------------------------------------------
1b5oA           ------------------------------LAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIV
3bh1A           ----------------------------------------------------------------------
1djeA           -----------------------------------------------------ALEEELAEWLGYSRALL
1bs0A           -----------------------------------------------------ALEEELAEWLGYSRALL
3e2fA           ----------------------------------------------------------------------
2bieB           ----------------------------SVMELSHRS----QSYEEVHEQAQNLLRELLQIPNDYQILFL
1c8nA           ------------------------------------------------NSTVVSNSELILNLTPIALAYT
3ei7A           ----------------------------------------------------------------------
3dzzB           YDFTHVPKRQGNSKEKELPWIAEDFKIAPEIASEEKLKVAAFGYESVPAEYYKAVADWEHRARPKEDWCV
2egyD           -------------------------------------------LQYSPTEGYAPLRAFVAEWIGVRPEEV
1b4xA           ----------------------------------------------------------------------
2egyB           ----------------------------------------------------------------------
1ajrA           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
3boxA           ----------------------------------------------------------------------
1bqaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXIHATFSMYSAHDHFIVGSDVYGGTFRLINKVLKRFGLEFTVVDIQDLAAVENAIQDNTVAIYF
3e6gA           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRAGLDFSFVDLTDPAAFKAAIRADTKMVWI
3e6gB           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRAGLDFSFVDLTDPAAFKAAIRADTKMVWI
3e6gD           FASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRAGLDFSFVDLTDPAAFKAAIRADTKMVWI
2cb1A           LASGQAATFAALALLRPGDEVVAAKGLFGQTIGLFGQVLSLMGVTVRYVDP-EPEAVREALSAKTRAVFV
2ctzA           ASGHAAQFLALTTLAQAGDNIVSTPNLYGGTFNQFKVTLKRLGIEVRFTSRERPEEFLALTDEKTRAWWV
3cogD           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
1cs1A           TNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLV
1cl1B           FPCGAAAVASILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
1cl1A           FPCGAAAVNSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFL
3d19B           ---------IRFWSRIMKEHSFFLRLGFRCFYRLFEHIEQIAHSYTNETDPEQIKRFNAEVQQAATNIW-
3cogB           FASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
3d19D           ---------IRFWSRIMKEHSFFLRLGFRCFYRLFEHIEQIAHSYTNETDPEQIKRFNAEVQQAATNIW-
3d19C           ---------IRFWSRIMKEHSFFLRLGFRCFYRLFEHIEQIAHSYTNETDPEQIKRFNAEVQQAATNIW-
1ddzA           DISFLSVLQYAVQYLKVKHILVCGHYGCGGAKAA-----------LGDSRLGLIDNWLRHIRDVRRMNAK
1e5eB           TSSGMGAIAATVLTILKADHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYF
1e5eA           TSSGMGAIAATVLTIKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYF
3bwnD           TEDRYIVVAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
3d19A           ----EHSFFLRLGFRCEDTQLIEEANQFYRLFE---HIEQIAHSYTNETDPEQIKRFNAEVQQAATNIWG
2c7tA           TTSGSTAMLALEALGIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDKTKA
3d19E           ----EHSFFLRLGFRCEDTQLIEEANQFYRLF---EHIEQIAHSYTNETDPEQIKRFNAEVQQAATNIW-
2dgmE           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRDPKRMIEACDENTIGVVP
3bwnA           TEDRYIVVAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
2c81A           TTSGSTAMLALEALGIGEGDEVIVPSLTWIATATAVLNVNALPVFVDVEADTYCIDPQLIKSAITDKTKA
3ecdC           QPHSGAQANGAVMLALAKDTVLGMSLFNALQYGVSRDT-----------MLIDYDQVEALAQQHK-PSLI
3e9kA           TVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLGEETLRIEDILEVIEKEGDSIAVILF
2dgkA           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMMDPKRMIEACDENTIGVVP
2dgmB           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMMDPKRMIEACDENTIGVVP
1ejiA           PYSGSPANFAVYTAVEPHGRIGLDLPDGGHLTHGFTDKKKISAKVYPETGYINYDQLEENASLFHPKL-I
3bcxA           SSANLLALTALTSPKLGVDEVITVAAGFPTTVNPT-IQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKA
3ecdD           QPHSGA--QANGAVMLAGDTVLGMSLFNALQYGVSRDTMLI-----------DYDQVEALAQQHKPSL-I
1b9hA           VTNGTHALELALQVMGPGTEVIVPAFTFISSSQAAQ----RLGAVTVPVDVDDPEAVAAAVTPRTKVIMP
3ecdA           QPHSGAQANGAVMLALAKDTVLGMSLFNALQYGVSRDT-----------MLIDYDQVEALAQQHKPSL-I
2dgkC           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRDPKRMIEACDENTIGVVP
3bcxB           ALTALTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVDVDIPTYNVNASLIEAAVSDKTKAIMI
3dr7B           CNNGTTALHALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPNLDAAKLEALITPRTKAIMP
3caiA           AVLLSLLAEASSSRAGLGYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEVDPTWQWESLISKSTRLVAV
3b8xB           VSSGSTANLLMIAALFFGDEIIVPAVSWSTTYYPLQQYGLRFVDIDINTLNIDIESLKEAVTDSTKAILT
2dgmA           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPPKRMIEACDENTIGVVP
3b8xA           VSSGSTANLLMIAARLKKGDEIIVPAVSWSTTYYPLQQYGLRVKFVDIDINTLNIDIESLKEAVTDSTKA
1c0nA           LVFVRGTTEGINLVANSGDNIIISQMEHHANIVPWQMLCARVGAELRVIPTLQLETLPTLFDAATRLLAI
3ecdB           PHSGAQANGAVMALAKPGDTVLGMSLFNALQYGVSRDTMLI-----------DYDQVEALAQQHKPSLI-
1ax4A           RGAENILFPVLLKYKQKKNPVFISNFHFDTTAAHVELNGCKSETYDDWKGDFDIKKLKENIAQHGVAIVS
2ch2A           GSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVE--MSERYGADVRTIEFSLETLARAIELHQPKCLFL
3bb8A           SSANLLALTALTSPKLGGDEVITVAAGFPTTVN-PTIQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKA
3bn1C           CNNGTTALHLALVAMGIPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPNLDAAKLEALITPRTKAIMP
2dgmC           LGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMMDPKRMIEACDENTIGVVP
3dr4D           CNNGTTALHALVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPRTKA
3dr4B           CNNGTTALHLAVAMGIGPGDEVIVPSLTYIASANSVTYCGATPVLVDNDPRTFNLDAAKLEALITPRTKA
2ch1A           GSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPFSLETLARAIELHQPKCLFL
1ecxA           TESINWILKTVAETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVEKLVDEDTFLVSI
1b9iA           VTNGTHALELALQVMGVGPGTEVIVPTFISSSQAA----QRLGAVTVPVDVDDPEAVAAAVTPRTKVIMP
3bn1D           CNNGTTALHLALVAMGIGDEVIVPSLTYIASANSV-TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKA
3bwnB           TEDRYIVVAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
3bcaA           GMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPGDELRTDLKAVEAKIQELGPEHILCLHS
1b8gB           TAGATSANETFIFCLDPGEAVLIPTPYYTGVEIVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLV
3bwnF           TEDRYIVVGTGHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
1ecxB           TESINWILKTVAETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVEKLVDEDTFLVSI
1eg5B           FFTSCATEWILKTVAETFEKRKRTIITTPIEHKAVLETKLSKGFKVKYVPVDSRGVVKEKLVDEDTFLVS
1c4kA           GGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNFIGGIYDSDFDEKKIRELAAKVDPERAKWKRPFRLAV
1c7gA           THQGRGAENLLSQLAIKPGQYVAGNMYFATFVDIVRDEAHDASLNLPFKGDIDLTLIKEKGAENIAYICL
3bc8A           GMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLERTDLKAVEAKIQELGLCLHS
2dr1A           SSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDRKNPDVEAVTI
2a7vA           DEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGYDYNQLALTARLFRPRLII
2c44B           YIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQKEAFDTGVRYDFKGNFDLEGLERGIENNVPYIVA
2aeuA           FNRTSSAILATILALKPKKVIHYLPELPGHPSIER----SCKIVNAKYFESDKVGEILNKIDKDTLVIIT
1bj4A           GVNVQPYNFAVYTAVEPHGRIMGLDLPDGGHSATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKL-I
3dr4A           NGTTALHLALVAMGIGPGDEVIVPSLTYIASAN-SVTYCGATPVLVDNDPRTFNLDAAKLEALITPRTKA
3b46A           -------------------------------VPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVII
2e7jA           TNGAREAKFAVMHSLKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYAITPENFAQTIEETKVLALI
2dr1B           SSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKPEDLDDALRPDVEAVTI
2bwnD           FSSAYNANDATLSTLVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNAHLRELIAADDPAAPKLIAF
3bcbA           TGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDLKAVEAKIQELGLCLHS
3dc1D           TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLSDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTV
