[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD98930.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3csuA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2bsqE.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "2bsqH.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2dwuB.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "2a5vC.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"

## Summary of PDB Search
:362
    1e-55  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-55  25%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-54  12%  3cmvG  [x.x.x] PROTEIN RECA
    3e-52  10%  3cmvH  [x.x.x] PROTEIN RECA
    1e-50  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-50  12%  3cmvC  [x.x.x] PROTEIN RECA
    2e-47   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-47  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    1e-45  23%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-45  33%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    8e-44   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-43  10%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-43  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-43  14%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-43  13%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-43  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-42  12%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-42  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-42  18%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-42   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    7e-42  10%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-42   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-41  10%  3cmxA  [x.x.x] PROTEIN RECA
    4e-41  15%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    6e-41   8%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-41   7%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    1e-40   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-40  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-40  12%  3cmvA  [x.x.x] PROTEIN RECA
    2e-40  13%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    4e-40   9%  2akaB  [x.x.x] DYNAMIN-1
    7e-40   9%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    7e-40  20%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-39  10%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-39  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-39  14%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    3e-38  10%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-38  11%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    8e-38  18%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-38  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    1e-37   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-37  11%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-37  37%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-37  34%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-37   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    7e-37  14%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    9e-37  14%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    1e-36  13%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-36  12%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    2e-36  10%  3cmtD  [x.x.x] PROTEIN RECA
    2e-36  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-36  10%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-35  11%  3cmvE  [x.x.x] PROTEIN RECA
    2e-35  14%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-35  13%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-35  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-35  12%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-35   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-34  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-34  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-34  11%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-34  10%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-34  12%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-34   8%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    5e-34  11%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-34  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-34  10%  1aroP  [e.8.1] T7 RNA POLYMERASE
    9e-34   9%  2axzC  [x.x.x] PRGX
    2e-33  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-33  11%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-33  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-33  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-33  14%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    7e-33  11%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-32  37%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-32  12%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-32  13%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-32  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-32  13%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    4e-32  14%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    5e-32  11%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-32  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    8e-32  10%  2ctsA  [x.x.x] CITRATE SYNTHASE
    2e-31   8%  4dcgA  [x.x.x] VP39
    2e-31  14%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-31  10%  3cmwC  [x.x.x] PROTEIN RECA
    2e-31  19%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-31  12%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-31  33%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-31  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-31  11%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-31  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-31  11%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    4e-31   8%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-31   9%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    7e-31  12%  1e0jB  [c.37.1] DNA HELICASE
    7e-31   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    8e-31   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-30  11%  3da4A  [x.x.x] COLICIN-M
    2e-30  11%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-30  11%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-30  15%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-30  12%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-30  16%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-30  12%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    4e-30  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-30  11%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    5e-30  10%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-30  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-30  32%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-30   9%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    1e-29  12%  1e0jA  [c.37.1] DNA HELICASE
    1e-29  10%  1e2kA  [c.37.1] THYMIDINE KINASE
    1e-29  10%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-29  11%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-29  12%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    1e-29   9%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-29   9%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-29  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-29  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-29  11%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    4e-29  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    4e-29  13%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    4e-29  13%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-29  13%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    6e-29   8%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-29  18%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-29  12%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    9e-29  17%  2bdtA  [x.x.x] BH3686
    9e-29   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    9e-29   8%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-28  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-28  12%  421pA  [x.x.x] H-RAS P21 PROTEIN
    2e-28  13%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-28  13%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    3e-28  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    4e-28  45%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-28  11%  3dlbB  [x.x.x] ARGONAUTE
    4e-28  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-28  11%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-28  15%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-27  14%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    2e-27  13%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-27  13%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-27  15%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    3e-27  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    3e-27   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    6e-27   9%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-27  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    7e-27  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    7e-27  11%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-27  10%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-27  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-27  22%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-27  33%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-26   5%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-26  11%  2c9oC  [x.x.x] RUVB-LIKE 1
    1e-26  15%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    1e-26   8%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    2e-26   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-26  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-26   5%  2bx2L  [x.x.x] RIBONUCLEASE E
    2e-26   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-26   9%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-26  10%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    4e-26   5%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    5e-26  13%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    5e-26  11%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-26  13%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    9e-26  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-26  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-26  11%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-25  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-25  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-25  13%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-25  15%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    3e-25   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    3e-25  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-25  15%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-25  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    4e-25  11%  2a1fF  [x.x.x] URIDYLATE KINASE
    4e-25  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-25   9%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-25  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-24  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-24  11%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-24   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    4e-24  21%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-24  11%  3cmvB  [x.x.x] PROTEIN RECA
    5e-24  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-24   9%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    7e-24  13%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    8e-24  11%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    9e-24   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    1e-23  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-23  16%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-23   9%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-23  15%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-23  10%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-23   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-23  14%  1adoA  [c.1.10] ALDOLASE
    2e-23   8%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-23  12%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-23  22%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-23  16%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-23  13%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-22  13%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-22  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-22   9%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-22  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-22  18%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-22   8%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-22  11%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-22  12%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-22  19%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-22   8%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    4e-22  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-22   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    6e-22  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-22  10%  2bhvA  [x.x.x] COMB10
    7e-22  12%  2bhvD  [x.x.x] COMB10
    9e-22  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    9e-22  29%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-22  22%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-21  14%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-21  14%  1e2mB  [c.37.1] THYMIDINE KINASE
    1e-21  17%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-21  10%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-21   9%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-21  13%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-21  20%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-21  11%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-21  12%  3ec1A  [x.x.x] YQEH GTPASE
    2e-21  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-21  10%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-21  17%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-21   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    4e-21  13%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    5e-21  18%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-21   8%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    6e-21  10%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    6e-21  11%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-21  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-21  17%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    7e-21  18%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-21   9%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    8e-21  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-21  17%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-20  19%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20  14%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-20  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    3e-20  11%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    3e-20  14%  3a00A  [x.x.x] GUANYLATE KINASE
    4e-20  14%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    5e-20  12%  3cmuA  [x.x.x] PROTEIN RECA
    5e-20  11%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    6e-20  18%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-20   9%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    9e-20  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    9e-20   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    9e-20   7%  2a1fE  [x.x.x] URIDYLATE KINASE
    1e-19  18%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    1e-19  11%  1e2nA  [c.37.1] THYMIDINE KINASE
    1e-19  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-19  15%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-19   9%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-19   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-19   9%  2a1fC  [x.x.x] URIDYLATE KINASE
    3e-19  18%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-19  14%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    6e-19   8%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    6e-19  16%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    7e-19   9%  3bczC  [x.x.x] PROTEIN MEMO1
    8e-19  13%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-18  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-18  11%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  10%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-18  11%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-18   9%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-18   5%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    4e-18  13%  3bm2B  [x.x.x] PROTEIN YDJA
    5e-18  14%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    5e-18  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-18  10%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    7e-18  11%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-17  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-17  11%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-17   8%  1e2mA  [c.37.1] THYMIDINE KINASE
    1e-17  12%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-17  10%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-17  13%  2anbA  [x.x.x] GUANYLATE KINASE
    2e-17   9%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-17  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    9e-17  13%  2an9A  [x.x.x] GUANYLATE KINASE
    9e-17   8%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-16  10%  1e2kB  [c.37.1] THYMIDINE KINASE
    1e-16   9%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-16   9%  2c95B  [x.x.x] ADENYLATE KINASE 1
    2e-16  14%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    3e-16  11%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-15  11%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-15  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-15  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-15  10%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-15  10%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-15  16%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    3e-15  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-15  12%  2dftA  [x.x.x] SHIKIMATE KINASE
    3e-15  14%  3a00B  [x.x.x] GUANYLATE KINASE
    4e-15  13%  2ancD  [x.x.x] GUANYLATE KINASE
    4e-15  16%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-15  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    9e-15  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-14  19%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-14  10%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    1e-14  12%  2ancF  [x.x.x] GUANYLATE KINASE
    2e-14  10%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-14  13%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    2e-14  11%  2dftC  [x.x.x] SHIKIMATE KINASE
    2e-14  11%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-14  18%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-14  17%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-14  13%  2ancB  [x.x.x] GUANYLATE KINASE