3bwoA           TEDRYIVVGTGHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
2dkjA           HSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLELEHRPKVI
3bn1A           NGTTALHLALVAMGIGPGDEVIVPSLTYIASANSVTGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMP
3bwoC           TEDRYIVVAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDA----WGFDKKGPYIELV
2cy8A           TGSGTETTLLALRVARAFTGRRMILRFEGTTANTL---------LIRPDDIEGMREVFANHGSDIAAFIA
1b8gA           VLTAGATSTFIFCLADPGEAVLIPTPYYTGVEIVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLV
2bkwA           TLGWDIFASNFILSKAPNKNVLVVSTGTFSD--RFADCLRSYGAQVDVVRVPLELITEKLSQNSYGAVTV
2bwnB           FSSAYNANDATLSTLRVLFPGLIYSDSLNHASMIEGIKRNAGPKRIFRHVAHLRELIAADDPAAPKLIAF
2bwnA           FSSAYNANDATLSTLVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVLRELIAADDPAAPKLIAF
1djpA           KTEAFKSAWGPLGMVVEGKSYWRLPAKRHTVNSEFDIKQISSLPQVDIAGNVTDTAYKALAQNGAKALIH
3b46B           --------------FDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVII
2cfbA           VNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHA------ATLTAPYNDLEAVSRLFEQYPNDIAGVIL
2c44A           -----------AFSNYFFDTTQGHSQINGCTVRNVYIKAFDTGVRYDFKGNFDLEGLERGIENNVPYIVA
3dr4C           CNNGTTALHLALVAMGIGDEVIVPSLTYIASANSVTYCTPVLVDNDPRTFNLDAAKLEALITPRTKAIMP
2bwoA           FSSAYNANDATLSTLRLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNAHLRELIAADDPAAPKLIAF
3e77A           QGGGCGQFSAVPLNLKAGRCADYVVTGAWSA-KAAEEAKKFGTINIVHPKTKIPDPSTWNLNPDASYVYY
3e77C           QGGGCGQFSAVPLNLKAGRCADYVVTGAWSA-KAAEEAKKFGTINIVHPKLGIPDPSTWNLNPDASYVYY
3dc1B           TSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGPDSLRDILSRWKPEDAKNPQKNTPKFLYTV
3dydA           VILTSGCSQAIDLLANPGQNILVPRPGFSLYAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIV
1eg5A           ESINWILKTVAETFEKRKRTIITTPIEHKAVLETKYLSKGFKVKSRGVVKLEEL----EKLVDEDTFLVS
3e77B           QGGGCGQFSAVPLNLIGGRCADYVVTGAWSA-KAAEEAKKFGTINIVHPKTKIPDPSTWNLNPDASYVYY
2aevA           VGFNRTSSAILATILALKKKVIHYLPELPGHPSIE--RSCKIVNAKYFESDKVGEILNKIDKDTLVIITG
2c44C           THQGRGAEQIYIPVLIKKKMVAFSNYFFDTTQGHSQINAFDTGVRYDFKGNFDLEGLERGIEEVGPNIVA
1dfoB           HSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKM-I
2e54A           ANTGTEANEAAIKIARKYYRILSAHNSFHGRTLGSLTATGQLVPGFEYFEFNNVEDLRRKMSEDVCAVFL
1b93B           ----------------RHQPLLEQHVLYATGTLISRATGMNVNAMLSGPMGGDQQVGALISEGKIDVIFF
1eghA           ALVAHDHCKQMLSWVERHQPLLEQHVLYATGTLISRATGMNVNAMLSGPMGGDQQVGALISEGKIDVLIF
1dtyA           --------FGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVII
2bwoD           FSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHAHLRELIAADDPAAPKLIAF
1agxA           QWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDALPGVQIV-YGSDNMMPDAYQAFAKAGVKAIIH
2bwpA           FSSAYNANDATLTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNAHLRELIAADDPAAPKLIAF
1e9yA           VEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPG
2btwA           --------EGEKLLLTSRSREDFFPLSQFVTQVNQAYVLNSLGINAPETAQYPYRVFTQDNFFSNEKTKA
3cq6A           VTRDNLWAQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADIDMDVALEEIRAKQPDIVFV
2bwoB           FSSAYNANDATLSTLVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNAHLRELIAADDPAAPKLIAF
1cj0A           PYSGSPANFAVYTALEPHGRIMGLDLPDGGHFMTDKKKISATSIFFESMGYIDYDRLEENARLFHPKLII
2bwnE           FSSAYNANDATLSTRVLFPGLIIYSDSLNHASMIEGIKRNAG--PKRIFRAHLRELIAADDPAAPKLIAF
3cq5A           VTRDNLWAEILQQLLQAFRTALGFQPSYSMHPILAKGTHTEFIAVSRGADIDMDVALEEIRAKQPDIVFV
2bwpB           FSSAYNANDATLSLRVLFPGLIIYSDSL--NHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDKLIAF
3bh1C           ----------------------------------------------------SPESIEPIQTLKTVHLGS
2btwB           ----------------SRSREDFFPLSQFVTQVNQASLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIA
1bjwA           TVGGKQALFNLFQAILDPGDEVIVLSPYWVMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVV
1bjnA           HGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKRAVKPMREWQLSDNAAYMHY
1cj0B           YSGSPANFAVYTALVEPHGRIMGLDLPDGGHFMTDKKKISATSIFFESMGYIDYDRLEENARLFHPKLII
3dzzA           FASGVVPAISAVQFTSPGDQILVQEPVYNFYEGNGRRVISSDLIYENSKYSVNWADLEEKLATPSVRVFC
3e2yA           ----------------------------------------------------DPRELESKFSSKTKAIIL
3bv0B           LMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVV
3bh1D           --------GCAIELVDGSIITGATSDLLGCSSSMLLNALKHLAGIDDAIHLLSPESIEPIQTLKTVHLGS
3bwnE           ------------------VSVVAAAPFYSTYVEET----TYVRSGMYKWEGD-----AWFDKKGPYIELV
3cq5B           VTRDNLWAEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSIDMDVALEEIRAKQPDIVFV
1ay4B           GGTGALRQALELARMANPDLRVFVSDPTWPNHVSIVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLH
1bw9A           --------------------------------TERVAHAVALGHTAVACDVFAPCAMGGVITTEVARLDC
1ajsA           ----------------------------------------------------------------------
3ei6B           ----------------SYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFF
3ei9B           ----------------SYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFF
3d46A           ----------------PFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDI
3d6kD           ----------------------------------------------------------------------
3dxvA           GSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGLILLPYPTGDTLLTEKLAAVPAGSIGAAFI
1c1xA           ------------------------------------AHAVALGHTAVACDVFAPCAMGGVITTEVARLDC
3ei9A           -----------------YPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFF
2e7uA           -------IVKFRGNYHGHADGLLGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKEEIAAIIF
2eh6A           ANSGTESVEAAIKLARKKWKFISFENSFHGRTYGSHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAGIII
1ariA           GTGALRVAADFLAKNTSVKRVWVSNPSHPNHKSVFNSAGLEVREENHTLDFDALINSLNEAQAGDVVLFH
1c1dA           -------------------------------------HAVALGHTAVACDVFAPCAMGGVITTEVARLDC
1b5oA           TVGGSQALFNLFQAIDPGDEVIVLSPYWVSYPEMVRFAVVEVETLPEEGFVPDPERVRRAITPRTKALVV
3bh1A           ----------------------------------------------------SPESIEPIQTLKTVHLGS
1djeA           FISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVT
1bs0A           FISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVT
3e2fA           -------------------------------------------------WTFDPRELESKFSSKTKAIIL
2bieB           QGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNEND
1c8nA           VQ-------SLPLIATQPAWLGTIADNYSKWRWVSLRISPKCPTTTSGTVAMCLSYDRNDVAPGSRVQLS
3ei7A           ----------------SYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFF
3dzzB           FASGVVPAISAVRQFTSPGDQILVQEFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLATPSVRVFC
2egyD           LITTGSQLDLVGKVFLDESPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERPRYLI
1b4xA           --------------NTSVKRVWVSNPSWPNHKSVFNREYAYYDAENHTLDFDALINSLNEAQAGDVVLFH
2egyB           ----------------------------------------------------------------------
1ajrA           -----------------DTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEDLQGFLSDLENAPSIFVL
1bxgA           --------------------------------TERVAHAVALGHTAVACDVFAPCAMGGVITTEVARTLD
3boxA           -------ATKLAHACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSHHGTLQSFRTLAETGIDIMQ
1bqaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETPTNPLLQXXXXXXXXXXXXXXXXXXXVDNTFATPYNQRPLELGADIVVHSATKYLGGHSDVVAGLAVT
3e6gA           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVV
3e6gB           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVG
3e6gD           ETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVG
2cb1A           ETVANPALLVPDLEALATLAEEAGVALVVDNTFGAAALCRPLAWGAHVVVESLTWASGHGSVLG-GAVLS
2ctzA           ESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGYLLRPLAWGAALVTHSLTKWVGGHGAVIAGEAFG
3cogD           ETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
1cs1A           ESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTYLNGHSDVVA-GVVIA
1cl1B           ESPGSITMEVHDVPAIVAAVRSVVPDAIIMNTWAAGVLFKALDFGIDVSIQAATYLVGHSDAMIGTAVC-
1cl1A           ESPGSITMEVHDVPAIVAAVRSVVPDAIIMITWAAGVLFKALDFGIDVSIQAATYLVGHSDAMIGT--AV
3d19B           ----GFKRKILGLILTCKLPGQNNFPLLVDHTSEADYNEGKLDALPDAIIKENVFFLADHAKFIGHLLDP
3cogB           ETPTNPTQKVIDIEGCAHIVHKHGDIILVVDTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSV
3d19D           ----GFKRKILGLILTCKLPGQNNFPLLVDHTSEADYNEGKLDALPDAIIKENVFFLADHAKFIGHLLDP
3d19C           ----GFKRKILGLILTCKLPGQNNFPLLVDHTSEADYNEGKLDALPDAIIKENVFFLADHAKFIGHLLDP
1ddzA           YLDKCKDGDEELNRLIELNVLEQ-----VHNVCATSIVQDAWDAGQELTVQGVVYGVGDGKLRDLGVVVN
1e5eB           ETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICG
1e5eA           ETPANPTLKIIDMERVCKDAHSQEGVLVIDNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGL-IC
3bwnD           TSPNNPDGTIRETVVNAKVIHD-------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWALV
3d19A           FKGLILTCKLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLDALPDAIIKENVFFLRIMADHAKFIG--
2c7tA           IIPVHLFGSMANMDEINEIAQEHNLFVIEDQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAGEGGI-IVT
3d19E           ----GFKRKILGLILTCKLPGQNNFPLLVDHTSREQLNEGKLDALPDAIIKENVFFLADHAKFIGHLLDP
2dgmE           TFGVTYTGPLHDALDKFQADTGIDIDMHIDAASAPDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
3bwnA           TSPNNPDGTIRETVVDEAKVIHD------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGW-ALV
2c81A           IIPVHLFGSMANMDEINEIAQEHNLFVIEDQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAGEGGIIVTK
3ecdC           IAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAAGRHANPVEHAHVVTSTTHKTLRGPRG---GFVLT
3e9kA           SGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGVELYLHDWGVDFACWCSYKYLNAGAGGIAG-AFI
2dgkA           TFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
2dgmB           TFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHPDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
1ejiA           IAGTSCYSRNLDYARLRKIADDNGAYLADAGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGIFYRKGVR
3bcxA           IMIAHTLGNLFDLAEVRRVADKYNLWLIEDDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAVFTQ
3ecdD           IAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAANPVEHAHVVTSTTHKTLRGPRG---GFVLT
1b9hA           VHMAG-LMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAV-VF
3ecdA           IAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVRHANPVEHAHVVTSTTHKTLRGPRG--GFVLTN
2dgkC           TFGVTYTGNYEFPQPLHDALDKFQADTGIDAASGPDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
3bcxB           AHTLGNLFDLAEVRRVADKYNLWLIED-CCDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAV-FT
3dr7B           VHLYGQICDMDPILEVARRHNLLVI---EDAAEAVGATYRGKKSGSLGDCATFSFFTTNDDDLAAKMRLL
3caiA           NSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAPYRLDIRETDADVVTVNAHAWGGPPIGAMVFRDPS
3b8xB           VNLLGNPNNFDEINKIIGGRDIILL---EDNCESMGATFNNKCAGTFGLMGTFSSFYSNHIATMGGCIVT
2dgmA           TFGVTYTGPLHDALDKFQADTGIDIDMHIDAASGPDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
3b8xA           ILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMGATFNNKCAGTFGLMGFYSNHIATM---EGGCIVT
1c0nA           THVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHPVDVQALDCDFYVFSGHKLYGPTGIGILYVK--
3ecdB           IAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAAGRHANPVEHAHVVTSTTHKTLRGPRG---GFVLT
1ax4A           TVTCNSAGSMSNLKEVYEIAKQHGIFVVMDSCENAYFIKARDPKYKNATIKEVIFDMYKYADALTMLLNI
2ch2A           THGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGITPISISP
3bb8A           IMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALGSDGKMAGTFGDIGTVSFYPAKHITMGEGGAV-FT
3bn1C           VHLYGQICDMDPILEVARRHNLLVI---EDAAEAVGATYRGKKSGSLGDCATFSFFTTNDDDLAAKMRLL
2dgmC           TFGVTYTGPLHDALDKFQADTGIDIDMHIDAASGPDIVWDFRLPRVKSISASGHKFGLAPLGCG-WVIWR
3dr4D           IMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKLGDCATFSFFGNAIIGGDDDLAAKMRLL
3dr4B           IMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGSLGDCATFSFFGNAIIDDDLAAKMRLLRG
2ch1A           THGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGITPISISP
1ecxA           MAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEVDYASFSAHKFHGPKGVGITY--IR
1b9iA           -VHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGA-VVF
3bn1D           IMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNNDDDLAAKMRLL
3bwnB           TSPNNPDGTIRETVVNRPDDDEAKVIHD-FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWALV
3bcaA           TTACFAPRVPDRLEELAVICANYDIPHVVNNAYGHLIQQGARVGRIDAFVQSLDNFMVPVG---GAIIAG
1b8gB           TNPSNPLGTTMTRNELYLLLSFVEDKGISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVYS
3bwnF           TSPNNPDGTIRETVVAKVIHD--------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWALV
1ecxB           MAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRK-
1eg5B           IAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFKLEVDYASFSAHKFHGPKGVGITYIRKG
1c4kA           IQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSSSPLLIDDLGPEDPGIIVVQSVHKQQAGFSQT--SQIHK
1c7gA           AVTVNLPVSMANMRAVHEMASTYGIKIFYDATENAYFIKEQEAGYENVSIKDIVHEMFSYADGCGGFLCM
3bc8A           TTACFAPRVPDRLEELAVICANYDIPHVVNNAYGHLIQQGARVGRIDAFVQSLDNFMVPV---GGAIIAG
2dr1A           TYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSE
2a7vA           AGTSAYA-RLIDYARMREVCDEVKAHLLADMAHISGLVIPSPFKHADIVTTTTHKTLRGARS---GLIFY
2c44B           TITSNSAVSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLLCM
2aeuA           STMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRPPALKLGADLVVTSTDKLMEGP----RGGLLA
1bj4A           IAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFY
3dr4A           IMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGCATFSFFGNAIIGGDDDLAAKMRLL
3b46A           NTPHNPVFTREELTTLGNICVKHNVVIISDEVYETRIATLSPEIGQLTLTVGSAGSFAATGWRI-GWVLS
2e7jA           TYPDGNYGNLPDVKKIAKVCSEYDVPLLVNAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPVMGMKEEW
2dr1B           TYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSE
2bwnD           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVRGAGVAERDGLMHRIDIFNGTLAAYGVFGG--YIA
3bcbA           TTACFAPRVPDRLEELAVICANYDIPHVVNNAYGHLIQQGARVGRIDAFVQSLDNFMVPVG---GAIIAG
3dc1D           PNGNNPTKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTG
3bwoA           TSPNNPDGTIRETVVAKVIHD--------FAYYWPHYTPITRRQDHDIMLFTFSITGHAGSRI--GWALV
2dkjA           VAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAAGLHPNPLPYAHVVTSTTHKTLRGPRG---GLILS
3bn1A           VHLYGQIC---DMDPILEVARRHNLLVIEDAAEAVGATYRGKKSGGDCATFSF------FGNIITGMITT
3bwoC           TSPNNPDGTIRETVVAKVIHDFA--------YYWPHYTPITRRQDHDIMLFTFSIT--GHAGSRIGWALV
2cy8A           EPVGSHFGVTPVSDSFLREGAELARQYGLDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILG
1b8gA           TNPSNPLMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVYS
2bkwA           THVDTSTAVLSDLKAISQAIKQTSPETFFVVDAVCSIGCEEFEWGVDFALTASQAIGAPAGLSISLC---
2bwnB           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAPRGAGVAERDGLMHRIDIFNGTLAAYGVFGG--YIA
2bwnA           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVYGPRGAGVAERDGLMHRIDIFNGTLAAYGVFGG--YIA
1djpA           AGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILAMVAM
3b46B           NTPHNPVFTREELTTLGNICVKHNVVIISDEVYETRIATLSPEIGQLTLTVGSAGSFAATGWRI-GWVLS
2cfbA           EPVVGNPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYG
2c44A           TITSNSAGNLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLLCM
3dr4C           VHLYGQICDMDPILEVARRHNLLVI---EDAAEAVGATYRGKKSGGDCATFSFFGNAIITTGE-GGMITT
2bwoA           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGRDGLMHRIDIFNGTLAAYGVFGG--YIA
3e77A           CANETVHGV-----EFDFIPDVKGAVLVCDMSSNFLSKPVDVS-KFGVIFAGAQKNVGSAGVTVVIVRDD
3e77C           CANETVHGVEFDFIPDVKGAVLV-----CDMSSNFLSKPVDVS-KFGVIFAGAQKNVGSAGVTVVIVRDD
3dc1B           PNGNNPTKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTG
3dydA           NNPSNPCILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLG--WIL
1eg5A           IAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEKDYASFSAHKFHGPKGVGITYIRK-
3e77B           CANETV-----HGVEFDFIPDVKGAVLVCDMSSNFLSKPVDV-SKFGVIFAGAQKNVGSAGV---TVVIV
2aevA           STMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRPPALKLGADLVVTSTDLMEGPR-----GGLLA