    3e-14  13%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-14   8%  1e2lA  [c.37.1] THYMIDINE KINASE
    3e-14  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-14  11%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-13  11%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-13  11%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-13  10%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-13   9%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-13  16%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    4e-13   5%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    5e-13  10%  2c9oA  [x.x.x] RUVB-LIKE 1
    5e-13  15%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-13  16%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-13   7%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    2e-12  12%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-12  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    3e-12  14%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-12  12%  3csuA  [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
    5e-12  11%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-12  12%  2c9gA  [x.x.x] PENTON PROTEIN
    7e-12  10%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-11  11%  1e2jB  [c.37.1] THYMIDINE KINASE
    1e-11   8%  1e2hA  [c.37.1] THYMIDINE KINASE
    2e-11  15%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-11  18%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-11  12%  3dfdA  [x.x.x] PROTEIN YQBN
    5e-11  11%  3dkvA  [x.x.x] ADENYLATE KINASE
    9e-11  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    1e-10   7%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-10   6%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    1e-10  16%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    5e-10   8%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    6e-10  10%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    1e-09   6%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-09  12%  2bsqE  [x.x.x] TRAFFICKING PROTEIN A
    2e-09  16%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    2e-09  18%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-09  10%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    3e-09  11%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    5e-09  12%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    6e-09   8%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-08   9%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    2e-08   6%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    3e-08  14%  2bhvC  [x.x.x] COMB10
    7e-08  15%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-07  10%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-07  13%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    7e-07  12%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    9e-07  10%  2bsqH  [x.x.x] TRAFFICKING PROTEIN A
    1e-06  13%  2c9oB  [x.x.x] RUVB-LIKE 1
    6e-06  10%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    1e-05  22%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    3e-05  20%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    5e-05  16%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    5e-05  13%  2dwuB  [x.x.x] GLUTAMATE RACEMASE
    1e-04  22%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-04  20%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-04  20%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    1e-04  15%  2a5vC  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  22%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    4e-04  14%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    8e-04  11%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    0.001  14%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
:362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATSGDVYFDGKRI
3dmdC           IEEAVKEAVSEILETSR-RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAA---
3b5jA           --HHDITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDL
3cmvG           MRLGEDRSMDVETISTGSSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
3cmvH           MRLGEDRSMDVETISTSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
3dmdB           IEEAVKEAVSEILETSR-RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAA---
3cmvC           MRLGEDRSMDVETISTSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2dwoA           LELTQSRVQKIWVPVDH--RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGE
3b60A           --TGDLEFRNVTFTYPGEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL
2d3wB           ----MLSIKDLHVSVED-KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRYEVTGGTVEFKGKDL
2d62A           ---AEVKLINIWKRFGD-VTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLERGQIYIEDNLVADPE
2dwpA           -------------------SRVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGE
2cgtH           RNVVLDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKA
2ccgA           --------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2ccjB           --------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2c03B           LTPAEVILATVYEALKE-ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADT
2ccgB           -------------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2b8wA           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
3dm5A           ---KKEHIIKIVYEETKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDT
1e69A           ---------RLKKLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENL
2bifA           -------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQ
3eiuA           -----YARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
1bifA           -------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNV--
3cmxA           --------SMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2bjbA           MLDALQTLGLRVD-GVGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAALGSVPVTFDGDQA
2bc9A           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSH--
1e9cA           -------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2c61B           AAMNPYARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
2b8tA           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
3cmvA           --------ETISTGSLSLDIA--LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2a2zD           -------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
2akaB           --------EDLIPLVNRLQDAFSAIGQNADDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPL
1e9fA           -------------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPE
2bbsA           ---TEVVMENVTAFWEKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
2czvA           -------------------GGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKV
1e9rA           ---SGGKLKRMTREKAK-QVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2dr3A           -----------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
3b2qA           ---NPYARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
3c95A           PLAWHPENRNAVIMVDLA-GDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHC
2awnD           ----SVQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1d1cA           -------RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQ
3eiuB           -----YARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
1e9sG           -----GKLKRMTREKAK-QVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2awnB           ----SVQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
2awnC           ------------VQLQN-VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMI------------------
1e98A           -----------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
1cr4A           IREHLSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
2dr3E           ------------RRVKTIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
2a30D           -------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
1e2dA           -------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
3cmtD           ----------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2c03A           ---AEVILATVYEALKE-ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADT
1e9sF           -----GKLKRMTREKAK-QVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3cmvE           -----EDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
3bjdB           ---------------------------------------------------LPQLQNLPIEEARIVADAL
2cckA           --------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2c04A           LTPAEVILATVYEALKE-ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADT
2b92B           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
3b2qB           AAMNPYARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
1e9sJ           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2cjwB           --------------------------FGMTYYRV-VLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESA
2a30B           -------------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQST
1e9sD           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3bh0A           YEEIESADGNITGVPSG-FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEM
1e9dA           -----------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
1dhjA           ----------------------------------------------------------------------
3a1wA           ------------------------------------LAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKK
1aroP           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------NPDLFDKNFQRI
3dt2A           KKCFALRIASRLAKEEGWHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
2b8wB           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTK
2bhjA           ------------------------------------------------------IKNWGSGEILHDTLHH
2d4hB           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDT
3dffA           ---------------------------------------------TRLLAISPHLDDAV----LSFGAGL
1dekB           --------------------------------KLIFLSGVKRSGKDTTADFIMS---------NYSAVKY
2awoA           ----SVQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1dkiA           VVKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLS
2d4hA           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGWC
1e9sB           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2a2zA           -------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
2a2zB           -------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
1e4yA           ------------------------------------LLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAA
2c9yA           -------------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAM
2ctsA           ------------SSTNL-KDILADLIPKARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVEGI
4dcgA           -----ESANEVAKKLPYQGQLLGELFFQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDG
2a5gA           ------------------------------------MLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET
3cmwC           -------------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
3c8uA           ------------LAALC-QGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVV----
2axpA           ---------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAK
2awnA           ----SVQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
1e3mA           -------------------QLYEELFDLLLPHLEALQQSASLVNLAERAYTLNYTCPTFIDKPGIRITEG
3dtbB           -----ASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAMK
3czpB           -------YKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPT
1e3aB           --------------------AKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGL
2eg5G           -KNSAYNQLVLAKVKPVVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDL
2c61A           AAMNPYARLPPKDFIQT-GISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA
1e0jB           IREHLSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
2c4rL           TTFISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWE
3dt4A           KKCFALRIASRLAKEEGEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
3da4A           ADRNLVLHPGISVYDAYH----FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANI
3adkA           -------------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHGDLLRAEVSS
2d0kA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------SALHRAADWAKSVFSSAA
1cfrA           ------------------------------------IISKSGEGNKYFSKVLSGLRDFINDEAIRLGGKI
1cr2A           IREHLSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
1bg0A           --------KDVFDSIKNKKTLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHP
3b85A           --------------IRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPA
3brwA           -TKVKLECNPTARIYRLGKEHFNYYSLDTALGHLVFSLKYDVIGDQE-----------------HLRLLL
1e9rE           ---SGGKLKRMTREKAK-QVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3dt7A           -KCFALRIASRLAKEEGEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
3d31A           ----MIEIESLSRKWKN--FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDV
3d7wA           ITLLRDYVSSGSFSNN--IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYF
1e0jA           ---REHLSSSVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
1e2kA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVL
2ahwD           --------KPPRINGRVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADSIISPTGLGDRADRGIS
3be4A           ----------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLATGDMLREAIKN
2dr3B           -----------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
3dt4C           KKCFALRIASRLAKEEGEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM
2akaA           -------RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSEQ
3bb1B           -----SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPV
3cm0A           -------------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDH
2a5jA           ------------------------------------IIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVN
2c7cH           ---------GAPTITKDGVSVAREIELDKFENMGAQMVKEVASKANTVLDLKRGIDKAVTAAVEELKALS
2a30A           -------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWC
3bb1F           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
1dg3A           MTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHKP
3cddC           -----------------------------------KAGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQ
3bb1A           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
3bgwA           YEEIESADGNITGVPSG-FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEM
2bdtA           --------------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHV
1ai4B           -------------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKNWNNSP
3d3kA           ----------SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTLLCGPHVKGAQGI
1dhiA           ----------------------------------------------------------------------
421pA           ------------------------------------VVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYR
3d3qA           ------------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQG
2bofX           ----------------------------------------------------SPFVNPNMSSAEWVRNNP
2b8tB           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
2awoC           ------------VQLQN-VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
3dlbB           ---------------------------WVEGLAVYRREHARGPGWRV----------------LGGAVLD
1e9sM           -----GKLKRMTREKAK-QVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1e9sI           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1eilA           ----------------------------------------------------------------------
4atjA           -------------------------------------------------RIAASILRLHFEDCF------
1e2hB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
2dr3D           ------------RRVKGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALHP
1cr0A           IREHLSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
1cr1A           IREHLSSEESVGLLFSG-CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE
2ahvA           --------KPPRINGRVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADSIISPTGLGDRADRGIS
3bb1H           -----SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
3bpbA           -----IIARTPARSLVDGLSHLGKPDYAKALEQHNAYIRALQTDITLLPPDERFPDSVFVEDCTSRCAII
3cr7C           -----------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
3bgwD           VYEEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEM
3cddF           -----GYVDDWVPSYDESTITISGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVG
3bb1E           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2bbtB           -EGFGELFEKAKQNNNN-TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
3dhwC           ----MIKLSNITKVFHQGIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQEL
3czjA           ----------------------------------------------------------------------
2c9oC           -GLAKQAASGLVGQENACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEV
2cvfA           -------------------SLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFS
2bwjA           ------------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGLLREEL
2bkiA           IKSYQGKSLGTMPPHFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRI
1e2fA           -----------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2bx2L           ------------------------------------------LPEGMGLIVRTAGVGKSAEALQWDLSFR
2bkhA           ---------TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRI
3cddD           ----------------GGKIYQGWTKIGITRSDLETYKFNDAQYKAFIEPIKQGCTVDIGGERVITGYVD
1cjaA           --------------------------ANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIV
3dymA           ----------------------------------------------------------------------
1e59A           --------------------------VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGY
1e9rF           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2dflA           TALEVKKERMNVKKISGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAV
1b0uA           ----KLHVIDLHKRYGG-HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNI
2bbsB           ------TTEVVMENVTA-FWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKH-----
2cckB           --------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
1e9rD           ---SGGKLKRMTREKAK-QVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3d3qB           -------------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQG
2dr3C           -----------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE
2dr3F           -----------------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAEHP
2c0bL           --------------YLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHW
1draA           ----------------------------------------------------------------------
3bb1C           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2b8tC           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI
2a1fF           ----------------------------------------------------------------------
3czpA           -------YKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPT
1e9sH           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
3dm9B           -----AVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT
1bmfC           KAPGIIPRISVREPMQT-GIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
2drcA           ----------------------------------------------------------------------
3bo6B           LKTNFHSLHNQMRQMPM-SHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFA
2d3wC           ----MLSIKDLHVSVED-KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGK
3cmvB           MRLGEDRSMDVETISGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
1e9sL           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1afrA           -----------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAS
1e3mB           -------------------QLYEELFDLLLPHLEALQQSASALAELDVLVNLAERAYTNYTCPTFIDKPG
3dauA           ----------------------------------------------------------------------
2ck3C           KAPGIIPRISVREPMQT-GIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
3crmA           -------------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYR
2c5mD           ----------------------------------------------------------------------
2d4uA           ------------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNG
3bb1G           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2ausC           ----------------------------------------------------------------------
1av6A           -----PESANEVAKKLPYQGQLKLLKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDG
1adoA           ----------------------------------------------------------------------
1dekA           ------------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKNT
1e6cA           --------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHT
2d3wA           ----MLSIKDLHVSVED-KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKEG
3dfnC           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2iB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
1eamA           -------EPAKKLPYQGQLKLLLGELFQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDG
3cbnA           ----------------------------------------------------------LRYTLRARGHPN
3dfqA           ----------------------------------------------------------------------
1e2gA           -------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE
2aumA           ----------------------------------------------------------------------
1d6jB           -----------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNI
2d2eA           ----QLEIRDLWASIDG-ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGE
2boeX           ----------------------------------------------------------------------
1e9rG           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
2czvB           -----------VKFIEMDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3cr7D           -----------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
3bk7A           --------------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD----
2d3wD           ----MLSIKDLHVSVED-KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGK
3dfqD           ----------------------------------------------------------------------
1e2mB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
3dfoD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1d6jA           -----------------ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
3dfpC           ----------------------------------------------------------------------
2d2fA           ----QLEIRDLWASIDG-ETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGE
3d1mA           ----------------------------------------------------------------------
3ec1A           --------------KGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPG
1ak2A           -------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAM
3cnlA           -----KQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVK
3dfnD           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3clvA           ---------------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFC
3dfnA           ----------------------------------------------------------------------
3ch4B           -----------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPL
3d1mB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cr7A           -------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
2awoD           ----SVQLQNVTKAWGE-VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM
3dfoC           ----------------------------------------------------------------------
2ccjA           --------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG
2aumB           ----------------------------------------------------------------------
3a00A           ------------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRT
1accA           --------------QETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIFNEPNGNLQYQGKDI
3cmuA           ---------------------LDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
2aunA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3cioD           --------DSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADL
1ek0A           ------------------------------------LLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFL
3dyoA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1e2nA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPRVL
3bb1D           --RGWSGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP
2dpyB           --FNPLQRTPIEHVLDT-GVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERG
1akeA           ------------------------------------LLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAA
1dw9A           ----------------------AILLSKAKKDLSFAEIDGTGLAEAFVTAALLGQQALPADAARLVGAKL
2a1fC           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3di4A           ------------KTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLH-----NLHDLTERFFSGKT
2dpyA           --FNPLQRTPIEHVLDTGVRAI-NALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERG
3bczC           ---------------------VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYCG
3b85B           --------------------GQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPA
3b9qA           --SEIKDALKESVLEML-AKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDT
1e9sA           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1e4vA           ----------------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAA
2a5vA           ----MFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVR------
1e9sE           -----GKLKRMTREKAKQ-VTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1dp0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cueF           ---------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVE
2bbtA           -AFWEEGFGELFEKAKG-TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMI-----------MGELEPS
2bv7A           TGPFLEAVSHLPPFFD----CLGSPVFTPIKAKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGA--
1e2iA           ----------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASE--TI
3dm5B           ---KKEHIIKIVYEETKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDT
2aunB           ----------------------------------------------------------------------
1e2mA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTY-WRVL
2cdnA           -------------------------------HMRVLLLGPPGAGKGTQAVKLAEKLGIPTGELFRRNIEE
2a5vB           ----MFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVR------
2anbA           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
1c9kC           ------------------------------------VTGGARSGKSRHAEALIGDAPQVLYIATSQILHH
2bkeA           TALEVKKERNVKKISTG-SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAV
2an9A           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
1e2jA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYETIAN
1e2kB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
3c7kC           ------------------------------------LLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKP
2c95B           ---------------------------KLKKTNIIFVVGGPGSGKGTQIVQKYGYTHLSTGDLLRSEVSS
2e85B           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------TVLQTIRQQQSTLNGWVALLQTRN
3e70C           EEAVKEAVSEILETSRR--IDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT
3cnnA           -----KQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKI
1dvrA           -------------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQ
2d7vA           EEAFVAALSSCHLVFLS-IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL
2d7vB           EEAFVAALSSCHLVFLS-IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQL
3dvlD           ----------------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEVFVTFETP
1e2nB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
2dftA           ------------------------------------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQR
3a00B           ------------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRT
2ancD           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
3c15C           ----------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
3ed8A           -----IELKGT--DFKEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQ
1cjtC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNN
2cbzA           -----ITVRNATFTWARDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALL--------AEMDKVEGH
3bjqB           ----------------------------------------------------------------------
2ancF           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQFLD
3cr7B           -------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD
1ckeA           -------------------------------APVITIDGPSGAGKGTLCKAMAEALQWDSGAIYRDVASE
2dftC           ------------------------------------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQR
1e9sK           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1cjuC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
3c14C           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
2ancB           ------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTR
1ckvA           -----SNAYDGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGK
1e2lA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGAS
1culC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNN
1e2lB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
1e9rB           -----GKLKRMTREKAKQV-TVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG
1e1qB           KAPGIIPRISVREPMQT-GIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY
3cr8B           ----------------------------------------------------------------------
3bwdD           -------------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDT
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2c9oA           -GLAKQAASGLVGQENACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVEVYS
2bboA           ---TEVVMENVTAFWEEGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS
1cs4C           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNN
3cqcA           --EALKQGNAIMRKFSKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIR-------------EHLCIRAYL
3cphA           ------------------------------------LIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFK
2b8tD           -------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKS
1d8jA           ----------------------------------------------------------------------
3csuA           ---------------------------------------------------IISINDLSRDDLNLVLATA
3dmdA           IEEAVKEAVSEILETSR-RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT
2c9gA           FKARVMVSRSLTKDKQV-ELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLK-----------------
1d2zD           GCLNFPAEIKKGFKYTQDVFQIDEAANRLPPDQSKSQMSGKLNERPTVGVLLQLLVQASAADFVALDFLN
1e2jB           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY
1e2hA           ----------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWR-VL
3c85A           ------------------------------------------------------LINPGHAQVLILGGRI
3e8aC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
3dfdA           -----IDAEEVEVPISKVDKEGNVVPFIFKTTDRIDELEKENTTKELDSQRF-------YARIAVETTVY
3dkvA           ------------------------------------LMGLPGAGKGTQAERIVEKYGIPHISTDMFRAAM
3do6A           LKDDILYPYGHYIAKID-HRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLR---
1chdA           ----------------------------------------------------------------------
3cd9A           -----IELKGIDFKEDGILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTP
1azsC           ----------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN
3cddA           ------------------WTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERI
3bs4A           ----------------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISY
3cddE           -------------------EIVLKAG-GKIYQGWTKIGITRSLEASGAFDLETYK---FLGNDAQYKAFI
2bsqE           ----------------------------------------------------------------------
3cbqA           -----------------------------------MLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTY
3c7kA           ------------------------------------LLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYS
2bwjB           -------------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST---GELL
2a78A           ------------------------------------MVGSGGVGKSALTLQFMYDEFVTKADSYRKKVVL
1d6aA           -----KSRSQVQLGIDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIEN-QVKTNFNRAFNPNP
2axnA           LELTQSRVQKIWVPVDH--RPSLPRSCGPNSPTVIVMVGLPARGKTYI--------------SKKLTRYL
3ci2A           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjvC           -------------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNL
1dwmA           ----------------------------------------------------------------------
2bwjD           ---------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREE
1agpA           ------------------------------------VVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYR
2bsqH           ----------------------------------------------------------------------
2c9oB           -GLAKQAASGLVNAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEV
3dzvA           ----------------------------------------------------------------------
2bwjF           ---------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-------
3dvlC           ----------------------------LPIGRSTLVSGTSGTGKTLFSIQFLGIIEFDEPGVFVTFETP
2b0lB           ----------------------------------------------------------------------
2dwuB           ------------------------------------GVLDSGVGGLTVASEIIRQLPK--ESICYIGDNE
2ax4A           -------------------------------GCTVWLTGLSGAGKTTISFALEELVSHAIPCYSLDGDNV
2ax4B           -----------------------------FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDG
2bwjE           ----------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-------
2a5vC           ---------------DSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERV
2bwjC           ---------------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST-------
1dapA           ------FVGYEVEVNFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYKLDRNPDFTASSQIAFGRAA
1e6vC           ----------------------------------------------------------------------
2a5fA           ------------------------------------MLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET


                         .         .         *         .         .         .         .:140
query           NDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEALRMVRLDGYEDRAISEMSGG
3dmdC           ------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGR
3b5jA           ALADPNWLRRQVGVVLQDNVLLNRSLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGG
3cmvG           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIV-VDSVAALTPKAEIEGLAARMMSQA
3cmvH           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIV-VDSVAALTPKAEIEGLAARMMSQA
3dmdB           ------------SDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGR
3cmvC           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVI-VVDSVAALTPKAEIEGLAARMMSQA
2dwoA           YRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALR--------------DVKSYLAKEGGQIAVFDATNT
3b60A           REYTLASLRNQVALVSQNVHLNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGG
2d3wB           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMPEDLLTRSVNVGFSGG
2d62A           KGVFVPPKERDVAVFQSYALYPHTVYDNIAFP-LKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSGG
2dwpA           YRREAVKQYSSYNFFRPDNEEAMK--------------VRKQCALAALRDVKSYLAKEGGQIAVFDATNT
2cgtH           VAVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPY
2ccgA           VPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHL------VLKVIPALKEGKVVLCDRYIDSSLAYQGYA
2ccjB           VPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYI------DSSLAYQGYA
2c03B           QRPAAREQLRLLGEKVGVPVLEV---------------MDGESPESIRRRVEEKARLEARDLILVDTAGR
2ccgB           VPTGEEIRKI--VLEGNDMDIRTEAMLFAASRREHLVLKVIPALK----EGKVVLCDRYIDSSLAYQGYA
2b8wA           GIWMWCKPGHILVLLDTEGLGDVEKGDNQNDSWVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDF
3dm5A           WRPGAYHQLRQLLDRYHIEVFGN---------------PQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGR
1e69A           PPAGSAYVGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGG
2bifA           YRRDMVKTYKSFEFFLPDNEEGLKIRKQCAL--------------AALNDVRKFLSEEGGHVAVFDATNT
3eiuA           AMGITNEEFMSDFEKTGALERAVVFLNLADDPVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKGA
1bifA           ------------GQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNT
3cmxA           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSEARMMSQAMRKLAGNLKQSNTLLIFINQIRNP
2bjbA           RGRPIAPRELGVAVDGTGLPFRVRGNGSLAG-----------GTVAIDASASSQFVSGLLLSA--ASFTD
2bc9A           ----------TKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTI
1e9cA           RSTEIGKLLSSYLQKKS-DVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFS
2c61B           AMGITAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPAEALRQMGYPGYMYTDLATLYERAGIVKGA
2b8tA           DTRSIRQSRTGTSLPSVEVESAPEILNYIMSNSFNDETRICEVANILAENGFVVIISGLDKNFKGEPFGP
3cmvA           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALAR----------SGAVDVIVVD-------------
2a2zD           NMMYEKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW
2akaB           VLQLVNSTTEYFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDI
1e9fA           RSTEIGKLLSSYLQKKS-DVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS
2bbsA           FCSQNSWIMPGTIKENIIGVSY-------------DEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGG
2czvA           DTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIIWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPY
1e9rA           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
2dr3A           HPVQVRQNQFGWDVKPYEEKGMFAMVDAFTAGIGK---------------------EYEKYIVHDLTDIR
3b2qA           AMGIEEAQYFMSDFEKTGALERAVVFLNLADPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAE
3c95A           LDNLKILRVDAQLYNGFFSDADRAAMKIVLETRNLPALDITFVDKRIEKLLFNYRA----RNFPGTLDYA
2awnD           NDTPPAEGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAG
1d1cA           QILQANPILEAFGNAKTTRNNNSFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHI-FYQLLAG
3eiuB           AMGIEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMAMGAAGYPGYMYTDLATLYERAGIVKGA
1e9sG           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRND-------------------YDWQRYALSVVPRGKTDE
2awnB           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
2awnC           -----AGLGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
1e98A           RSTEIGKLLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS
1cr4A           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN----------DTFHLYDSFAEAETD
2dr3E           HPVQQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEY---------------------EKYIVHDLTDIR
2a30D           NVQSTNVERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW
1e2dA           RSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
3cmtD           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGARMMSQAMRKLAGNLKQSNTLLIFINQIRMK
2c03A           QRPAAREQLRLLGEKVGVPVLEV---------------MDGESPESIRRRVEEKARLEARDLILVDTAGR
1e9sF           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYD-------------------WQRYALSVVPRGKTDE
3cmvE           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVI-VVDSVAALTPKAEIEGLAARMMSQA
3bjdB           A-VHATSRQIDSAASKLAALQAYAAYQQLLYVLSLSDDVA---TAQTRRWLARAIYRVEERFPAADLSRA
2cckA           VPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPA------------LKEGKVVLCDRYIDSSLAY
2c04A           QRPAAREQLRLLGEKVGVPVLEVMDGESPES---------------IRRRVEEKARLEARDLILVDTAGR
2b92B           GIWMWCVPHPGLGDVEKGDNQNDSWIFALAVLLTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSFVSF
3b2qB           AMGITNEEAQYFDFEKTGALERAVVFLNLADDTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKGA
1e9sJ           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPR-------------------GKTDE
2cjwB           TIILLDENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEG
2a30B           NVLQMMPERWSFTFQTYACLSRIRAQLASLNDAEKPFFERSVYSDRYIFASNLYESECMNETEWTIYQDW
1e9sD           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSVVPRGKTDE
3bh0A           GK---KENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQ
1e9dA           RSTEIGKLLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFS
1dhjA           ---------------------------IAALAVDRVI----GMENAMPWNLPASLAWFKRNTLDKPVIMG
3a1wA           EGVFTYKGIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMT
1aroP           -----------------------NDFSDIELAAIPFNTLADH--YGERLAREQLALEHSYEMGEARFRKM
2axzC           EKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSS
3dt2A           KFDAGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPITSWKNK
2b8wB           GIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVT
2bhjA           KATSCNPKSLTRGPRDKPTPLEELLPHAIEFIGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIFA
2d4hB           EGLGQNVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFFVWTLRDFSLDLEADGQ
3dffA           AQAAQDGANVLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRGRFLDSIYRKL
1dekB           QLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDR--------ETNLNLTKLEVITIMEQAFCYLNGK
2awoA           NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
1dkiA           SNNPYFN-HPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSS--GSAGSS
2d4hA           VPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVRIRSKSSPDE
1e9sB           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
2a2zA           NVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNG-KEKPVLFFERSVYSDRYIFASNLYESECM
2a2zB           NVQSTNVLRWSFTFQTYACLSRIRAQLASLNGEPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW
1e4yA           VKSGSELGKQAKDIMDAGKLVTDELVIAL-------------------VKERIAQEDCRNGFLLDGFPRT
2c9yA           VASSELGKKLKATMDAGKLVSDEMVVELIEKLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFS
2ctsA           RFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTSWLSKEWAKRAALPSHVVTMLDNFPTNLHPM
4dcgA           RHHDPILNGLTLVTRFVDEEYLRSIKKQLHPSKYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIPHG
2a5gA           VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM
3cmwC           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLA
3c8uA           ---PDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLF--------DRARDIAIAG
2axpA           SGNEKLFEDEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPVRGDEYIEGK
2awnA           NDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLD---------------------
1e3mA           HPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVG
3dtbB           FDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGPLAPGVTITSWKNK
3czpB           EEERARHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQ
1e3aB           LPFEMNPKVYNPQSGYIANWNNSPQKDYPASDRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQS
2eg5G           FPNDFNSLLPSFYRKLEK-ENGRKIGSCLIGAMPGSFYSRLFPEESMHFLQVPSGLVTEIGTNKGSIYSS
2c61A           AMGNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYA
1e0jB           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT---FHLYDSFAEAETDRLLAKLA
2c4rL           AIKKAAERPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKITGEIPLF
3dt4A           KFDAGNLRAINPENGFFGVAPGTSVKTNPNAIKTITIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNK
3da4A           GLKISPKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEKYDFNASTHRGIIGESLTRLGAMFSGK
3adkA           GSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVD
2d0kA           -----------------AISLIAALAVDRVIGNE----------NALPWNLPADLAWFKRNTLNKPVIYG
3ecpA           LGDPRRTARLVNVAAQLAKYSGKSITIS-----------SEGSKAAQEGAYRFIRNP--NVSAEAIRKAG
1cfrA           SDGSFNKYEWLIGIRAIEFFNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNN-----VNLITSN
1cr2A           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQ-----------WFDELFGNDTFHLYDSFEAETD
1bg0A           PK--QWGDINTLVGLDPAGQFIISTRVRCGRSLCLTAEQYKEMEEKVSSTLSSMEDELKGTYPLTGMSKA
3b85A           VEAGEKLGF---LPGDPYLRPLHDALRDVEPEVIPKLEAAYRGRTLNDAFVILDEAQNTTPAQKFLTRLG
3brwA           RTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQK
1e9rE           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSVVPRGKTDE
3dt7A           KFAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGEGIDEPLAPGVTITSWKNK
3d31A           TDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKK---IKDPKRVLDTARDLKIEHLLDRNPLTLSGG
3d7wA           LSDA--------PAGAETQDFSGTTSSSQPFN-----GSYPDLERYAGHRDQIPLGIDQLIQSVTALRFP
1e0jA           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGND---TFHLYDSFAEAETDRLLAKLA
1e2kA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQI---------------TMGMPYAVTDAVLAPHIGGE
2ahwD           PLAQEGKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGDPRQQGGKLN
3be4A           GIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVISG
2dr3B           HPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDL----------------------TDIR
3dt4C           KFDAQGNLRAINPEGFFGVAPGTSVKTNPNAIKTIQKNTNVAETSDGGVYWEGIDEPLAPGVTITSWKNK
2akaA           QILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGSIQSYLLEKSRVVFQSETERNYHIFYQLLAGA
3bb1B           MVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIGIW
3cm0A           VARTPLGERVRPIMERGDLVPDDLILELIERVIFDGFPRTLAQAEALDRLLSETGTR-LLGVVLVEVPEE
2a5jA           IDGKQIKLAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLE
2c7cH           VPCS--DSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPY
2a30A           NVQSTNVLQWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASCMNETEWTIYQDW
3bb1F           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYLVAKAITDSFGKGIW
1dg3A           GHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFNSIGTINQQAMDQLYYVTELTHRIRSSADFVSF
3cddC           GQAVDIGGERVITGYVDDWVPSYDE-STITISVSGRDKTADTLTQIADIVCKPFGIKVIVNTDVGEIEQG
3bb1A           VMVSRSRAGFTLNIIDTPGLIENDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLAITDSFGKGIW
3bgwA           GKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNIN---------IFDKAGQSVNYI
2bdtA           VGGYLTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALR
1ai4B           QKDYPASDLFAFLWGGADRVTE-IDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQS
3d3kA           SCANHDVQVILFLPNFVKMLESITNELSLFS---KTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQ
1dhiA           ------------------ISLIAALAVDRVIGME----------NAMPWNLPASLAWFKRNTLDKPVIMG
421pA           KQVVIDGETCLLDILDTAGQEMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
3d3qA           DIGTAKVTTEEEYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISED
2bofX           ND-----PRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIILVVSNAPGRDCGAPSHSA
2b8tB           LPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGP
2awoC           NDTPPAERG----VGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGG
3dlbB           LWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPSLLDYHASKGRL
1e9sM           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
1e9sI           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSVVPRGKTDE
1eilA           -----------------------------------------RLGYLGFAVKDVPAWDHFLTKSVGLMAAG
4atjA           ---VNGCDASILLDNTTSFRTEKDAFGNAARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGG
1e2hB           WRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGHPIAALLCYPAA
2dr3D           VQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGI-------------------GKSKEYEKYIVHDLTDIR
1cr0A           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGND----------TFHLYDSFAEAETD
1cr1A           ESVEETAEDLIGLHNRVRLRQSDSLKRE-----IIENGKFDQWFDELFGNDTF-----HLYDSFAEAETD
2ahvA           PLAQEGLKWALCGHWGQSPRISDLAEQNKII---AYNYPQGVLTQTLRAAISDIGIGTFVDPRQQGGKLN
3bb1H           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAY----------RVDNL
3bpbA           TRPGAEGETEIIEETVQRFYPGKVERIEAPGTVE-------AGDIMMVGDHFYIGESARTNAEGARQMIA
3cr7C           NIRFGLNKDLGFSNIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEGLYKKAREGV
3bgwD           GKKENIKRLIVTAGSI---NAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQ
3cddF           EPFQRIQILARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAG
3bb1E           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIW
2bbtB           F------------CSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGG
3dhwC           TTLSKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGG
3czjA           -------SHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRLDNDIGVSEA
2c9oC           YSTEIKKTEMENFRRAIGLRIKETKKKEIIQDVTLHDLDEINKVVNKYIDQGIAELVPGVLFVDEVHMLD
2cvfA           PERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVVVVDSITAHYRAEENRSGLIAELSRQ
2bwjA           ASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPRKQGEEFGRRIGDPQLVICMD
2bkiA           VEANPLLEAFG--NAKTVRNNNSSRFGKFVEIHSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGA
1e2fA           RS-TEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS
2bx2L           LIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHGRPDFSSKIKLYTGEIPLF
2bkhA           V--EANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFLEKSRICVQGKEERNYHIFYRLCAGA
3cddD           DWVPSDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQI---ADIVCKPFGIKVIVNTDVGQIEQG
1cjaA           NNSDRLPIADNIMLSERGATVVPIDSKIILDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLYTG
3dymA           -------------------DFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVS
1e59A           SFDFAYTSVLKRELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDD
1e9rF           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
2dflA           YI-----------DTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAI---NTDHQIAIVDDLQELVSKD
1b0uA           NLVRDKDGQLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSDARERALKYLAKVGIDERAQGKYPVHLSGG
2bbsB           ------SGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGG
2cckB           VPTGEEIRKIVLDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAI
1e9rD           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV-------------------PRGKTDE
3d3qB           DIGTAKVTGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNEDKKQVKL
2dr3C           HPVQVRQNMAQFGW--------------------DVKPYEEKGMFAMVDAFTAGIGEYEKYIVHDLTDIR
2dr3F           VQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAG-------------------IGKSKEYEKYIVHDLTDIR
2c0bL           EAIKKAAESRPALIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKITGEIPLF
1draA           ------------------ISLIAALAVDRVIGME----------NAMPWNLPAELAWFKRNTLDKPVIMG
3bb1C           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIW
2b8tC           DSRTGTSLAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGP
2a1fF           -------------------------------------------------------------------SQP
3czpA           EEERAQPYLWRFWRHIPARRQFGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQ
1e9sH           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSVVPRGKTDE
3dm9B           FRAGA-------IEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVL----------IDTA
1bmfC           CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQY----------------------LAPY
2drcA           ------------------ISLIAALAVDRVIGME----------NAMPFNLPADLAWFKRNTLDKPVIMG
3bo6B           GDKFHISVQREQVPQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYKPDQENSQYSASSLHN
2d3wC           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFIALLKMPEDLLTRSVNVGFSGG
3cmvB           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA--VDVIVVDSVAALTPKAEIGLAARMMSQA
1e9sL           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
1afrA           DGFDEQVRELREIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTEN-SPYLGFI
1e3mB           IRITEGRHPVVEVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAAQKVEIGPIDRIFTRVGT
3dauA           ------------------ISLIAALAVDRVIGME------NAMPWNLPADLAWFKRNTL----NKPVIMG
2ck3C           CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATA----------------------SDAAPLQYLAPY
3crmA           GMDIGTAKPSRLARYPHRLIDIRDPAESYSAAEFRADALA--AMAKATARGRIPLLV-GGTMLYYKALLE
2c5mD           ----------------------------------------------------------------------
2d4uA           SWVTLNRAGIRYMMDQNNIGSGSTVAELMESALKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNA
3bb1G           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDDKLVAKAITDSFGKGIW
2ausC           --------------------------EVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINDKPPGPTSHE
1av6A           RHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPTADLLSNYALQNVMISILNPVASS
1adoA           -------------------------------------------------------------SHPALTPEQ
1dekA           DYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVI
1e6cA           SGMTVADVVPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAELQAHQRPTLT
2d3wA           IFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGG
3dfnC           ------------------------------------------------------------HSHPALTPEQ
3bv4A           ----------------------------------------------------------------ALTPEQ
2e85A           -----------------------SAVTDVLLCVGNSMMGDDGAGPLL-----AEKCAAAPKGNWVVIDGG
1e2iB           ------------WRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGG
1eamA           RH-----HDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPKIILISDVRSPSTADLLSNYALQNVMISILN
3cbnA           --VTAGHRTTFEVTVDP----EIGETADCIIGVSSSDSIAIARESLVRVILRTENGDEIRGYGHPELTLD
3dfqA           -------------------------------------------------------------SHPALTPEQ
1e2gA           RSTEIGKLLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS
2aumA           ---------------DQTWQPIDGRVALIAPA----SAIATEVLEATLRQLEVHGVDRHVEARYRYLAGT
1d6jB           RFGLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVD
2d2eA           NILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLYLSRYLNEG
2boeX           ---------------DSPFYVNMSSAEWVRNNPNDPR--TPVIRDRIASVPQGTWFA---HHNPGQITGQ
1e9rG           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSVVPRGKTDE
2czvB           VRDTVQKSYLIYVESNDLRVIRYSIEKGVDAIIWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPY
4dfrA           ------------------ISLIAALAVDRVIGME------NAMPWNLPADLAWFKRN----TLDKPVIMG
2bhvA           ------------TITADKMIPALITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKGE
2bhvD           ------------TITADKMIPAFLITPISSIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMG
3cr7D           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFAFISPYRKDRDTARQLHEVAEETGLPFVEGLYKKAREGV
3bk7A           -------LTVAYKPQYIKAEYEGTVYELLSK----IDSSKLNSNFYKTELLKPLGIIDLYDRNVEDLSGG
2d3wD           DLLALSPEDRAGEGQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFIALLKMPEDLLTRSVNVGFSGG
3dfqD           -------------------------------------------------------------SHPALTPEQ
1e2mB           WRVLGASETIANIYTTQHRLDVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAPAA
3dfoD           -------------------------------------------------------------SHPALTPEQ
2a1fD           ----------------------------------------------------------------------
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEV-------AKLFADSNSIAITSFISPYRKDRDTARQLHEVATPG
3dfpC           ------------------------------------------------------------HSHPALTPEQ
2d2fA           NILELSPDERARKFQYPVEVPGVTIANFLRLALQAVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGG
3d1mA           ------------------------------------------------YKQFIPNVAEKTLGASGRYEGK
3ec1A           TDMIEIPLESGATLYDTPGIINHHQMAHFVDARDLKITPKREIHPRVYQLNEGQTLFFGGLARLDYIKGG
1ak2A           VASGSELTMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFS
3cnlA           ILDTPYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGG
3dfnD           ------------------------------------------------------------HSHPALTPEQ
1bglA           ------------------------------------------------------------------VSEA
3clvA           NENLCNKFDIWDTAGQERYASIVPLYYRGATCAIVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKID
3dfnA           -------------------------------------------------------------SHPALTPEQ
3ch4B           KEQYEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRREQSRQQRGWVFTPGV
3d1mB           ------------------------------------------------YKQFIPNVAEKTLGASGRYEGK
5dfrA           -------------------------------------AALAVDRVIGPWNLPADLAWFKRNTLDKPVIMG
1dyhA           ------------------ISLIAALAVDRVIGME------NAMPWNLPADLAWFKRN----TLDKPVIMG
1aldA           ------------------------------------------------------------YQYPALTPEQ
3dfpD           -------------------------------------------------------------SHPALTPEQ
3b55A           ---------------------------------------------YNTNQIAKWLEAHAKPLKTTNPTAS
1drbA           ------------------ISLIAALAVDRVIGME----------NAMPWNLPACLAWFKRNTLDKPVIMG
3dftD           -------------------------------------------------------------SHPALTPEQ
3cr7A           NIRFGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEGLYKKAREGV
2awoD           NDTPPAERGVGMVEALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY
3dfoC           -------------------------------------------------------------SHPALTPEQ
2ccjA           VPTG------EEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYA
2aumB           ---------------DQTWQPIDGRVALIAPASAIAT----EVLEATLRQLEVHGVDYHVEARYRYLAGT
3a00A           PRAGEVNGKDYNFVSVDEFKSMIKNNEFI----------EWAQFSGNYYGSTVASVKQVSKSGKTCILDI
1accA           TEFDFN-------FDQ-------QTSQNIKNQLAELN------ATNIYTVLDKIKLNAKMNILIRDHYDR
3cmuA           ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA--VDVIVVDS--VAALTPKAEIEGEIGDSH
2aunA           ---------------DQTWQPIDGRVALIAPA----SAIATEVLEATLRQLEVHGVDYHVEARYRYLAGT
3dftC           -------------------------------------------------------------SHPALTPEQ
3cioD           RRGYSHNHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNELLMRDRMRQLLEWANDHYDLVIVDTP
1ek0A           TQRVTINEHTVKFEIWDTAGQERPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKVGNKIDLQEG
3dyoA           -------SHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVS
2a1fE           ----------------------------------------------------------------------
6aldA           -------------------------------------------------------------SHPALTPEQ
1e2nA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHP
3bb1D           VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDKLVAKAITDSFGKGIWSKRSEALLQV
2dpyB           REVKILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAQREIALAIGE
1akeA           VKSGSELGKQAKDIMDAGKLVTELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVEFD
1dw9A           DLDEDSILDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGK
2a1fC           -------------------------------------------------------------------SQP
3dfqC           -------------------------------------------------------------SHPALTPEQ
1bccF           -LEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILPK---EQ
3di4A           RALHGTHVTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHTGLPLH
2dpyA           REVKILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMREIALAIGE
3bczC           SCAAHAYKQVDPSITRRIFILGPSHHVPLSRCADIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHS
3b85B           VEAGEKLGFL---PDPYLRPLHDALRDVEPEV-IPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPA
3b9qA           FRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDV-----VLCDTSGRLHTNYSLMEEL
1e9sA           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
1e4vA           VKSGSELGKQADIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEF
2a5vA           DVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVALMARSSAISERIAGGSLAIV----------------
1e9sE           DMLSKFGRDKDIILNPYDQRTKGWSFFNE---IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETA
1dp0A           -------------------CIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEA
3bm2B           -------------ALELLIN-RRSASRLAEPAPT---------GEQLQNILRAGRAPDWHFEQGAIAAGS
3cueF           LDGKTVKLQIWDTARTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLK
2bbtA           EGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGG
2bv7A           -------------TLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKK------YHG
1e2iA           ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPAALLCY
3dm5B           WRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG----------------VDIIIVDTAG
2aunB           ---------------------WQPIDGRVAL-IAPASAIATEVLEATLRQLEVHGVDYHLEARYRYLAGT
1e2mA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAG-----------SP
2cdnA           GT--KLGVEAKRYLDAGDLVPSDLTNELVDDRLNANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEF
2a5vB           DVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVALMARSSAISERIAGGSLAIVGVYQLDDGRAVLRDHI
2anbA           QPRPGEVHGEHYFFVNHDEFKE-MISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQI
1c9kC           KDGR--PAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPEQWDYAERAIDDEIQILIAAC
2bkeA           YIDTEGTFRWERIENAKALGLDIDNVNNIYYI----------------RAINTDHQIAIVDDLQELVSKD
2an9A           QPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQ-VLATGVDVFLDIDWQGAQQI
1e2jA           IYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTL-IFDRHPIAALLC
1e2kB           WRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTS------------AQITMGMPYAVTDAVLAPHIGG
3c7kC           VV-----------YSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMR
2c95B           GSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVD
2e85B           -----------------------SAVTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGN-----WVVIDGG
2d4uB           T---LNRAGIRYMMDQNNIGSGSTVAELMESALKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNA
3e70C           FRAGAIEQLEEHAKRIGVKVIKHSYGADPAA---------------VAYDAIQHAKARGIDVVLIDTAGR
3cnnA           LDGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGG
1dvrA           IAKGTQLGLEAKKIDQGGLVSDDIMVNMIKDELTNNGFILVGFPRTIPQAEKLDQMKEQGTPLEKAIELK
2d7vA           EKHHLAHENC---------FIANSVETEVVTEI-------------------------------------
2d7vB           EKHHLAHENC---------FIANSVETEVVTEI-------------------------------------
3dvlD           QDIIKNARSFGWDLAKLVDEGKLFILDASPD-------------PEGQEVVGGFDLSALIERINYAIQKY
1e2nB           SETIANIYTTQHRLDQGEISAGDAAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYA
2dftA           TGRSIADIFATDGEQEFRRIEEDDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNDRAEK
3a00B           PRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASV----------KQVSKSGKTCILDI
2ancD           QPRPGEVHGEHYFFVNHDEFKE-MISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQI
3c15C           NLKEAIETIVAAMSNLVPPVELANPENQFRV---------------------------------------
3ed8A           QNTP--IGDGPVLLPDNHYLSYQTVLSKDPN--------EKRDHMVLLEFVT------------------
1cjtC           LKEAIETSNLVPPVELANPENQFRVDYILSV---------------------------------------
2cbzA           VAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGG
3bjqB           ----------------------------------------------------------------------
2ancF           IDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDT
3cr7B           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSTSFISPYRKDRDTARQLHEVETGLPFVVAE-QRD
1ckeA           DALVPLASHLDVRFVSTNGNLEVILEGEDVS----GEIRTQEVANAASQVAAFPRVREALLRRQRAFREL
2dftC           TGRSIADIFATDGEIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRDRAEK
1e9sK           DMLSKFGRDKDIILNPYDQRTKGWSFFN-------------------EIRNDYDWQRYALSVVPRGKTDE
1cjuC           NLKEAIETIVAAMSNLVPPVELANPE--------------------------------------------
3c14C           NLKEAIETIVAAMSNLVPPVELANPENQFRV---------------------------------------
2ancB           QPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNY-YGTSREAIEQVLATGVDVFLDIDWQGAQQI
1ckvA           IEVDCDEELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSELMG-------------------------
1e2lA           ETIANHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIA--ALL
1culC           LKEAIETIVAAMSNLVPPVELANPENQFRVD---------------------------------------
1e2lB           WRVLGASETIANIFTTQHRLDQGEISAGDAA--------VVMTSAQITMGMPYAVTDAVLAPHIGGEAGS
1e9rB           DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKL
1e1qB           CIYIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIRPPGRE
3cr8B           ------------------------------------------------YGGTLVNLIDPEKREALKHEAL
3bwdD           AGEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFDHA
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2c9oA           TEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFESLQKERVEA
2bboA           FCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLA
1cs4C           LKEAIETINLVPPVELANPENQFRVDYILSV---------------------------------------
3cqcA           EAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFV
3cphA           IKTVDINGKKVKLRFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM
2b8tD           IRNIQSRTGTSILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGP
1d8jA           --------------------------------------------AKIVNYMKTRHQRTLDLDETQHLDIG
3csuA           AKLKANPKVIASCFFEASTRTRLSFETSMVVGFSDSGKKGETLADTISVISTYVDAIVMRHPQARLATEF
3dmdA           FRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGR---------------
2c9gA           ----------------------------------------------------------------------
1d2zD           ESTPARPVLISLELLE------------------------------------------------------
1e2jB           WRVLGASETIANIYQHRLDQGEISAGDAAVVMTSANITMGM-PYAVTDAVLAPHIGGEAGSPPPALTLIF
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE----------AGSPP
3c85A           GTGAYDEGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHTALEQLQRRNY
3e8aC           NLKEAIETIVAAMSNLVPPVELANPENQ------------------------------------------
3dfdA           PTFKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAI---------------------------------
3dkvA           KEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTV-------------------
3do6A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3cd9A           IGDGPVLLPDN-HYLSTCSALSKDPNEKRDH---------------------------------------
1azsC           NLKEAIETIVAAMSNLVPPVELANPENQFRV---------------------------------------
3cddA           TGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPFNNQTLTQIADIVCKPFGIKGEPFQRIQ-IEQG
3bs4A           PLQLIIRIRFGVDVIKYLENHRLAIVDTFSFHGIMPGVWYLEGMLSSETLPIKYAVEDHKKVWMDLNLFE
3cddE           EPIKQGQAERVITGYVDDWVPSYDESTISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPF--G
2bsqE           -----------------ASVVIRNLSEATHNAIKFGRSTEAEIRLILDNIAKAQQTVRLGSMLGQEIGGV
3cbqA           ERRIMVDKEEVTLVVYDIWEQRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGA
3c7kA           NTIQSLAAIVRAMDTLGVEYGD------------------------------------------------
2bwjB           REELASESERSKLIRDIDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPRKQGEEFGRRIGDPQLVICMD
2a78A           DGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPNKSDLE
1d6aA           KVLNLGKISTAIHDAKNGVLPKPLELVDAS--------GAKWIVLRVDEIKPDVAL--------------
2axnA           NWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNT
3ci2A           ----------------------------------------------------------------------
2dx7A           --------------------------------------------------LLATTGTIVSGVYEKEFSKY
2bhvC           DKMIPAFLITPISSQIAGKV-IAQVESDIFAHMG--------------KAVLIPKGSKVIGYYSNNNKME
1cjvC           KEAIETIVAA--MSNLVPPVEL------------------------------------------------
1dwmA           ----------------------------------------------------------------------
2bwjD           LASESERSKLIRDIMERDLVPSGIVLELLKEA--------------------------------------
1agpA           KQVVIDGETCLLDILDTAGQEEYSAMRFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
2bsqH           -----------------------ATHNAIKFRARAGRSTEAEIRLILDNIAKAQQTVRLGSMLGQEIGGV
2c9oB           YSTEIKKTEVLM-ENFRRAIGLRIKETKEVYEGEVTELTPC-----------------------------
3dzvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3dvlC           QDIIKNARSFGWDLAKLVDEGKLFILD----------ASPDPEGQEVVGGFDLSALIERINYAIQKY---
2b0lB           ----------------------------------------------------------------------
2dwuB           RCPYGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAATL-AALQEALSIPVIGVIHARAATIQSNM
2ax4A           FSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDNARKIHESAGLPFFEIFVDAPLNICESRDVKG
2ax4B           FSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDNARKIHESAGLPFFEIFVDAPLNICESRDVKG
2bwjE           ----------------------------------------------------------------------
2a5vC           ------APSVLLGRRDGLSRVQRHVHETVAILMARSSAISERIAGG------------------------
2bwjC           ----------------------------------------------------------------------
1dapA           HMKQQGQSGAFTV---------------------------------------------------------
1e6vC           -------------------------------------------------------------------YMN
2a5fA           VTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADELHRIINDREMRDAIILIFANKQDLPDAM


                         +         .         .         .         .         *         .:210
query           QRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELRSLQKKLGITFIFITHDQEEALAMSDEIFVL
3dmdC           SETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISY
3b5jA           QRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAHRLSTV-KNADRIIVM
3cmvG           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
3cmvH           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
3dmdB           SETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISY
3cmvC           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQIL
2dwoA           TRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPD-YKDCNSAEAMDDFMKRISCYEASY
3b60A           QRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK--NRTSLVIAHRLSTI-EQADEIVVV
2d3wB           EKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSF--IIVTHYRILDYIKPDYVHVL
2d62A           QRQRVALGRAIIRRPKV-FLDEPLSNLDAKLRVKRA-ELKKLQRQLGVTTIYVTHDQVE---ATGDRIAV
2dwpA           TRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPD-YKDCNSAEAMDDFMKRISCYEASY
2cgtH           FINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKV
2ccgA           RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQ-NRLDQEDLKFHEKVIEGYQEIIHN
2ccjB           RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRE-RIIKNNRLDQEDLKFHEKVIEGYQEIIQRFKSV
2c03B           LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARH
2ccgB           RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIEGYQEIIHSQRFKSV
2b8wA           VWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLA
3dm5A           HKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVA
1e69A           EKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK--HTQFIVITHNK-IVMEAADLLHGV
2bifA           TRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPD-YVNRDSDEATEDFMRRIECYENS-
3eiuA           KGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV------ARELHRKGIYPPINVLPSLSRLMNSGIGA
1bifA           TRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPD-YVNRDSDEATEDFMRRIECYENSY
3cmxA           ETTTGGNALKF-YASVRLDIRRIGAVKEGENVVGSETRVK------VVKNKIAAPFKQAEFQILYGEGIN
2bjbA           GLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAA-VV
2bc9A           NQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADTPDEYLTYSLKLKKGTSQKDETFNL
1e9cA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERY-----ENGAFQERALRCFHQLMKDTTLNWKMV
2c61B           KGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH------RKGIYPPINVLPSLSRLMNSGIGA
2b8tA           IAKLFTYADKITKLTAICNECGAEA-------THSLRKIDGKHADYNDDIVKIGCQEF--YSAVCRHHHK
3cmvA           -----SVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDI
2a2zD           HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNELEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
2akaB           EFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQ--GQRTIGVITKLDLMDEGTDARDVL
1e9fA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERHQLMKDTNWKMVDASKSIEAVHEDIRVL-SE
2bbsA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMA--NKTRILVTSKMEHLKKADKILIL
2czvA           ERANLAWKLVEKYKVRRFLTSSAQEKWD----VRYPRDLISLGVVIGMEIPQAKASISMY----------
1e9rA           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
2dr3A           EFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSLQLKRVLAGTGCTSIFVSQVSGFGEHGVDGIIRL
3b2qA           ALRQMGAARN---EVPGRRGYPGYMYTDLATLYERAGIV--KGAKGSVTQIPILSMPGDDITHPIPDLSG
3c95A           EQQRWLEHRRQVFTPE--FLQGYADELQMLVQQYADKEKVALLKALADEIV-------------------
2awnD           RVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGI
1d1cA           ATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA---MDIVGFSQEEQMSIFKIIAGILHL
3eiuB           KGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR------ELHRKGIYPPINVLPSLSRLMNSGIGA
1e9sG           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTESLFAGSNEASKALTSARFVL
2awnB           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2awnC           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
1e98A           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA-----FQERALRCFHQLMKDTTLNWKMV
1cr4A           RLLAKLAYMRSGLGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVICHLGGALRQLSDTIIAL
2dr3E           EFIEVLRQAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTGCTFVSQVSVGPGVEHGVDGIIRL
2a30D           HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNELEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
1e2dA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE------RALRCFHQLMKDTTLNWKMV
3cmtD           NPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGS-----ETRVKVVKNKIAAPFKQAEFQILYGEGIN
2c03A           LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDAGGAALSARHV
1e9sF           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVL
3cmvE           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
3bjdB           LEQEIAAQSRERHPSQYVFGSASRAQLQVFLRHQWFRTFRLYRDAA--DLLVNLTDVDEA-AALARYLYG
2cckA           QGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSQEDLKFHEKVIEGYQEIIRFKSVN
2c04A           LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGALSARHV
2b92B           FPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLCIRKFFPKKKCFVFDRPVHRRKL
3b2qB           KGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA------RELHRKGIYPPINVLPSLSRLMNSGIGA
1e9sJ           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTESLFAGSNEASKALTSARFVL
2cjwB           RAAVVFDCKFIETSAAVQHNVK--------------------ELFEGIVRQVRLRRDSKE-KNERRLAYQ
2a30B           HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNELEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
1e9sD           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGAESLFAGSNEASKALTSARFVL
3bh0A           TKRKNPGKRVIVMIDYLQLLEPAKANDSRTNISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPML
1e9dA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERY-----ENGAFQERALRCFHQLMKDTTLNWKMV
1dhjA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
3a1wA           AIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY----------------------------
1aroP           FERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPE-AVAYITIKTTLACLTSADNTTVQA
2axzC           IIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFIKNISINGYYDLEIYQFLTDKNIDS
3dt2A           EWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGGRRPAGVPLVYEALSWQHGVFVGAAMAAE
2b8wB           ELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFF
2bhjA           TKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRL
2d4hB           PLTPDEYLTSLKLKKGTSVFDRPVHRRKLAQLEKQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVN
3dffA           PDGRWLTAHVEGRQKLAVNDHSPDSDHDL--VGEVADDIRSIIDEFDPTLVVTCAAIGE---HPDHEATR
1dekB           SPIKGVFVFDDE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLD
2awoA           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
1dkiA           RVQRALKENFGYNQSVHQINRGDFS-------KQDWEAQIDKELSQNQPVYYQGVGK-----VGGHAFVI
2d4hA           SADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLTFNLPRLCIRKFFPKKKCFVFDRPVHRRKLA
1e9sB           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
2a2zA           NETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLL
2a2zB           HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNELEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
1e4yA           IPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDV---TGEELTTR
2c9yA           IPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKD---DITGEPLIRRSDDNEKALKIRLQAYHTQTTP
2ctsA           SQLSAAITALNSESNFARAYAEGIHRTKYWELIYEDDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWS
4dcgA           NKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKYLNKIVRNKVVVNFDYPN-----QEYDYF
2a5gA           KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN----------------------------
3cmwC           ARMMSQA-------MRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGA
3c8uA           AAEVGPECRVAIIEGNYLLFDAPGWRDLTAIVSIRLEVPADLEARLVQRWLDHGLNHDAAVARAQGNDLA
2axpA           DIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDIIFL-------------------------------
2awnA           ---------------------EPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
1e3mA           FVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENANKIKALTLFATHYFELTQLPEKEGVAN
3dtbB           EWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIFGGRRPAGVPLVYEALSWQHG-VFVGAAMRS
3czpB           TQERF-KEREKTPYKRYKITEEDWRNRDKWDQY-----VDAVGDVDRTSTEIAPWTLVEANKRFARVKVL
1e3aB           DPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNV-WLTSMLKRTVVAAVPMPFDKWYSASGYETTQDG
2eg5G           KASRLPVQKAYLDQFTKDFTTF----LRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVE
2c61A           EALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDI-THPIPDLSGYIT
1e0jB           YMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRP
2c4rL           SHYQIESQIESAFQREGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQIDMTPVRHQRAVE
3dt4A           EWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGGRRPAGVPLVYEALSWQHGVFVGAAMAAE
3da4A           EYQILLPGEIHIKES-------------------------------------------------------