2c44C           TITSNSAGSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDWTIEQITRETYKYADMLAGLLCM
1dfoB           IGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNAHVVTTTTHKTLAGPRGGLILAKGG
2e54A           EPIQGEPATKEFLEEARKLCDEYDALLVFDEVQCTGKLFAYQKYGVVPDVLTTAKGLGGGVP--IGAVIV
1b93B           WDPLNAVPHDPDVKALLRLATVWNIPVATNVATADFIIQSPHFNDADILIPDYQRYLADR----------
1eghA           WDPLNAVPHDPDVKALLRLATVWNIPVATNVATADFIIQSPHFNDADILIPDYQRYLADR----------
1dtyA           EPIVQGAYHPEWLKRIRKICDREGILLIADEIATTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTT
2bwoD           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARM
1agxA           AGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARLLMAKTN
2bwpA           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARM
1e9yA           ELFLKN-------EDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFDIAAGTAVRFEPGEEKSVELIDIG
2btwA           VIAPEVVARQGTLDELGRLIASYGVKVKVNDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQEGGHISP
3cq6A           TTPNNPTGDVTSLDDVERIINVAPGIVIVDESPSPSATTLLEKYPTKLVVSRTMSAFDFAGGRLG--YFV
2bwoB           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARM
1cj0A           AGTSCYSYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRGV
2bwnE           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGRDGLMHRIDIFNGTLAAYGV-FGGYIAA
3cq5A           TTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYASATTLLEKYPTKLVVSRTMSKAFDFAGGRL-GYFVA
2bwpB           ESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMERDGLMHRIDIFNGTLAKAYGVFGGYIAA----
3bh1C           SNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRGCDVH------TTTILGSVDEGIFRN---LGVLVT
2btwB           PEVVAKQGTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENGNFVIVNYLRKEIGQ---ERGGHISP
1bjwA           NSPNNPTLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAAFAMTG--WRIGYAC
1bjnA           CPNETID----GIAIDETPDFGADVVVAADFSSTILSRPID-VSRYGVIYAGAQNIGPAGLTIV-IVRED
1cj0B           AGTSCYDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFE-HCHVVTTTTHKTLRGCR---AGMIFY
3dzzA           N-PHNPIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSTFNLAALHA-ACAII
3e2yA           NTPHNPIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLG--WSI
3bv0B           EPVVQGFHDPRYLHDLRDICRRYEVLLIFDEIATTGALFAADHAGVSPDIMCVGKALTGGY--LSLAATL
3bh1D           SNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRGVHTTTILGSVDEGIFRNL-----------GVLVT
3bwnE           TSPNNPDGTIRETVVEAKVIHD-------FAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRI-GWALV
3cq5B           TTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYASATTLLEKYPTKLVVSRTMSKAFDFAGGRL-GYFVA
1ay4B           GCCHNPNLTLDQWAEIASILEKTGALPLIDLAYQAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLAL
1bw9A           SVVAGAANNVIADEAASDILHARGILYAPDFVANAGGAILVGREVLGWSESVVHERAVAIGDTLNQVFEI
1ajsA           -----------------------------------AIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVV
3ei6B           CSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYARSIFEIPGAEEVAMETASFSKYAGFTGVRLGWT-VI
3ei9B           CSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYARSIFEIPGAEEVAMETASFSNYAGFTGV--RLGWTV
3d46A           MQPDGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYS-----HHAVITFTNTPFSEFLMTSPDCSTLRPQF
3d6kD           -------------------------------VHNVIEFAQAAGNPNRFWFSSTSKITHAG---SGVSFFA
3dxvA           EPIQSDVPPDGFLRKFADICRAHGILVVCDEVGLARSGRLHCFEHEGFVPDILVKGLGGGLPLSAVIAPA
1c1xA           SVVAGAANNVIADEAASDILHARGILYAPDFVANAGGIHLVGREVLGWSESVVHERAVAIGDTLNQVFEI
3ei9A           CSPNNPTATREQLTQLVEFAKKNGSIIVYDSAYPRSIFEIPGAEEVAMETASFSNYAGFTGVRLGWT-VI
2e7uA           EPVVGNAVPTEDFLKALHEAKAYGVLLIADTGFRLAFGGATELLGLKPDLVTLGKILGG--GLPAAAYAG
2eh6A           EVIQGEEASEDFLSKLQEICKEKDVLLIIDEVQTTGEFYAYQHFNLKPDVIALAKGLGGGVPIG---AIL
1ariA           GCCHNPTGIDPTLEQWQTLAQLSVEKGWLLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV
1c1dA           SVVAGAANNVIADEAASDILHARGILYAPDFVANAGGIHLVGREVLGWSESVVHERAVAIGDTLNQVFEI
1b5oA           NSPNNPVYPKEVLEALARLAVEHDFYLVSDEIYEEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYAC
3bh1A           SNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLCDVHTTTILGSVDEGIFRNL-----------GVLVT
1djeA           EGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQQKVKPELLVVTFGKGFGVSGAAVLC----
1bs0A           EGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGELQKVKPELLVVTFGKGFGVSGAAVLCSSTV
3e2fA           NTPHNPIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGTFSVTGWKLGW---SI
2bieB           AYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLK-VNQFGMIYAGAQKNLGPSGV---TVVIV
1c8nA           QTYKAIILNTDVTPTSAIYVDVDVTRFDKAWYSTIGTAAFAALTAFDQNQFCPCTVHIGSDGGPA--VAV
3ei7A           CSPNNPAATREQLTQLVEFAKKNGSIIVYDSAYARSIFEIPGAEEVAMETASFSKYAGFTG--VRLGWTV
3dzzB           NPPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGTPAFTVDWDAKNWVVSLISPSTFNLAALHAACA-II
2egyD           PSFQNPTRKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREPGVIYLGSFSKVLSPGLRVAFAV
1b4xA           GSCHNPTGIDPTLEQWQTLAQLSVEKGWLLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV
2egyB           -----------------------------EARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAH
1ajrA           HAPTGTDPTPEQWKQIASVMKRRFLFPFFDSAKDAWAIRYFVSEGFELFCAQSFSNFGLYNE--RVGNLT
1bxgA           CSVVAGAIADEAASDILHARGILYAPDFVANAGGAIH--LVGREVLGWSESVVHERAVAIGDTLNQVFEI
3boxA           PDVGWCG-GLTTLVEIAALAKSRGQLVVPHGSSVYS-----HHAVITFTNTPFSEFLMTSPDCSTLRPQ-
1bqaA           -----------------------------GLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLV


                         .         .         .         +         .         .         .:280
query           SDEKIAEKLAFLQNSIGSTLGPDDSWLIQRGIKTLGARMRVHHANTEAIIKFLENDDRVARILYPGLPDF
3e6gA           GDNELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
3e6gB           DNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
3e6gD           DNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASH
2cb1A           RETELWRNYPQFLQPCGMALSPFNAYLLFQGLETVALRVARMSETARFLAERLQGHPKVKALRYPGLPED
2ctzA           ELAFIVKARVDGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHH
3cogD           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
1cs1A           KDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPEN
1cl1B           -NARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
1cl1A           CNARCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGS
3d19B           SERKLVDTARNFSNDFD--------ELMYQAIDLESMKP--QSQTAPLLDQFLDQNRVSVASLRDFKKTA
3cogB           NCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSH
3d19D           SERKLVDTARNFSNDFD--------ELMYQAIDLESMKP--QSQTAPLLDQFLDQNRVSVASLRDFKKTA
3d19C           SERKLVDTARNFSNDFD--------ELMYQAIDLESMKP--QSQTAPLLDQFLDQNRVSVASLRDFKKTA
1ddzA           SSDDISKFYRTKSDSGALKAGNPNAPLVQVTKGGESELDSTMNRVFVNNENWRQKMLKQDPQFFSNLAHT
1e5eB           KADLLQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDH
1e5eA           GKADLLQQIRMVGIKDITVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDH
3bwnD           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
3d19A           ---HLLDPSERKLVDTARNFSNDFDELMYQAIDLESMKP--QSQTAPLLDQFLDQNRVSVASLRDFKKTA
2c7tA           KNPRLFELIQQLRADSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSR
3d19E           SERKLVDTARNFSNDFD--------ELMYQAIDLESMKPQSQTA--PLLDQFLDQNRVSVASLRDFKKTA
2dgmE           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
3bwnA           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
2c81A           NPR-LFELIQQLRADSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSR
3ecdC           NDEEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLL
3e9kA           HEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKK
2dgkA           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
2dgmB           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
1ejiA           SVDPKTGKETLESLINSAVFPGLQGGPHNHAIAGVAVALKQATTEFKIYQLQVL---ANCRALSDALTEL
3bcxA           SAELKDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSD
3ecdD           NDEEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLL
1b9hA           PDGETEKYETAFLRHSCGRPRDDSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADR
3ecdA           DEEIAKKINSAVFGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLL
2dgkC           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
3bcxB           QSAELKSIIESFRDWGRDCITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSD
3dr7B           RGQGMDPNRRYWFPIVGFRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
3caiA           VMNSFGSVSTNPYATGPARLAGVVASIEYLAALDESARGSRRERLAVSMQSADAYLNRVFDYLMVSLRSL
3b8xB           DDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKFVLPGKKLPRFISVRRKNAEYFLDKFKDH
2dgmA           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
3b8xA           DDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDDQFEESFKFVLPGKKLPRFISVRRKNAEYFLDKFKDH
1c0nA           ----EALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEY
3ecdB           NDEEIAKKINSAVFPGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNH
1ax4A           GGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREA
2ch2A           KALDVIRNRRTKSKVWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKM
3bb8A           QSAELKSIIESFRDWDCQLGSLPQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSD
3bn1C           RGQGMDPNRRYWFPIVGFNMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
2dgmC           DEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
3dr4D           RGQGMDPNRRYWFPIVGFNYRMTQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
3dr4B           QGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
2ch1A           KALDVIRNRRTKSKVWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKM
1ecxA           KGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEK-------LRSKLVSGLMNL
1b9iA           PDGETEKYETAFLRHSCGRPRDDSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADR
3bn1D           RGQGMDPNRRYWFPIVGFNMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
3bwnB           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
3bcaA           FNEPFIQDISKMYPGRASASLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHN
1b8gB           LSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKK
3bwnF           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
1ecxB           -GVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHME-------KLRSKLVSGLMNL
1eg5B           VPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVS-----------GLNLG
1c4kA           KDSHIKGQLRYCDHKHFPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNG
1c7gA           NDEEMFSAAKELVVVYEGMPSYGGLMAIGLREAMQYEYIEHRVKQVRYLGDKLREAGVPIVEPTGGHAVF
3bc8A           FNEPFIQDISKMYPGRASASPSLDVLLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHN
2dr1A           RFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVFGINVALRIIEKMGGKEKWAKMVREGVREI
2a7vA           RKGVKAVDPKTGREI-PYTFEDRINFAVFPSLQGGPHNHAIKQACTPMFREYSLQVLKNARAMADALLER
2c44B           KDDSFFDVYTECRTLCVTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGH
2aeuA           GKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERNFDLSKIEKLNKELK---AIDDNINIVYERT
1bj4A           RKGVKSVDPATGKEIQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSD
3dr4A           RGQGMDPNRRYWFPIVGYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGR
3b46A           LNAELLSYAAKAHTRICFASPSPLQEA--------CANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL
2e7jA           AEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDN
2dr1B           RFLEIAEKMPERGWYFDIPLYVKYLKEKESTPSTPPMPQVFGINVALRIIEKMGGKEKWRAKMVREGVRE
2bwnD           ASARMVDAVRSYAPGFIFSTSLPPAI-------AAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
3bcbA           FNEPFIQDISKMYPGRASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHN
3dc1D           PKP-LIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHV--DRVIDFYSNQKDAI---LAAADKW
3bwoA           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
2dkjA           NDPELGKRIDKLIFPGIQGGPLEAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTD----
3bn1A           NDDDLAAKMRLLRGGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLA--RLGNRVTKPHVALT
3bwoC           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
2cy8A           GREDVMGVL------SRGSFTGN----------PITAAAAIAAIDTILEDDVCAKINDLGQFANHLFARK
1b8gA           LSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKK
2bkwA           -SSRFDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKGAYFATPPVQLINSLDVALKESDWFKDSLVNGL
2bwnB           ASARMVDAVRSYAPGFIFSTSLPPA--IAAGAQASIAFLKEGQKLRDAQQMHAKVLKMRLKALGMPIIDH
2bwnA           ASARMVDAVRSYAPGFIFSTSLPPA-------IAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
1djpA           TKTQDSKELQ------------------------------------------------------------
3b46B           LNAELLSYAAKAHTRICFASPSPLQEA--------CANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL
2cfbA           GRAEIMKMVAPAGPTLSGNPLAMTTLEILSRPGSYEHLDRITGKLVQGLLDAAR------EFGHEVCGGH
2c44A           KDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAMERLAVGLYD----GMNLDWLAYRIAQVQYLVDGLEEI
3dr4C           NDDDLAAKMRLLRGQFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNR--VTKPHVALT
2bwoA           ASARMVDAVRSYAPGFIFSTSLPPAI-------AAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
3e77A           LLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNS
3e77C           LLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNS
3dc1B           PKP-LIERVILHIQVSTLHPSTFNQLMISQLLHEW--GEEGFMAHVDRVIDFYSNQKDAILAAADKWLTG
3dydA           IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPG---EFYHNTLSFLKSNADLCYGALAAI
1eg5A           --GVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAEIAVEELSEAAKHEKL--------RSKLVSGLNLG
3e77B           RDDLLGFALRECPS-VLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMSIKSQTIYEIIDNS
2aevA           GKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNKAFERAKNFDLSKIEKLKELKAIDDNINIVYERT
2c44C           KDDSFFDVYTECRTLCVVYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGH
1dfoB           SEELYKKLNSAVFPPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDN---
2e54A           NERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVE----------EKGNYLMKKLQEMKEEY
1b93B           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1dtyA           RE--VAETIS----DGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVA---DIEVQLREQLAPA
2bwoD           VDAVRSYAPGFIFSTSLPPA------------IAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
1agxA           DAKEIQNMF-------------------------------------------------------------
2bwpA           VDAVRSYAPGFIFSTSLPPA------------IAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
1e9yA           GNRRI---FGFNALVDRQADNESKKIALHR----------------------------------------
2btwA           LAAYNEQTDRFLID-VSRYKYPPVWVKTTDLWKANTVDSV------------------------------
3cq6A           ANPAFIDAVMVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEEAVVPSESNFVFFGDF
2bwoB           VDAVRSYAPGFIFSTSLPPA------------IAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
1cj0A           RSVDILYNLESLINSPGLQGGPHNHAIA-------GVAVALKQAMTPEFKEYQRQVVANCRALSAALVEL
2bwnE           SARMVDAVRSYAPGFIFSTSLP--------PAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAL
3cq5A           NPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFF
2bwpB           SARMVDAVRSYAPGFIFSTSLP--------PAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRL---
3bh1C           SDPKFQK---------------------------------------------------------------
2btwB           LAAYNEQTDRFLID-VSRYKYPPVWVKTTDLWKANTVDSV------------------------------
1bjwA           GPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAY-------RRRRDLLLEGLTAL
1bjnA           LLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNS
1cj0B           RRGVRSVDKEILYNLEAVFPGLQGGPHNHAIA---GVAVALKQAMTPEFKEYQRQVVANCRALSAALVEL
3dzzA           PNPDLRARAEESF---FLAGIGEPNLLYEEGHDWLRELKQVLRDNFAYAREFLAKE--------------
3e2yA           GPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVVRLLNSVGLKPIVPD
3bv0B           CTADVAHTISAGPTFMANPLACAVSVASVELLLGQDWRTRITE-----LAAGLTAGLDTARAL-PAVTDV
3bh1D           SDPK------------------------------------------------------------------
3bwnE           KDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKES
3cq5B           NPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEEAVVPSESNFVFFGDF
1ay4B           CAELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSD
1bw9A           SDN-------------------------------------------------------------------
1ajsA           AKLRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSERARLEALKTPGT
3ei6B           PKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEA--MHKVIGFYKENTNIIIDTFTSL
3ei9B           IPKKLLYSDGFPVAKDTCFNGASLACLTPEGLEAMHKVIGFYKENTNIIIDTFTYGGKNAPYVWVHFPNQ
3d46A           DP--------------------------------------------------------------------
3d6kD           SSKENIEWYASHANVRGIGPNKLNQLAHAQFFGD-VAGLKAHLKHAASLAPKFE---RVLEILDSRLSEY
3dxvA           EILDCASAFAMQTLHGNPISAAAAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACG
1c1xA           SDN-------------------------------------------------------------------
3ei9A           PKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEA--MHKVIGFYKENTNIIIDTFTSL
2e7uA           RREIMEKVAPLGPVYQAGTLSGN-PLAMAAGLATLEL--------LEENPGYYAYLEDLGARLEAGLKEV
2eh6A           AREEVAQSFTPGSH--GSTFGG--NPLACRAGTVVVDEVEKLLPHVREVGNYFKEKLK------------
1ariA           AADSETVDRAFSQMKAAIRANYSNPPAGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEK
1c1dA           SDN-------------------------------------------------------------------
1b5oA           GPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAY-------RRRRDLLLEGLTAL
3bh1A           SDPK------------------------------------------------------------------
1djeA           -SSTVADYLLQFARHIYSTSMP--------PAQAQALRASLAVIRSDEGDARREKLAALITRFRAGV---
1bs0A           ADYLLQFARHLIY---STSMPPAQAQALRASLA---------VIRSDEGDARREKLAALITRFRAGV---
3e2fA           GPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVVRLLNSVGLKPIVPD
2bieB           KKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDES
1c8nA           PPGDIFFKYVIEL---------------------------------------------------------
3ei7A           IPKKLLYSDGFPVAKDTCFNGA--SNISQAGALACLTPEGLEA-----MHKVIGFYKENTNIIIDTFTSL
3dzzB           PNPDLRARAEESF---FLAGIGEPNLLYEEGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSN----
2egyD           AHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERRVRRVYREKAQAMLH--ALDREVPKEVRYTR
1b4xA           AASETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEK
2egyB           PE--ALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERRVRRVYREKAQAMLH--ALDREVPKEVRYTR
1ajrA           VVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARL
1bxgA           SDN-------------------------------------------------------------------
3boxA           FDPILLDEPVPV----------------------------------------------------------
1bqaA           AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQE


                         .         *         .         .         .         .         +:350
query           PGHEVAKKQMDHFGAMISFELQEGLDTKKFVESLKVISLAESLGGIESLIEVPSVMTHGSIPREIRLENG
3e6gA           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLG
3e6gB           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMTHEQL--------G
3e6gD           PQHVLAKRQMSGFGGIVSIVLKGGFDAKRFCEKTELFTLAESLGGVESLVNHPAVMTRE--------QLG
2cb1A           PAHRNARKYLASGGPILTLDLGDLERASRFLGAIRLL-KAANLGDARTLLVHPWTTTHSRLKEEARLQAG
2ctzA           PHHDRAQKYFKGPGAVLTFGLKGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAG
3cogD           PQHELVKRQCTGCTGMVTFYIKTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLG
1cs1A           QGHEIAARQQKGFGAMLSFELDGEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAG
1cl1B           KGHEFWKRDFTGSSGLFSFVLKNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEI--D
1cl1A           KGHEFWKRDFTGSSGLFSFVLKNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEI--D
3d19B           RDLIEQCKIKSIIHPLLADHVFR--EADRFLEIIDMYDVHLT----------------------------
3cogB           PQHELVKRQCTGCTGMVTFYIGTLQHAEIFLKNLKLFTLAESLGGFESLAELPS----------------
3d19D           RDLIEQCKIKSIIHPLLADHVFR--EADRFLEIIDMYDVHLT----------------------------
3d19C           RDLIEQCKIK----SIIHPLLADHVEADRFLEIIDMYDVHLT----------------------------
1ddzA           QTPEILWIGCSRVPANQIINLPAGQCIHSDMSFLSVLQYAVQYLKVKRVVGCAAALGDGLIDNWLRHIRD
1e5eB           EGHDIAKKQMRMYGSMITFIKSGFEGAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAG
1e5eA           EGHDIAKKQMRMYGSMITFILKGFEGAKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAG
3bwnD           DAFTLPKYPEAFCNYFGKSLESYPAFWLGTKEETDLVSELRRHKVMSRAGERC----------------G
3d19A           RDLIEQCKIKSIIHPLLADHVFR--EADRFLEIIDMYDVH------------------------------
2c7tA           QTYYGYVFRFDPVKGLNADQFCEILREKLHPPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWGLHYPVSER
3d19E           RDLIEQCKIKSIIHPLLADHVFR--EADRFLEIIDMYDVH------------------------------
2dgmE           GPYEFICTGRPDEGIPAVCFKL-KDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
3bwnA           DAFTLPKYPEAFCNYFGKSLESYPAAWLGTKEETDLVSELRRHKVMSRAGERC----------------G
2c81A           QTYYGYVFRFDPVKF-------------GGLNADQFCEILREKLNMGTFYLHPPYLPVHKNPLFCPWTKN
3ecdC           LVDLRPKGLKGAQVEQALERAG-----ITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRL
3e9kA           SVLLTGYLEYLIKHNYGVVNIITPSHVEERG-------CQLTITFSVPNKDVFQELEKRGVVCDKRNPNG
2dgkA           GPYEFICTGRPDEGIPAVCFKLKD-GEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
2dgmB           GPYEFICTGRPDEGIPAVCFKL-KDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
1ejiA           GYKIVTGGSDNHLILDLRSKGTDGGRASIACNKNTCPGDKSALRPSGLRLGTPALTSRGLLEEDFQKVAH
3bcxA           PSW---------FGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYLTNTDRIMNQ
3ecdD           LVDLRPKGLKGAQVEQALERAG-----ITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRL
1b9hA           NSHYMAMFRIPGLTEERRNALVDRLVEAGPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNDAISSDC
3ecdA           LVDLRPKGLKGAQVEQALERAG-----ITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRL
2dgkC           GPYEFICTGRPDEGIPA-VCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
3bcxB           PSWFGFPITLKEDS---------GVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYLTNTDRIMNQ
3dr7B           HVFWMYTVRLGEGL---------STTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
3caiA           PLVMLIGRP-EAQIPVVSFAV-HKVPADRVVQRLADNGILAIANTGSRVLDVLGVNDVGGA---------
3b8xB           PYLDVQQETGESSWFGFSFIIKSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNVDNA
2dgmA           GPYEFICTGRPDEGIPAVCFKL-KDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
3b8xA           PYLDVQQETGESSWFGFSFIIKSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDVLKYFDYTVHNNVDNA
1c0nA           E-QNLMHYALSQLESVPDLTLYGPQAR--LGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYY
3ecdB           LLLVDLRPKGLKGAQVEQALERAGI---TCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFEVGRL
1ax4A           GIPIQYPTGGHAVFVDCKKLVP-QIPGDQFPAQAVINALYLESGVRAVEIGSFLLGRDPATGEQKHAMEF
2ch2A           GLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIFYLYG
3bb8A           PSWFGFPITLKEDS---------GVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTR
3bn1C           HVFWMYTVRLGEGL---------STTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
2dgmC           GPYEFICTGRPDEGIPA-VCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRI---
3dr4D           HVFWMYTVRLGEGL---------STTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
3dr4B           HVFWMY---------TVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
2ch1A           GLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIFYLYG
1ecxA           GAHIITP-LEISLPNTLSVSF-PNIRGSTLQNLLSGYGIYVSTHVLDAMGVDR----------------R
1b9iA           NSHYMAMFRIPGLTEERRNALVDRLVEAGPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDAISSD
3bn1D           HVF---------WMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
3bwnB           DAFTLPKYPEAFCNYFGKSLESYPAFWLGTKEETDLVSELRRHKVM---------SRAGERC-------G
3bcaA           PISLAMTLKTIDGHHDKAVTQL----GSMLFTRQVSGARAVPLGNVQTVSGHTFRGFM-----SHADNYP