3adkA           AGPETMTKRLLKRGETSGRVDDNEETIKKRLE-TYYKATEPVIAFYEKRGIVRKVNAEGSVDDV------
2d0kA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYLT
3ecpA           AMQTVKLAQE----FPELLAIEDTTS--LSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGL
1cfrA           PDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRLQLA
1cr2A           RLLAKLAYMRSGLGCDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHLKSGARQLSDTIIAL
1bg0A           TQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFEDHLRIISMQKGGDLKTVYKRLVTAVDN
3b85A           FGSKVVTGDGLRLVR-HILRGVDDVHFSELTSSDVVRHVGHIVDA-------------------------
3brwA           LGATSEEEL-FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGTHGQTGTESVYCNFRNKEIMFEGDAQQLQ
1e9rE           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVL
3dt7A           EWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRRPAGVPLVYEALSWQHGVFVGAAMAAE
3d31A           EQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAVV
3d7wA           GGQTKTQARSIL--ILIQMISEAARFNP--ILWRARQYINS-----GASFLPDVYMETSWGQQSTQVQHS
1e0jA           YMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRP
1e2kA           AGPPPALTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG
2ahwD           EVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVM-M
3be4A           RCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGILKRVN
2dr3B           EFIEVLRQAIRDINAKRVVVDSVTTLYINAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVHG
3dt4C           EWRPQDEEPCAHPNSRFCTPASQCPIIDSPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMAAE
2akaA           TAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFK----ITRQAMDIVGFSQEEQMSIFKIIAGILHL
3bb1B           NKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLA-SDIPVVLIENSGRCNSDEKVLPNGIAW
3cm0A           ELVRRILRRAE-LEGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAAL--
2a5jA           SRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF------------------
2c7cH           FINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKV
2a30A           HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNELEKLHYKHESWLLHRTLKTNFDYLQEVPILTL
3bb1F           NKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKD--IPVVLIENSGRCNKNDSDEK--VL
1dg3A           FPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPE
3cddC           ETPHELLARLAK-QRGVLLTSDTFGNLV----ITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIK
3bb1A           NKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVR---SGASLKSDIPVVLIENSGRCNKNDSDEK-VL
3bgwA           WSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQMARELDVVVIALSQLSRQVEQRQDKRPML
2bdtA           KKGERCLELV--EEFESKGIDERYFYNTSHLQPTNLNDIVKNLKT-NPRFIF------------------
1ai4B           DPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRT-VVAAVPMPFDKWYSASGYETTQDG
3d3kA           PWYKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGL-PLPLGEHA-GRIYLCDIGIPQQVFQEVGINYHS
1dhiA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
421pA           AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQ-------------------------
3d3qA           KKYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKRKKVQQFTENYDTLLIGIESRETLYLRINKRVDIL
2bofX           YRSWIDEFAAGLKNRPAYIIVEPDLISLQHVQQEVLETMAYAGKALGSSQARIYFDAGHSAWHSPAQMA-
2b8tB           IAKLFTYADKITKLTAICNECGAEATHSLRKIDGK--------HADYNDDIVKIGCQEFYSAVCRHH-HK
2awoC           QRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
3dlbB           QGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVR
1e9sM           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1e9sI           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTESLFAGSNEASKALTSARFVL
1eilA           SAGDAALYRADQRAWRIAVQPGELDDLAYALEVDDAAALERMADKLRQAGVAFTRGDEA--LMQQRKVMG
4atjA           PSWRVPLGRRDSLQAFNANLPAPFFTL-PQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNF
1e2hB           RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANT--VRYL
2dr3D           EFIEVLRQAIRDINAKRVVVDSVTTLYKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGEHG
1cr0A           RLLAKLAYMRSGLGCDVIILDHISIRKMID---NLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIAL
1cr1A           RLLAKLAYMRSGLGCDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHGSGALRQLSDTIIAL
2ahvA           EVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQ
3bb1H           DKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDSDIPVVLIE
3bpbA           ILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQ-DFNIIEIPEE----ESYAANCIWV
3cr7C           IKEFTGISAPYE-APANPEVHVKNYELPVQDAVK---QIIDYLDTKGY----------------------
3bgwD           TKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQIQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPML
3cddF           IKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQGKLWNINTLVPVI
3bb1E           NKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSG--RCNKNDSDEKVL
2bbtB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMA-NKTRILVTSKM-EHLKKADKILIL
3dhwC           QKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVI
3czjA           TRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
2c9oC           IECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIR
2cvfA           KHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKP-GLRVAVLERHRFRPEGLMAYFRIT
2bwjA           CSADTMTNRLLQMSRSSLPVDDTTKTIAKRLE-AYYRASIPVIAYYETKTQLHKINAEGTPEDVQLCTAI
2bkiA           SEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRM-----
1e2fA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGERYENGAFQER-----ALRCFHQLMKDTTLNWKMVD
2bx2L           SHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDI---EETAFNTNLEAADEIARQLRLR
2bkhA           SEDIRERLHLSPDNFRYLNRGCTRYFANKETDQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKI
3cddD           ETPHELLARLAK-QRGVLLTSDTFGNLVITRASKTK---AGVSLILGDNVKAARGRF-SWRQRFSKFTIK
1cjaA           YD--VGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESLQKCPQAIPFILRM--------------
3dymA           EATRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
1e59A           ERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWN-ETILPRMKSGERVIIAAHGN-SLRALVKYLDNM
1e9rF           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
2dflA           PSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRIQL
1b0uA           QQQRVSIARALAMEPDVLLFDEPTSALDPELVG-EVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFL
2bbsB           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMA-NKTRILVTS-KMEHLKKADKILIL
2cckB           NGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDTYQT---
1e9rD           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVL
3d3qB           KLKELEHLNNNKLHEYLASFDESAKDIHPNNRKRVLRAIEYYLKNYDTLLIGIESRETLYLRINKRVDIL
2dr3C           EFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMSIILQLKRVLAGTGCTSIFVSQVSGVE-HGVDGIIRL
2dr3F           EFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIQLKRVLAGTGCTSIFVSQVSGGVEHGVDGIIRL
2c0bL           SHYQIESQIESAFQREVRLPSGGSIVIDINSARDIEETAFNTNLEAEIARQLRLRDLGGVIDFIDMTPVR
1draA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
3bb1C           NKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVR---SGASLKSDIPVVLIENSGRCNKNDSDEKVLP
2b8tC           IAKLFTYADKITKLTAICNECGAEATHSLRKIDGKH--------ADYNDDIVKIGCQEFYSAVCRHHHKV
2a1fF           IYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEM-GVEVSVVLGGGNLFRGAKLAKAGM
3czpA           TQERF-KEREKTPYKRYKITEEDWRNRDKWYVDAVGDVDRTS-TEIAPWTLVEANDKRFA----------
1e9sH           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRLEGTLAESLFAGSNEASKALTSARFVL
3dm9B           GRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISY
1bmfC           SGCSMGEYFRDNGKHALIIYDDLSKQAV--AYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAF
2drcA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
3bo6B           TRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQALREEPFYRL-------
2d3wC           EKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRS--FIIVTHYQR-ILDYIKPDYVHVL
3cmvB           MRKLAGN-LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVIAAPFKQAEFQIL
1e9sL           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1afrA           YTSFQERATFISHGNTARQAKEHGDIKLAQICGTIA-------ADEKRHETAYTKIVEKLFEIDPDGTVL
1e3mB           FVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACENLANKIKALTLFATHYFELTQLPEKEGVAN
3dauA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
2ck3C           SGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRP--PGREAYPGDVFYLHSRLLERAAKMNDAF
3crmA           GLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPAVGYRQVWDYLDGKLSY
2c5mD           -KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYVIRKGDYLGKTVQVVPHITDAIQEWVMRQALE
2d4uA           LAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQN-DRLHDIAVSDNN---------------
3bb1G           NKAIVALTHAQFSPPDGLPYDEFFSKRSE----ALLQVVRSGASLSDIPVVLIENS-GRCNKNDSDEKVL
2ausC           VVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPA-GKEYVALMHLH-GDVPEDKIRAVM
1av6A           LKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYVRNKVV
1adoA           KKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1dekA           NNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATV
1e6cA           GRPIAEEMEAVLREREALYQDVAHYVVDATQPPAIVCELMQTMR--------------------------
2d3wA           EKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVL
3dfnC           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
3bv4A           KKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
2e85A           SAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP------DDIAEMFMMTTHNMPLNYLIDDIGEVI
1e2iB           EAHAPPPALTLIFDRHPILLCYPAARYLGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHI-DRLAKR
1eamA           PVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYY
3cbnA           HPTDIVCRKSDYICSRTLIRADKAAFDLDE-------NLVRDLR--KGRELKVEIIVEYE----------
3dfqA           KKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1e2gA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF---------QERALRCFHQLMKDTTLNWKMV
2aumA           VEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI-------SVLLSAFH
1d6jB           VPVEVAEQRAPYEAPANPEVHVKNYELPVQ---DAVKQIIDYLDTKGY----------------------
2d2eA           EKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVM
2boeX           VDALMSAAQAAGKIPILVVSNAPGRDCGHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQE
1e9rG           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLALFAGSNEASKALTSARFVL
2czvB           ERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEIIL---------
4dfrA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
2bhvA           YRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPAFGDYLLMQLMRQSGMGINQVVNQI-LR
2bhvD           YRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVITFGDYLLMQLMRQSGMRDKSKIAPIVVI
3cr7D           IKEFTGISAPYE-APANPEVHVKNYELP--VQDAVKQIIDYLDTK-GYL---------------------
3bk7A           ELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIVF
2d3wD           EKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVN--SLRDGKRSFIIVTHYQRILDYKPDYVHVL
3dfqD           KKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1e2mB           RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRY---
3dfoD           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
2a1fD           ---QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEM-GVEVSVVLGGGNLFRGAKLAKAGM
1d6jA           EETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLDTKGY----------------------
3dfpC           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
2d2fA           EKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVM
3d1mA           ITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVGVKLRVTEGWDEDGHHSEESLH--
3ec1A           RRSFVCYMANELTVHR-TKLEKADSLYANQLGELLSPPSKRYAAE---FPPLVPRSLSVK-ERKTDIVFS
1ak2A           IPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEY
3cnlA           VPDIERALMLFFTEAGRVSFERPED---------------------------------------------
3dfnD           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1bglA           TRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
3clvA           KNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYK-------------------------
3dfnA           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
3ch4B           DDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIR------------------------------
3d1mB           ITRNSERFKEPNYNPDIIFKDEENTGADRLMTQRCKDKLNALVMNQWPGVKLRVTEGWDEDGHHSEESLH
5dfrA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
1dyhA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
1aldA           KKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
3dfpD           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
3b55A           LNDLKPLKNV--GSASIVGLGEATHGAHE--VFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLT-
1drbA           RHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
3dftD           KKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPCIGGVILFH
3cr7A           IKEFTGISAPEAPANPEVHVKNYELPVQDAVKQIID-YL----DTKGYL---------------------
2awoD           HYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVEL-------PMPNRQQVWLPVESRDVQVGANMSLGI
3dfoC           KKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
2ccjA           RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSV
2aumB           VEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAAS-PRPLIGFADISVLLSAFHRHGLPA
3a00A           DMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYK--ELKDFIFAE---------------
1accA           NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIR------KILSGYIVEIEDTEGL-KEVINDRYDML
3cmuA           MGLAARMMSQAMRKLAGNLKQSLLIFINQIRMKIGVMFGNPETTTGGNALKFYAS---------------
2aunA           VEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAAS-PRPLIGFSDISVLLSAFHRHGLPA
3dftC           KKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPCIGGVILFH
3cioD           PMLAVSDAAVVGRSVGTSLLVARFGLNT----AKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSY--
1ek0A           GERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPL-------------------------
3dyoA           TRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
2a1fE           ---QPIYKRILLKLSGEALQGEDGLGIDPAILD-RMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
6aldA           KKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1e2nA           IAALLCYPAARYLMGSMTPQAVLFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGE-----------
3bb1D           VRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQ--TITEVALNKSESIFVDK-------
2dpyB           PPATKGYPPSVFAKLPALV---------------------------------------------------
1akeA           VPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDTAPLIGYYSKEAEAGNTKYAKV
1dw9A           ----------------------------------------------------------------------
2a1fC           IYKRILLKL-----SGEALQGEDGLGIDPAILDRMAV-EIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
3dfqC           KKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRR-FYRQLLLTADDRVNPCIGGVILFH
1bccF           WTKYEEDVPYLEPYLKEVI---------------------------------------------------
3di4A           EAELVHDVLNVFCTGGQYFKASPVRPGDYLEFFAEIDLLGNLSACGDCSSEASCHP--------LLVEIF
2dpyA           PPATKGYPPSVFAKLPALV---------------------------------------------------
3bczC           IEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNQRFRYSYYDESQGEIYRSIEHL
3b85B           QKFLTRLGF----GSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHIVDAY----------
3b9qA           IACKKAVGKIVSGAPNE-----ILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVE
1e9sA           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1e4vA           DVPDELIVDRIVGRRVHAPSGRVYHVKTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKV
2a5vA           ----------------------------------------------------------------------
1e9sE           KKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEALTSARFVLSDKLPEHVTMPDGDFSI
1dp0A           TRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
3bm2B           DDKAIDKARNAPFRAPLIITVVAKVPWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVV----REAFGC
3cueF           DKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKE-SMS---------------------
2bbtA           QRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL--VTSKMEHLKKADKILIL
2bv7A           WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVN-YTATIDVIYEMYTRMNAELNYKV-
1e2iA           PAARYLMGSMTPQAVLAFVALIPPGTNIVLGALPEDRHIDRL-AKRQRPGERLDLAMLAAIRRVYGLLAN
3dm5B           RHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVA
2aunB           VEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAAS-PRPLIGFSDISVLLSAFHRHGLPA
1e2mA           PALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG
2cdnA           RVSEEVLLERLKGRGRADDTDDVILNRMKVYRDET----APLLEYYRDQLKTVDAVGTMDEVFARALRAL
2a5vB           GNIG------------------------------------------------------------------
2anbA           RQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEAEYDYLIVNDDFDTALTDLKTIIRA
1c9kC           QRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD----EVWLVVSGIGVKI---------
2bkeA           PSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVVPGI---RIQLKKS
2an9A           RQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEAEYDYLIVNDDFDTALTDLKTIIRA
1e2jA           YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLRLDLAMLAAIRRVYGLLANTVRYL
1e2kB           EAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLA
3c7kC           LWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLF
2c95B           AGPETMTQRLLKRGETSGRVDDNEETIKETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFS--------
2e85B           SAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIID------PDDIAEMFMMTTHNMPLDQLKEDIGEVI
2d4uB           LAELIQLLGAGKINE---FFDQPTQGYQDGFEKQ------------------------------------
3e70C           SETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISY
3cnnA           VPDIERALMLFFTEAGRVSFERP-----------------------------------------------
1dvrA           VDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYTEPIVDFYK
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dvlD           RARRVSIDSV----TSVFQQYDASSVVRRELF-----RLVARLKQIGATTVMTTERIEEYGPIARYGVFV
1e2nB           VLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGVRYLQCGGSWREDWGQLSGPQSN
2dftA           YRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSR---------------------------------
3a00B           DMQGVKSVKAIPELNARFLFIAPPSGAHDKVIVND--DLDKAYK--ELKDFIFAE---------------
2ancD           RQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAYAEYDYLIVNDDFDTALTDLKTIIRA
3c15C           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cbzA           QKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVM
3bjqB           -QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQY-GGKILTFGKELYNTKRNTKRIDFG
2ancF           DLKTIIRAERLRMSRQKQRHDALISKLL------------------------------------------
3cr7B           PKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIID---YLDTK-------------
1ckeA           PGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLD
2dftC           YRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSR---------------------------------
1e9sK           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLALFAGSNEASKALTSARFVL
1cjuC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancB           RQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMEYDYLIVNDDFDTALTDLKTIIRA
1ckvA           ----------------------------------------------------------------------