1b8gB           LVSGLQKSGISCLGLFCWVDMRHLLRSNTFEAEME---LWKKIVYEVHLNISPGSSCHCTEP--------
3bwnF           DAFTLPKYPEAFCNYFGKSLESYPAFWLGTKEETDLVSELRRHK---------VMSRAGERC-------G
1ecxB           GAHIITPLEISLPNTLSVSFP--NIRGSTLQNLLSGYGIYVSTRHVLDAMGVDRRIAQG-----------
1eg5B           AHIITPLEISLPNTLSVSFP---------NIRGSTLQNLLSGYGIYVSTRHVLDAGVD----------RR
1c4kA           KKWEDGDTEDMYWRFEKGAKWHAYEGGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHG
1c7gA           LDARRFCPHLTQDQ---------FPAQSLAASIYMETGVRSMERGIVSAGRSKETGENHRPK-----LET
3bc8A           PISLAMTLKTIDGHHDKAVTQLG----SMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNY-----P
2dr1A           GLDILAEPGH-ESPTITAVLTPPGIKGDEVYEAMRKRGFELAKG------------YGSVKEKTFRI---
2a7vA           GYSLVSGGTDNHLVLVDGARAERVLELVITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVD
2c44B           AAFVD------AGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAE-----L
2aeuA           PTGFVIKRVYKDDTINIKKLIEI---GFNLLKNYGII--------------TITVAGMPGASKSLRI---
1bj4A           NHLILVDLRSKGTDGGRAEKVLE--ACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAH
3dr4A           HVFWMY---------TVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHATDDLKIAEACGVD
3b46A           GLPYTAPEG----TYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEK
2e7jA           PHNHDLMFFHAEVLYEISKKAGGRFFLYRELKSRKIHGIKPGLTRY--FKLSTYGLSDEEVDYVLN---A
2dr1B           IGLDILAEPGHESPTITAVLTPPGIKGDEVYEAMRKRGFELAKG------------YGSVKEKTFRI---
2bwnD           GMPIIDHGSH-IVPVVIGDP---VHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
3bcbA           PIS--------LAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSH-ADNYP
3dc1D           LTGLAEWHVPA--AGMFLWIK--------VKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAP------
3bwoA           DAFTLPKYPEAFCNYFGKSLESYPAFWLGTKEETDLVSELRRHKVM---------SRAGERC-------G
2dkjA           ------------NHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIRGFTPEEMP
3bn1A           GRHV-------FWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
3bwoC           DAFTLPKYPEAFCNYFGKSLESYP---------------AFAWLGTKEETDLVSELRRHKVMSRAGERCG
2cy8A           GLNWLAYGRFSGFHLMPGLPPNTTDTGSITR-----AEVARPDVKMIAAMRMALILEGVDIGGRGSVFLS
1b8gA           LVSGLQKSGISCLGLFCWVDMRHLLRSNTFEAEME---LWKKIVYEVHLNISPGSSCHCTEP--------
2bkwA           QLTSVSRYPSNSAHGLTAVYVADPPDVIAFLKSHGVV------------------IAGGIHK-------D
2bwnB           GSH-----------IVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
2bwnA           GMPII-----DHGSHIVPVVIDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
1djpA           ----------------------------------------------------------------------
3b46B           GLPYTAPEG----TYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKEHEK
2cfbA           ISGMFGLFFTAGPVTNYEQA---------------KQSDLKKFAAFHRGMLEQGIYLAP--SQFEAG---
2c44A           GVVCQQAGGHAAFVDAGKLLP------HIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLP
3dr4C           GRHV-------FWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYALATDDLKIAEACGVD
2bwoA           GMPIIDHGSH-IVPVVIGDP---VHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
3e77A           QGFYVCPVEPQNRSKMNIPFRIGNAGDDALEKRFLDKALELNMLS---------------------LKGH
3e77C           QGFYVCPVEPQNRSKMNIPFRIGNAGDDALEKRFLDKALELNMLSLKG---------------------H
3dc1B           LAEWHVPAAGMFLWIKVKGINDVK-------------ELIEEKAVKMGVLMLPGNAFYVDSSAP------
3dydA           PGLRPVRPS----GAMYLMVGIEMEHFPEFENDVEFTE--------RLVAEQSVHCLPATCFEPNF----
1eg5A           AHIITPLEISLPNTLSVSFP---------NIRGSTLQNLLSGYGIYVSTHVLDAGVDRRIAQG-------
3e77B           QGFYVCPVEPQNRSMNIPFRIGNAKGDDALEKRFLDKALELNML----------SLKGHRSVGGIRAS--
2aevA           PTGFVIKRVYKDDTINIKKLIEI---GFNLLKNYGIITITVAMPGASKSLRIDLTSRDAERIDDNYIIKA
2c44C           AAFVD------AGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSF-LLGRDPKTGKQLPCPA----EL
1dfoB           -------------HLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIGTPAITFKEAE
2e54A           DVVADVRGM----GLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIFLPPLTVEYGEIDLAVTLKKV
1b93B           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
1dtyA           RDAEM-VADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPPYIILPQQLQRLTAVNRA
2bwoD           GMPIIDHGSH-IVPVVIGDP---VHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
1agxA           ----------------------------------------------------------------------
2bwpA           GMPIIDHGSH-IVPVVIGDP---VHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
1e9yA           ----------------------------------------------------------------------
2btwA           ----------------------------------------------------------------------
3cq6A           SDQHAAWQAFLDRGVLIR----------------------------------------------------
2bwoB           GMPIIDHGSH-IVPVVIGDP---VHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
1cj0A           GYKIVTGGSDNHLIVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALGTPALTSRGLLEKDFQKVAH
2bwnE           GMPIIDHGSH-IVPVVIGD---PVHTKAVSDMLLSDYGVYVQPINFPTVPRGTER---------------
3cq5A           GDFSDQHAAWQAF---------------------------------------------------------
2bwpB           --KALGMPIIDHGSHIVPVVIGDPVHTKAVSDML------------------------------------
3bh1C           ----------------------------------------------------------------------
2btwB           ----------------------------------------------------------------------
1bjwA           GLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSE------------
1bjnA           DFYRNDVAKRNRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRV--------------VGGMR----
1cj0B           GYKIVTGGSDNHILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALGTPALTSRGLLEKDFQKVAH
3dzzA           -VPEVKVLDSNASYLAWVDISALGNAEDFCKYLREK----------TGLIISAGNGYRGNGHEFVRINLA
3e2yA           GGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSK------------------S
3bv0B           RVC----------GAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEITQITAMVEV
3bh1D           ----------------------------------------------------------------------
3bwnE           DAFTLPKYP-EAFCNYFGKSLESY----PAFAWLGTKEETDLV---SELRRHKVMSRAGERC-------G
3cq5B           SDQHAAWQAFLDRGLRTTIGVPEEND--AFLDAAA-----------------------------------
1ay4B           -RFGFVAEH----RGMFSR---LGATPEQVKRIKE-----------EFGIYMVGD---------------
1bw9A           ----------------------------------------------------------------------
1ajsA           WNHITDQIGMFSFTGLNPKQVEYLINQKH-------------------IYLLPSGRINMCGL--------
3ei6B           GYDVY----GGKNAPYVWVHFPNQSSWDVFAEILE---------------------KTHVV---TTPGSG
3ei9B           SSWDVFAEILEKTHVVTTPGSGFGPGGEGFVR----VSAFGHRENILEACR-------------------
3d46A           ----------------------------------------------------------------------
3d6kD           GVAKWTS----PTGGYFISVDVVPGTASRVVELA--------------KEAGIALTGAGSSFPLHNDPN-
3dxvA           MELVCDRQSREPARAETAK----------------LIYRAYQLG-----LVVYYVGMNGNVLE-------
1c1xA           ----------------------------------------------------------------------
3ei9A           GYDVY----GGKNAPYVWVHFPNQSSWDVFAEILEKTHVV------------------------TTPGSG
2e7uA           LKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRT---DTELFKRFFHGLLDRGIYWPPSNF--------
2eh6A           ---ELGKGKVKGRGLMLGLELER--ECKDYVLKAL-----------------------------------
1ariA           GANRD----FSFIIKQNGMFSFSGLTKEQVLRLRE-----------------------------------
1c1dA           ----------------------------------------------------------------------
1b5oA           GLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALE----
3bh1A           ----------------------------------------------------------------------
1djeA           --QDLPFTLADSCSAIQPLIVGDNSRALQLAEKLR-----------QQGCWVT-GIRPPTVPA-------
1bs0A           --QDLPFTLADSCSAIQPLIVGDNSRALQLAEK-----------LRQQGCWVT-AIRPPTVPA-------
3e2fA           GGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKH----------KKLTAIPVSAFCDSKSK-------
2bieB           NGFYVGHAEKGSRSLMNTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGG--------------------
1c8nA           ----------------------------------------------------------------------
3ei7A           GYDVY----GGKNAPYVWVHFPNQSSWDVFAEILEKTHVV------------------------TTPGSG
3dzzB           --------ASYLAWVDISAL---GNAEDFCKYLREK----------TGLIISAGNGYRGNGH--------
2egyD           PKG----------GMFVWMELPKGLSAEGLFRRALEENVAFVPGGPFFA-------------------NG
1b4xA           GANRDFSFIIKQ-NGMFSF---SGLTKEQVLRLRE-----------------------------------
2egyB           PKG----------GMFVWMELPKGLSAEGLFRRALEENVAFVPGGPFFA-------------------NG
1ajrA           EALK-TPGTWNHITDQIGMFSFTGLNPKQVEYLIN-----------------------------------
1bxgA           ----------------------------------------------------------------------
3boxA           ----------------------------------------------------------------------
1bqaA           KGANRDFSFIIKQNGMFSF---SGLTKEQVLRLRE-----------------------------------


                         .         .         .         .         *         .         .:420
query           IKDELIRLSVGIEDEEDLINDLKQALDKIG
3e6gA           ISDALVRLSVGIEDLGDLRGDLERA-----
3e6gB           ISDALVRLSVGIEDLGDLRGDLERA-----
3e6gD           ISDALVRLSVGIEDLGDLRGDLERA-----
2cb1A           VTPGLVRVSVGLEDPLDLLALFEEALE---
2ctzA           VSPEMVRLSVGLEHVEDLKAELKEAL----
3cogD           ISDTLIRLSVGLEDEEDLLEDLDQALKAA-
1cs1A           ISETLLRISTGIEDGEDLIADLENGFRAA-
1cl1B           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
1cl1A           FSGTLIRLHIGLEDVDDLIADLDAGFARI-
3d19B           ------------------------------
3cogB           --DTLIRLSVGLEDEEDLLEDLDQALKAA-
3d19D           ------------------------------
3d19C           ------------------------------
1ddzA           VRRHNQAELSRITDPKDSLNRL--------
1e5eB           ITDGMIRLSVGIEDADELIADFKQGLDAL-
1e5eA           ITDGMIRLSVGIEDADELIADFKQGLDAL-
3bwnD           SDKKHVRVSMLSREDV--FNVFLERLANM-
3d19A           ------------------------------
2c7tA           ASGQSIVIHHAPSHLSLLVDAVAELARK--
3d19E           ------------------------------
2dgmE           ----MCRRGFEMDFAELLLEDYKASLKYL-
3bwnA           SDKKHVRVSMLSREDV--FNVFLERLANM-
2c81A           RYLKSVRKTEAYWRGLHYPVSERASGQSI-
3ecdC           ILEVFEALRTNPEGDHATEQRVRREIFAL-
3e9kA           IRVAPVPLYNSFHDVYKFTNLLTSILD---
2dgkA           ----MCRRGFEMDFAELLLEDYKASLKYL-
2dgmB           ----MCRRGFEMDFAELLLEDYKASLKYL-
1ejiA           FIHRGIELQIQSHATKATLKEFKEKLAG--
3bcxA           TFWIGIYPGLTHDHLDYVVSKFEEFF----
3ecdD           ILEVFEALRTNPEGDHATEQRVRREIFAL-
1b9hA           VWLHHRVLLAGEPELHATAEIIADAVAR--
3ecdA           ILEVFEALRTNPEGDHATEQRVRREIFAL-
2dgkC           ----MCRRGFEMDFAELLLEDYKASLKYL-
3bcxB           TFWIGIYPGLTHDHLDYVVSKFEEFFGL--
3dr7B           GLNLPTHAGLTEADIDRVIAALDQVL----
3caiA           -----VTVGLAHYSTMAEVDQLVRALASLG
3b8xB           EYKNGLFVGNHQIELFDEIDYLREVL----
2dgmA           ----MCRRGFEMDFAELLLEDYKASLKYL-
3b8xA           EYKNGLFVGNHQIELFDEIDYLREVL----
1c0nA           NVPAMCRASLAMYNTHEEVDRLVTGLQRI-
3ecdB           ILEVFEALRTNPEGDHATEQRVRREIFAL-
1ax4A           MRLTIARRVYTNDHMDYIADALIGLKEKFA
2ch2A           FKESLKATHPDYI-----------------
3bb8A           IMNQTFWIGIYHDHLDYVVSKFEEFFGL--
3bn1C           GLNLPTHAGLTEADIDRVIAALDQVL----
2dgmC           ----MCRRGFEMDFAELLLEDYKASLKYL-
3dr4D           GLNLPTHAGLTEADIDRVIAALDQVL----
3dr4B           GLNLPTHAGLTEADIDRVIAALDQVL----
2ch1A           FKESLKATHPDYI-----------------
1ecxA           IAQGAIRISLCKYNTEEEVDYFLKKIEEI-
1b9iA           CVWLHHRVLLAGEPEHATAEIIADAVGR--
3bn1D           GLNLPTHAGLTEADIDRVIAALDQVL----
3bwnB           SDKKHVRVSMLSREDV--FNVFLERLANM-
3bcaA           CAYLNAAAAIGMKMQDLFIKRLDKCLNIV-
1b8gB           ---GWFRVCFANLPERTLMQRLKAFVGE--
3bwnF           SDKKHVRVSMLSRED-----VFNVFLERLA
1ecxB           ----AIRISLCKYNTEEEVDYFLKKIEEI-
1eg5B           IAQGAIRISLCKYNTEEEVDYFLKKIEEI-
1c4kA           IIPESILFLMTPAETPAKMNNLITQL----
1c7gA           VRLTIPRRVYTYAHMDVVADGIIKLYQHK-
3bc8A           CAYLNAAAAIGMKMQDLFIKRLDKCLNIV-
2dr1A           ----GHMGYMKFEDIQEMLDNLREVINELK
2a7vA           FIDEGVNIGLEVKSKTAKLQDFKSFLLKD-
2c44B           LRLTIPRATYTQTHMDFIIEAFKHVKENAS
2aeuA           ---DLTSRDAERIDDNYIIKAIVESI----
1bj4A           FIHRGIELTLQIQSDTGVAATLKEFKERL-
3dr4A           GLNLPTHAGLTEADIDRVIAALDQVL----
3b46A           AAENLLRFAVCKDDAENAVERLKLLKDYL-
2e7jA           FKEIIEKYS---------------------
2dr1B           ----GHMGYMKFEDIQEMLDNLREVINELK
2bwnD           -----LRFTPSPVHDLKQIDGLVHAMDLL-
3bcbA           CAYLNAAAAIGMKMQDLFIKRLDKCLNIV-
3dc1D           --SPYLRASFSSASPEQMFQVLAQLIKE--
3bwoA           SDKKHVRVSMLSRED-----VFNVFLERLA
2dkjA           LVAELIDRALLEGPSEALREEVRRLALA--
3bn1A           GLNLPTHAGLTEADIDRVIAALDQVL----
3bwoC           SDKKHVRVSMLSRED-----VFNVFLERLA
2cy8A           AQHEREHVEHLVTTFDRVLDRLADEN----
1b8gA           ---GWFRVCFANLPERTLMQRLKAFV----
2bkwA           IGPKYIRIGHGVTACNKNL-PYKNCFDLI-
2bwnB           -----LRFTPSPVHDLKQIDGLVHAMD---
2bwnA           -----LRFTPSPVHDLKQIDGLVHAMDLL-
1djpA           ------------------------------
3b46B           AAENLLRFAVCKDDAENAVERLKLLKDYL-
2cfbA           ----FTSLAHTEADIERTIAAARTVLSQL-
2c44A           CPAELLRLTIPQTHMDFIIEAFKHVKENAS
3dr4C           GLNLPTHAGLTEADIDRVIAALDQVL----
2bwoA           -----LRFTPSPVHDLKQIDGLVHAMDLL-
3e77A           RSVGGIRASLYNEDVQKLAAFMKKFLEMHQ
3e77C           RSVGGIRASLYNAVTIEDVQKLAAFMKKF-
3dc1B           --SPYLRASFSSASPEQMFQVLAQLIKE--
3dydA           -----IRVVITVPEVLEACSRIQEFCEQ--
1eg5A           ----AIRISLCKYNTEEEVDYFLKKIEEI-
3e77B           -----LYNAVTIEDVQKLAAFMKKFLEMHQ
2aevA           I-VESIKMAF--------------------
2c44C           LRLTIPRATYTQTHMDFIIEAFKHVKENAS
1dfoB           AKELAGWMCDVLDSINDVIERIKGKVLDI-
2e54A           LQG---------------------------
1b93B           ------------------------------
1eghA           ------------------------------
1dtyA           VQD---------------------------
2bwoD           -----LRFTPSPVHDLKQIDGLVHAMDLL-
1agxA           ------------------------------
2bwpA           -----LRFTPSPVHDLKQIDGLVHAMDLL-
1e9yA           ------------------------------
2btwA           ------------------------------
3cq6A           ------------------------------
2bwoB           -----LRFTPSPKQIDGLVHAMDLLWAR--
1cj0A           FIHRGIELTVQIQDDTGPRATLKEFKEKL-
2bwnE           -----LRFTPSPVHDLKQIDGLVHAMDLL-
3cq5A           ------------------------------
2bwpB           ------------------------------
3bh1C           ------------------------------
2btwB           ------------------------------
1bjwA           ------------------------------
1bjnA           -----ASIYNAMPLEGALTDFMVEFERRHG
1cj0B           FIHRGIELTVQIQDDTGPRATLKEFKEKL-
3dzzA           CPKELVIDGQRLKQG---------------
3e2yA           KPHFEKLVRFCFIKKDSTLDAAEEIFRAW-
3bv0B           ARL---------------------------
3bh1D           ------------------------------
3bwnE           SDKKHVRVSMLSRED-----VFNVFLERL-
3cq5B           ------------------------------
1ay4B           -----SRINIAGLNDNT-IPILARAIIEVG
1bw9A           ------------------------------
1ajsA           ---TTKNLDYVATSIHEAVTKIQ-------
3ei6B           FGEGFVRVSAFGHRENEACRRFKQLYKH--
3ei9B           ------------------------------
3d46A           ------------------------------
3d6kD           --NENIRLAPSLPPVLEVADGFATCVLAA-
3dxvA           -----FTPPLTITETDKALDLLDRAFSEL-
1c1xA           ------------------------------
3ei9A           FGEGFVRVSAFGHRELEACRRFKQLYKH--
2e7uA           ---EAAFLSVAHREEEKTLEALRKAL----
2eh6A           ------------------------------
1ariA           ------------------------------
1c1dA           ------------------------------
1b5oA           ------------------------------
3bh1A           ------------------------------
1djeA           -GIARLRLTLTAAHEMQDIDRLLEVLHGNG
1bs0A           -GTARLRLTLTAAHEMQDIDRLLEVLHGNG
3e2fA           -PHFEKLVRFCFIKKDSTLDAAEEIFRAW-
2bieB           -----CRASIYNAVPIDACIALRELMIQF-
1c8nA           ------------------------------
3ei7A           FGEGFVRVSAFGHRENEACRRFKQLYKH--
3dzzB           ---EFVRINLACPKEIDGQRLKQGVLN---
2egyD           GGENTLRLSYATLDRE----GIAEGVRRLG
1b4xA           ------------------------------
2egyB           GGENTLRLSYATLDRE----GIAEGVRRLG
1ajrA           ------------------------------
1bxgA           ------------------------------
3boxA           ------------------------------
1bqaA           ------------------------------