1e2lA           CYPAARYLMGSMTPQAVLAFVALIPPNIVLGALPEDRHIDRLAKRERLDLAMLAAIRRVYGLLANTVRYL
1culC           ----------------------------------------------------------------------
1e2lB           PPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRH----------
1e9rB           ALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
1e1qB           AYPGDVFYLHSRLLERAAKMNDAFG-------GGSLTALPVIETQAGDVSAYIPTNVIS---ITDGQIFL
3cr8B           SLPSLDLDWQQQCELE-MLMTGAYSPLTGFMTRAQCARVESAQQLDSPITLTSRDRALADRRPGERLLRD
3bwdD           VPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ--------------------------
2b0lC           -------------KAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVVIVNALRKLESAGVI
2aexA           -------------EDELAHRCSSFMAPPVTDLGEMELLILETQAQVCQALAQVDGGANFSVDRWERKEGG
2c9oA           GDVIYIEANSGAVKRQG-RCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANGEINKVVNK
2bboA           RAVYKDADLYLLDSPF----------GYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILIL
1cs4C           ----------------------------------------------------------------------
3cqcA           DGGWMVDVREDAKED-----HERTHQMVLLRKLCLPM-----LCFLLHTILHSTGQYQECLQLADMV-SS
3cphA           ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQE-KIDSNKLVG---------------
2b8tD           IAKLFTYADKITKLTAICNECGAEATHSLRKIDGKH-------ADYNDDIVKIGCQEF-YSAVCRHHHKV
1d8jA           LKQKQWLMEALVNNPKIEVIDGKYAFKPKYNV--------------------------------------
3csuA           SGNVPVLNAGDGSNQDLFTIQETQGRLDNLYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDE
3dmdA           SETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISY
2c9gA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e2jB           DRHPILLCYPAARYLMGSMTPQAVLAFVALGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTV-----
1e2hA           PALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG
3c85A           KGQIAAIAEYPD-QLEGLLESGVDAAFNIYSEAGSGFARHVCQLEPQFTSI-------------------
3e8aC           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1chdA           ----------LLSSEKLIAIGASTGGTEAIRHV-----LQPLPLSSPAVIITQHMPPGFTRSFAERLNKL
3cd9A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3cddA           ETPHELLARLASDTFGNLVITRASKTKAG-VSLILGDNVKAARGRFSWRQRFKFTIKAAKADVTDSEIGR
3bs4A           GRELYGFAISMSGYLEVFTPEETLRYLETSAEVRY---GHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRR
3cddE           IKVIVNTDVGEPFQRIQIPHELLARLAKQ-----------------------------------------
2bsqE           ELEDVR----------------------------------------------------------------
3cbqA           RSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRL-------------------------
3c7kA           ----------------------------------------------------------------------
2bwjB           CSADTMTNRLLQMSRSSLPVDDTTKTIAKRLE-AYYRASIPVIAYYETKTQLHKINAEGTPEDV------
2a78A           DKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRA-------------------------
1d6aA           ----------------------------------------------------------------------
2axnA           TRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKI-SSPDYKDCNSAEAMDDFMKRISCYEASY
3ci2A           --------------------------LVGKSVEEAKKVILQDKPE-AQIIVLPVGTIVTMEYRIDRVRLF
2dx7A           GVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKIEERGAECIIAGCTEVSVVLKQDDLKVPLI
2bhvC           YRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVLSTLTNGLLIGITGDYLLMQLMRQNQILR
1cjvC           ----------------------------------------------------------------------
1dwmA           -------------------------------GNMAAATVERENRN-VHAIVLKEGSAMTKDFRCDRVWVI
2bwjD           ----------------------------------------------------------------------
1agpA           AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQ-------------------------
2bsqH           E---------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dzvA           ------SANALLYIDAKPIADDPREFPQFQQTSALVLNLGHLSQEREQSLLAASDYARQV----NKLTVV
2bwjF           ----------------------------------------------------------------------
3dvlC           ------RARRVSIDSVTSVF--QQYDASSVVRRELFRLVARL-KQIGATTVMTTERIEEYGPIAR-----
2b0lB           -------------KAVVQMAISSLSYSE--LEAIEHIFEELDGNEGLLVASKIADRIVNALRKLESAGVI
2dwuB           YEKALHELDTYLKCPTLATVVENRLEDTAYVTQQVKQALLPLTKELGCTHYPLLESYIKK-ELGEDVTII
2ax4A           LYKR---ARAGEIKG-FTGIDSDYEKPE------------------------------------------
2ax4B           LYKR---ARAGEIKGFTGIYEKPETP--------------------------------------------
2bwjE           ----------------------------------------------------------------------
2a5vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e6vC           PNYELKKLREIPDEDIVRLMGHREPGEEYPSV--------------------------------------
2a5fA           KPHEIQEKLGLTRIRDRNWYVQPSCATS------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNGNIVQSGTPVDIYDEPINHYVADFIGESNIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPE
3dmdC           VIDAPILFVGVGQGYDDLRPFEKEWFL-------------------------------------------
3b5jA           EKGKIVEQGKHKELLSEPESLY------------------------------------------------
3cmvG           QILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVELLLKQK
3cmvH           QILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVELLLKQK
3dmdB           VIDAPILFVGVGQGYDDLRPFEKEWFL-------------------------------------------
3cmvC           YGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKAN-----------------------------
2dwoA           QPLDPDKCDRDLSLIKVIDVGR------------------------------------------------
3b60A           EDGIIVERGTHSELLAQH--GVYAQLHK------------------------------------------
2d3wB           YQGRIVKSGDFTLVKQLEEQGY------------------------------------------------
2d62A           NKGELQQVGTPDEVYYKPVNTFVAGFIGPPNFLDATITDDGFLDFGEFKLKLLQDQFNVGKEVIFGIRPE
2dwpA           --QPLDPDKCDRDLSLIKVIDV------------------------------------------------
2cgtH           AAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLVINKDTTTIIDGVGEEAAIQGRVAQIRQQ
2ccgA           ESQRFKSDQPLENVVEDTYQTIIKYL--------------------------------------------
2ccjB           NADQPLENVVTYQTIIKYLE--------------------------------------------------
2c03B           VTGKPIYFAGVSEKPEGLEPFYAGRILGMGDV--------------------------------------
2ccgB           NADQPLE-----NVVEDTYQTI------------------------------------------------
2b8wA           QLEKLQDEELD-PEFVQQVADFCSYIFSNSKT--------------------------------------
3dm5A           ATGAPIKFIGTGEKIDDIEPFDPPRFVGLGDIQ-------------------------------------
1e69A           TMVNGVSAIVPVEV--------------------------------------------------------
2bifA           ---YESLDEEQDRDLSYIKIMDVGQSYVVNRVADHIQ---------------------------------
3eiuA           GKTREDVSDQMYAGYAEGRDLRGLVAIVGKEA-LSERDTKFLEFADLFEDKFVRQGWNENRTIE------
1bifA           ESLDEEQDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM-----------------------------
3cmxA           FYGELVDLGVKEKLIEKAGAWYSYKGE---KIGQGKANATAWLK--------------------------
2bjbA           SGGTVRITGWPRVSV-QPADHILAILRQ------------------------------------------
2bc9A           PRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGP
1e9cA           DASKSIEAVHERVLSEDAIATATEKPLKE-----------------------------------------
2c61B           GKTREDHKAVSDQMYAGYAEGRDLRGLV------------------------------------------
2b8tA           VPNRPYLNSNSEEFIKFFKN--------------------------------------------------
3cmvA           RRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDL------------------
2a2zD           DVNEDFK-----DKYESLVEK-VKEFLST-----------------------------------------
2akaB           ENKLLPLRRGYIGVVNRSQKDI------------------------------------------------
1e9fA           DAIATATEKPLGELW-------------------------------------------------------
2bbsA           HEGSSYFYGTFSELQ-NLRPDFSSKLMSFDQF--------------------------------------
2czvA           ----------------------------------------------------------------------
1e9rA           RSWLEDPNGGNLFITWREDMGPALRPLI------------------------------------------
2dr3A           DLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIYPDKVLK--------------------------
3b2qA           YITEGQIVVAR-ELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAVG
3c95A           ----------------------------------------------------------------------
2awnD           RPEHLLPSDIADVILEGE--VQVVEQLGNETQIHIQIPSIRQNLVYRQN---DVVLVEEGATFAIGLPPE
1d1cA           GNIKFEKGAGEGAVLKDKTALNAASTVFGVN---------------------------------------
3eiuB           GKTREDHKAVSDQMYAGYAEGRDLRGL-------------------------------------------
1e9sG           SDKLPEHVTMPDGDFSIRSWLE------------------------------------------------
2awnB           DAGRVAQVGKPLELYHYPADRFVAGFIGSPKAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPE
2awnC           DAGRVAQVGKPLELYHYPADRFVAGFIGNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANM
1e98A           DASKRIEAVHERVLSEDAIRTATEKPLGE-----------------------------------------
1cr4A           ERNQLVLVRILKCRFTGDTGIAGYEYNKETGWLE------------------------------------
2dr3E           DLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKIIVYPDKVLKRG-----------------------
2a30D           DVNEYES---------------------------------------------------------------
1e2dA           DASKSIEAVHERVLSEDAIATATEKPLGE-----------------------------------------
3cmtD           FYGELVDLGVKEKLIEKAGAWYSYKG--------------------------------------------
2c03A           TGKPIYFAGVS-EKPEGLEPFYAGRILGM-----------------------------------------
1e9sF           SDKLPEHVTMPDGDFSIRSWLEDPNGGN------------------------------------------
3cmvE           QILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVELLLKQK
3bjdB           ELGEEDEKGSHPRLLAKLLEAIGLEA--------------------------------------------
2cckA           ADQPLENVEDTYQTIIKYLE--------------------------------------------------
2c04A           TGKPIYFAGVSEGLEPFYPERLAGRILGMGDV--------------------------------------
2b92B           AQLEKLQDEELDPEFVQQVADFCSYIFSNSKTVNGPRLESLVLTY-------------------------
3b2qB           GKTREDHKAVSDQMYAGYAEGRDLRGLV------------------------------------------
1e9sJ           SDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGP-------------------------------
2cjwB           KRK-------------------------------------------------------------------
2a30B           DVNEYES---------------------------------------------------------------
1e9sD           SDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALLISAWVDVVCTSILSLPEEPKRRLWLFID
3bh0A           SDLRESGQLDADIIEFLYRDDYYDKESESKNIVEVIIAKH------------------------------
1e9dA           DASKSIEAVHERVLSEDAIATATEKPLKE-----------------------------------------
1dhjA           HIDAEVEGDTHFPDYEPDDWESVSSEFHDADAQNSHSYCFE-----------------------------
3a1wA           ----------------------------------------------------------------------
1aroP           VASAIGRAIEDEARFGRIRDLEAKHFKKFMQVVEADMLSKGLLGGEAWSSW-------------------
2axzC           YLNAVNIINIFKIIGKEDIHRSLVEEL-------------------------------------------
3dt2A           HKGKVIMHDPFAMRPFFGYNKYLAHWLSMAH---------------------------------------
2b8wB           PKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKT------KTLSGGIQVNGPRLE
2bhjA           WNTIRGDAATLEFTQLCIDLGWKPRYGRFDVL--------------------------------------
2d4hB           GPRLESLVLTYVNAISSG----------------------------------------------------
3dffA           DAALFATHEKNVPVRLWEDLPYAVFKSGAVELPQGFRLGSADVSSVKPERSQKFQAVE------------
1dekB           KFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGAGLPIRDGD----LVITNDGSLEELFSKIKN--
2awoA           DAGRVAQVGKPLELYHYPADRFVAGFIGSPKMIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPE
1dkiA           -DGADGRNFYHVN---------------------------------------------------------
2d4hA           -QLEKLQDEELDPEFVQQVADFCSYIFSNSKT--------------------------------------
1e9sB           RSWLEDPNGGNLFITWREDMGPALRPL-------------------------------------------
2a2zA           HRTLKT----------------------------------------------------------------
2a2zB           DVN-----EDFKDKYESLVEK-VKEFLST-----------------------------------------
1e4yA           KDDQEETVRKRLVEYHQMTAPLIGYYSKEAE-----AGNTKYAKVDGTK---------------------
2c9yA           LIEYYRKRGIHSAIDASQTPDVVFASI-------------------------------------------
2ctsA           HNF-------------------------------------------------------------------
4dcgA           HMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLN------------------------------------
2a5gA           ----------------------------------------------------------------------
3cmwC           VKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLI----------------
3c8uA           NARAIEAARLPADL--------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2awnA           DAGRVAQVGKPLELYHYPADRFVAGFIGSPKMIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPE
1e3mA           VHLDALEHGDTIGAASKSYGLAVAALAG------------------------------------------
3dtbB           EAKVIMHDPFAMRPFFGNFGKYLAHWLSMAHRPAAKLPKIFHVN--------------------------
3czpB           RT--------------------------------------------------------------------
1e3aB           PTGSLNISVGAKILYEAVQGDKSPIPQAVDLFAGKPQQEVVLAALEDTWETLSKSNWKTPAMALTFRANN
2eg5G           GHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLET------FKVLYDAGFSHIKAEYVASSVRAV
2c61A           EGQIVVARELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGKEA
1e0jB           VSITDLRGSGALRQLSDTIIALERNQQGD-----------------------------------------
2c4rL           NRLREAVRQDRARIQISHISRFGLLEMSRQRL--------------------------------------
3dt4A           HKGKVIMHDPFAMRPFFGYNFG------------------------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d0kA           HIDAEVEGDTHFPDYEPD----------------------------------------------------
3ecpA           LHQEWWMRPDDPADADEKESGKWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSK
1cfrA           HEGSLMKALYTHQTRTWTINPTGIRYYAAATSIGNADVIG------------------------------
1cr2A           ERNNLVLVRILKCRFTGDTG--------------------------------------------------
1bg0A           IESKLPFSHDDRFGFLTFCPTNLGTTMRASVHI-------------------------------------
3b85A           ----------------------------------------------------------------------
3brwA           RKRHIGNDIVA-VVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYK-VSVTARDDVPFFGPPLPD
1e9rE           SDKLPEHVTMPDGDFSIRSWLED-----------------------------------------------
3dt7A           HKGKVIMHDPFAMRPFFGYNKYLAHWLS------------------------------------------
3d31A           MDGKLIQVGKPEEIFEKPVEGRVASFVGFENVLKGRVISAEQGLLRIRVGEVVIDAAGDMEVGDQVYAFL
3d7wA           TDGVFNNPIALAIAPGVIVTLTNIR---------------------------------------------
1e0jA           VSITDLRGSGALRQLSDTIIALERNQQGD-----------------------------------------
1e2kA           ERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL--------------------------------
2ahwD           QVQKMVKKATLHPKSVRIPGYLVDIVV-VDPDQSQLYGGAPVNRFISGDFTLDPLNQRKLVARRALFEMR
3be4A           AKLPPKE---------------------------------------------------------------
2dr3B           VDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFITDKGIIVYP-----------------------
3dt4C           HKGKVIMHDPFAMRPFFGYN--------------------------------------------------
2akaA           GNIKFEKGAGEGAVLKDKTALNA-----------------------------------------------
3bb1B           IPHLVQTITEV------ALNKSESIFVDK-NLIDG-----------------------------------
3cm0A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2c7cH           AAVKAPGFGDRRKAMLQDIATLTGGTV-------------------------------------------
2a30A           DVNEYESVEKVKEFLST-----------------------------------------------------
3bb1F           PNGIAWIPHLVQTITEVALNKSESIFVDK-----------------------------------------
1dg3A           FVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLE-------------------------------------
3cddC           ADSAGLPTVGGIKARYRPLIIVNEEVTTA-----------------------------------------
3bb1A           PNGIAWIPHLVQTITEVALNKSESIFVDK-----------------------------------------
3bgwA           SDLRESGQLDADIIEFLYRDDYYDKESESKNIVEVIIAK-------------------------------
2bdtA           ----------------------------------------------------------------------
1ai4B           PTGSLNISVGAKILYEAVQGDKSPIPQAVDLFAGKPQQEVVLAALEDT----WETLSKRYGNNVSNWKTP
3d3kA           PFG-------------------------------------------------------------------
1dhiA           HIDAEVEGDTHFPDYEPD----------------------------------------------------
421pA           ----------------------------------------------------------------------
3d3qA           GHGLFNEVQHL---VEQGFEASQSQAIGYKELVPVINISENAVE--------------------------
2bofX           --SWLQQADISNSAHGIATNKAVLSAIGNPSL--------------------------------------
2b8tB           VPNRPYLNSNSEEF--------------------------------------------------------
2awoC           DAGRVAQVGKPLELYHYP----------------------------------------------------
3dlbB           AQAYRLSIPKLMGRRAVSKPADALRVGFY---RAQETALALLRLDGAGWPEFLRRALLRFGASGASLRLH
1e9sM           RSWLEDPNGGNLFITWREDMGPALRPLI------------------------------------------
1e9sI           SDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMG--------------------------------
1eilA           LLCLQDPFGLPLEIYYGPAEIFHEPFLPSAPVSGFVTGDQGIGHFVRCVPDTAK----------------
4atjA           SNT-GLPDPTLNTTYLQTLRGLCPLNGNLSALVD------------------------------------
1e2hB           QCGGSWREDWGQLSGPQS----------------------------------------------------
2dr3D           VDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRKGIIVYPDKVLKRG-----------------------
1cr0A           ERNQLVLVRILKCRFTGDTGIA------------------------------------------------
1cr1A           ERNQLVLVRILKCRFTGDTGIAGY----------------------------------------------
2ahvA           VQKMVKKATLHPKSVRIPGYLV------------------------------------------------
3bb1H           NSGRCNKNDSDEKVLPNGIAWI------------------------------------------------
3bpbA           NERVIMPAGYPRTREKIARLGYRVIEVDTSEY--------------------------------------
3cr7C           ----------------------------------------------------------------------
3bgwD           SDLRESGQLIIEFLYRDDYYDKESESKNIVEV--------------------------------------
3cddF           DEIGLDEELIASILFSEDDAGRLAVIS-------------------------------------------
3bb1E           PNGIAWIPHLVQTITEVA-LNKSESIFVDKNLID------------------------------------
2bbtB           HEGSSYFYGTFSELQ-NLRPDFSSKLMDSFDQFSA-ERRNSILTETLHRFS-------------------
3dhwC           SNGELIEQDTVSEVFSHPKTPL------------------------------------------------
3czjA           DVEVASTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRC
2c9oC           AQT-------------------------------------------------------------------
2cvfA           ERG-------------------------------------------------------------------
2bwjA           DSI-------------------------------------------------------------------
2bkiA           --CTAMKKIGLDDEEKLDLFRVVAGVLHLGNI--------------------------------------
1e2fA           ASKSIEAHEDIRVLSEDAIATATEKPLGE-----------------------------------------
2bx2L           DLGGLIVIDFIDMTPVRHQRAVENRLREA-----------------------------------------
2bkhA           GLDDEEKLDLFRVVAGVLHLGNIDFEEAGCNLKN------------------------------------
3cddD           DSAGLPTVGGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGK
1cjaA           ----------------------------------------------------------------------
3dymA           DVEVASTPHPARIGLNCQLAQVAERVNWLGLGPQPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTR
1e59A           SEEEILELNIPTGVPLVYEFDENFKPLKR-----------------------------------------
1e9rF           RSWLEDPNGGNLFITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLWLFI----------------
2dflA           KKSRGN--RRIARVVDAPHLPEVFALTEE-----------------------------------------
1b0uA           HQGKIEEEGDPEQVFGNPQSPRLQQFLKG-----------------------------------------
2bbsB           HEGSSYFYGTFSELQNLR----------------------------------------------------
2cckB           ----------------------------------------------------------------------
1e9rD           SDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDM---------------------------------
3d3qB           GHGLFNEVQHLVEQGFEASQSQAIGYKELVPVIKG-NISENAVE--------------------------
2dr3C           DLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKVLKRGKVLE--------------------------
2dr3F           DLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDGIIVYPDKVLKRG-----------------------
2c0bL           HQRAVENRLRE-AVRQDRARIQISHISR------------------------------------------
1draA           HIDAEVEGDTHFPDYEP-----------------------------------------------------
3bb1C           NGIAWIP-HLVQTITEVALNKSESIFVDK-----------------------------------------
2b8tC           PNRPYLN-SNSEEFIKFFKN--------------------------------------------------
2a1fF           NRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL-------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sH           SDKLPEHVTMPDGDFSIRLEDPNGGNLFITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLWLFID
3dm9B           VIDAPILFVGVGQGYDDLREWFLERIFG------------------------------------------
1bmfC           GGGSLTALPVIETQAGDVSAYIPTNVISITD---------------------------------------
2drcA           HIDAEVEGDTHFPDYEP-----------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2d3wC           YQGRIVKSGDFTLVKQLEEQGY------------------------------------------------
3cmvB           YGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDN---------------------
1e9sL           RSWLEDPNGGNLFITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLWLF-----------------
1afrA           AFADMMRKKISMPAHLMYDGRD------------------------------------------------
1e3mB           VHLDALEHGDTIAAASKSYGLAVAALAG------------------------------------------
3dauA           HIDAEVEGDTHFPDYEP-----------------------------------------------------
2ck3C           GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETEL----FYKGIRPAINVGLSVSRVGSAAQTRA
3crmA           ----------------------------------------------------------------------
2c5mD           PQVCVIELGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTSVRELRGLGLSPD
2d4uA           ----------------------------------------------------------------------
3bb1G           PNGIAWIPHLVQTITEVALNKSESIFVDKNLI--------------------------------------
2ausC           KEFEGEIIQRTRKVYYIEILEIDGRDV-------------------------------------------
1av6A           VNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRF-------------------------
1adoA           ETLYQKAKGGVVGIKVDKGVVPLAGTNGETTT-QGLDKDGADFAKWRCVLKIGEHTPSALAIMENANVLA
1dekA           IHVVRPGKSNDTHITEAGLPIRDGDLVITND---------------------------------------
1e6cA           ----------------------------------------------------------------------
2d3wA           YQGRIVKSGDFTLVKQLEEQGY------------------------------------------------
3dfnC           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGL----------
3bv4A           ETLYQKAKGGVVGIKVDKGVVPLAGTNGETTTQGLVGLSERCFAKWRCVLKIGEHTPSALAIMENANVLA
2e85A           FLGIQPDIVGFYYPMTQPIKDAVETVYQR-----------------------------------------
1e2iB           ERLDLAMLAAIRRVYGLLAN--------------------------------------------------
1eamA           LNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYC------------------------------------
3cbnA           ----------------------------------------------------------------------
3dfqA           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
1e2gA           DASKSIEAVHEDIR--------------------------------------------------------
2aumA           RHGLPAIHGPVATGLGLQ----------------------------------------------------
1d6jB           ----------------------------------------------------------------------
2d2eA           MDGRVVATGGPELALELEAKGY------------------------------------------------
2boeX           VLETMAYAGKALKAGSS--QARIYFDAGHSAWHSPAQMASWLQQADISNSAH------------------
1e9rG           SDKLPEHVTMPDGDFSIRSWLEDPNGGNITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLWLFID
2czvB           ----------------------------------------------------------------------
4dfrA           HIDAEVEGDTHFPDYEP-----------------------------------------------------
2bhvA           DKSKIAP--IVVIREGSRVFISPNTDIFFPIPRENEVIAE------------------------------
2bhvD           REGSRVFISPNTDIFFPIPNEVIAEFL-------------------------------------------
3cr7D           ----------------------------------------------------------------------
3bk7A           -EGEPGRHGRPPMGMREGMNRFLASV--------------------------------------------
2d3wD           YQGRIVKSGDFTLVKQLEEQGY------------------------------------------------
3dfqD           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKD
1e2mB           ----------------------------------------------------------------------
3dfoD           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDG-----------
2a1fD           NRVVGDHMGMLATVMNGLAMRDSLFRADVNAK--------------------------------------
1d6jA           ----------------------------------------------------------------------
3dfpC           ETLYQKADGRPVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLA
2d2fA           MDGRVVATGGPELALELEAKGY------------------------------------------------
3d1mA           YEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV-------------------------------------
3ec1A           GLGWVTCNDPGAQLVVH--APKGVDV--------------------------------------------
1ak2A           YSKRGIASQTPDVVFASILAAFSK----------------------------------------------
3cnlA           ----------------------------------------------------------------------
3dfnD           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
1bglA           DVEVASDTPPARIGLNCQLAQVAERVNW------------------------------------------
3clvA           ----------------------------------------------------------------------
3dfnA           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
3ch4B           ----------------------------------------------------------------------
3d1mB           YEGRAVDITTSDRDRSKYGMLARLAVEAGFDWV-------------------------------------
5dfrA           HIDAEVEGDTHFPDYEPD----------------------------------------------------
1dyhA           HIDAEVEGDTHFPDYEP-----------------------------------------------------
1aldA           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
3dfpD           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
3b55A           --GKGNPSQHLTPVFKTKELDLLD----------------------------------------------
1drbA           HIDAEVEGDTHFPDYEP--DDWESVFSEF-----------------------------------------
3dftD           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDG-----------
3cr7A           ----------------------------------------------------------------------
2awoD           RPEHLLPSDIADVILEGEVQVVE--QLGNETQIHI---QIPSIRQNLVYRQNDVVLVEEGATFAIGLPPE
3dfoC           ETLYQKAKGGVVGIKVDKGVVPLAGTNGETTTLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIM
2ccjA           NADQPLENVVTYQTIIKYLE--------------------------------------------------
2aumB           IHGPVATGLGL-----------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1accA           NISSLRQDGKT----------------------------FIDFKKYNDKLPLYISNPNYKVNVYAVT-KE
3cmuA           ----------------------------------------------------------------------
2aunA           IHGPVATGLGL-----------------------------------------------------------
3dftC           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
3cioD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dyoA           DVEVASDTPHPARILNCQLAQVAERVNWL----GLGPQENYPDRLTAACFD--RWDLPLSDMYTPYVFPS
2a1fE           NRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL-------------------------------------
6aldA           ETLYQKADGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
1e2nA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1akeA           DGTKPVA-----EVRADLEK--------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2a1fC           NRVVGDHMGMLATVMNGLAMRDSLFRADVNAKL-------------------------------------
3dfqC           ETLYQKDDGRP-----------FPQVIKSKGGVVGIKVDKGVVPLAG-----------------------
1bccF           ----------------------------------------------------------------------
3di4A           APAEGLGDWPSPSVNGYDRSHG------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3bczC           DKGSIIEQLDPVSFSNYLKKYH------------------------------------------------
3b85B           ----------------------------------------------------------------------
3b9qA           ELGIPVKFIGVGEAVEDLQPFDPEAFVN------------------------------------------
1e9sA           RSWLEDPNGGNLFITWREDMGPALRPL-------------------------------------------
1e4vA           DGTKPVAEVRA-----------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e9sE           RSWLEDPNGGNLFITWREDMGPALRPL-------------------------------------------
1dp0A           DVEASDTPHPARIGLNCQLAQVAERVNW------------------------------------------
3bm2B           REQDKIYLGTPQLVPDPT----------------------------------------------------
3cueF           ----------------------------------------------------------------------
2bbtA           HEGSSYFYGTFSELQNLR-----PDFSSDS----------------------------------------
2bv7A           ----------------------------------------------------------------------
1e2iA           TVRYLQCGGSWREDWGQ-----------------------------------------------------
3dm5B           ATGAPIKFIGTGEKIDDIEPFDVSRLLGLGDIQ-------------------------------------
2aunB           IHGPVA----------------------------------------------------------------
1e2mA           ERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL--------------------------------
2cdnA           G---------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2anbA           ERLRMSRQKQRHDALISK---LLAD---------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bkeA           RGNRRIARVVDAPHEGEVVFALTEEGIRD-----------------------------------------
2an9A           ERLRMSRQKQRHDALISK----------------------------------------------------
1e2jA           QCGGSWREDWGQLSGPRP----------------------------------------------------
1e2kB           KRERL-----------------------------------------------------------------
3c7kC           DVGGQRSERKKWIHCFEDVTAIIFCVDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKK
2c95B           ----------------------------------------------------------------------
2e85B           FLGIQPDIVGFYYPMTQPIKDAVETVY-------------------------------------------
2d4uB           ----------------------------------------------------------------------
3e70C           VIDAPILFVGVGQGYDDLRPFEKEWFLE------------------------------------------
3cnnA           ----------------------------------------------------------------------
1dvrA           KTGIWAGSQPPATVWAD-----------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dvlD           SDNVVILRNVLEGERRRRT---------------------------------------------------
1e2nB           AGPRPHIGDTLFTLFRAP----------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2ancD           ERLRMSRQKQRHDALIS-----------------------------------------------------
3c15C           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cbzA           SGGKISEMGSYQELLARD--GAFAEFLRT-----------------------------------------
3bjqB           YEGDPYSIVPSALEAKVPRELRDASQVP------------------------------------------
2ancF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1ckeA           STT-----LSIEQVIEKALQYA------------------------------------------------
2dftC           ----------------------------------------------------------------------
1e9sK           SDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGP-------------------------------
1cjuC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancB           ERLRMSQKQRHDALISKLL---------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e2lA           QCGGSWREDWGQLSGPRP----------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1e9rB           RSWLEDPNGGNLFITWREDMGPALRPL-------------------------------------------
1e1qB           ETE-------------------------------------------------------------------
3cr8B           GEGYMLAILTLSDVWKDGERWHLAGEVEGAALPPHPD---------------------------------
3bwdD           ----------------------------------------------------------------------
2b0lC           ESRSLGMKGTYIKVLNNK----------------------------------------------------
2aexA           GGGCVFEKAGISVVHGNLSEEAAKQMRSRGKVLKTK----------------------------------
2c9oA           YIDQGIAELVPGVLFVDEVHML------------------------------------------------
2bboA           HEGSSYFYGTFSELQ-NLQPDFSSKLMSFDQ---------------------------------------
1cs4C           ----------------------------------------------------------------------
3cqcA           ERHKLYL---------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b8tD           PNRPYLNSNSEEFI--------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3csuA           KGIAWSLHSSIEEVMAEVDILYMTRFV-----------------LRASDLHNAKANMKVLHPLPRVDEIA
3dmdA           VIDAPILFVGVGQGYDDLRPFEKEWFL-------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2hA           ERLDLAMLAAIRRVYGLLAN--------------------------------------------------
3c85A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1chdA           CQISVKEAEDGERVLP------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3cddA           YRPLIIVNEEVAKRGQWERQRSIGKSN-AEYTVTGWRIPQTGKLWNINTL--------------------
3bs4A           ADYVL-----------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2bsqE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2axnA           QPLDPDKCDRDLSLIKVIDVGRRFLVNRV-----------------------------------------
3ci2A           VDKLDNIAQVP-----------------------------------------------------------
2dx7A           DPMDVIAEVAVKVALEK-----------------------------------------------------
2bhvC           DKSKIIREGSRVFIS-------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1dwmA           VNDHGVVTSVPH----------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bsqH           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dzvA           DLVGYGASDIRNEVGEKLVHNQP-----------------------------------------------
2bwjF           ----------------------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
2b0lB           ESRSLGMKGTYI----------------------------------------------------------
2dwuB           SSAEETAIEL------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2a5vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DLVLTSPEKGQLKVKVDTQLFRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESE
3dmdC           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3cmvG           ALALGQIEKQFGKGSIMRLGSMDVETISTGSLSLDIALGAGGLP---MGRIVEI-YGPESS---------
3cmvH           ALALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEI----------------
3dmdB           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d62A           DVHDAVPEENTVKATVDIIENLGGEKIVHLR--RGNISFFPKESKVREGDEVSVVF-DKKIHIF------
2dwpA           ----------------------------------------------------------------------
2cgtH           REKL------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2bc9A           RLE-------SLVLTYVNAISSG-----------------------------------------------
1e9cA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b2qA           KEALSERDTKFLEFLFEDKFVRQGWNENR------------TIEDTLEIGWQILTHLPENQLGRIDNKYI
3c95A           ----------------------------------------------------------------------
2awnD           RCHL------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2awnB           HLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVNDVVLVEEGATFAIGLPPERCHLFR-----
2awnC           SLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIRQNLVNDVVLVEEGATFAIGLPPERCHLFR-----
1e98A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3cmvE           ALALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEI-YGPESSGKTTLT---
3bjdB           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e9sD           EL--------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2b8wB           SLVLTYVNA-------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2awoA           HLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVNDVVLVEEGATFAIGLPPERCHLFR-----
1dkiA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2awnA           HLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVNDVVLVEEGATFAIGLPPERCHLFR-----
1e3mA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1e3aB           FFGVPQAAAEETRHQAEYQNRGTENDMIVFSPTTSDRPVLAWDVVAPGQSGFIAPDGTVDKHKMYENFGR
2eg5G           YEPILASHFGEAIIPIFHRFAKHAAKVLPLGKGFYNNLIISLAKK-------------------------
2c61A           ---LSERDTKFLEFLFEDKFVRQGRNE---------NRTIEDTLEIGWQIL-------THLPENQLGRID
1e0jB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3ecpA           H---------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3brwA           PAVF--RKGPEFQEFLLTKLINAAKLEERTRAALLETL--------------------------------
1e9rE           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3d31A           RPENIALSKSSTQSSTEAWVLGALVRVKVDCGVPLNVLISAEEMELSPGVQIYARFKASSVHVLR-----
3d7wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2ahwD           KGAVGNVGVGIADGIGLVAREEGCADDFILTVETGPIGGITANVNTRTSQFDFYHGGGLDVCYLSFAEVD
3be4A           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
1ai4B           AMALTFRANNFFGVPQAAAEETRHQAEYQNRGTENDMIVFSPTTSDRPVLAWDVVAPGQSGFIAPDGTVD
3d3kA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dlbB           TLHAHPSQGLAFREALRKAKEEGVQAVLVLTPPM------------------------------------
1e9sM           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3czjA           GELNYGPHQWRGDFQFNISRYSSHRHLLHAEEGTGFHMGIGGDDSWSPSVSAEFQLSAGRYHVWCQ----
2c9oC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3cddD           LWNINTLVPVIDEIGLDEELIASILFSED-----------------------------------------
1cjaA           ----------------------------------------------------------------------
3dymA           ELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFPSVSAEFQLSAGRYH-YQLVWCQ
1e59A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1e9sH           EL--------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2ck3C           MKQVAGTMKLELAQYREVAAFAQFGSDLDAAT--------------------------------------
3crmA           ----------------------------------------------------------------------
2c5mD           LVVCRCSNPLDTSVKEKISMFCHVEPE-------------------------------------------
2d4uA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
1adoA           RYASICQQNGIVPIVEPEILPDGDHDLKRCQYV--TEKVLAAVYKALSDHHIYL----EGTLLKPNMVTP
1dekA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3bv4A           RYASICQQNGIVPIVEPEILPDGDHDLKRCQYV--TEKVLAAVYKALSDHHIYL----EGTLLKPNMVTP
2e85A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9rG           EL--------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dfqD           GADFAKWRC-------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
3dfpC           RYASICQQNGIVPIVEPEILPDGDHDLKRC----------------------------------------
2d2fA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2awoD           RCHL-FREDGTACRRLHKEP--------------------------------------------------
3dfoC           ENANVLARYASICQQNGIVLPDGDHDLKRCQYVTEKEGTLLKPNMVTPGHACTQKYSHEEIAMATVTALR
2ccjA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1accA           NTIINPSENGDTSTNGKILIFSKKGYEI------------------------------------------
3cmuA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dyoA           ENG-------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3c7kC           SPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTC-ATDTNNIQVVF--------------
2c95B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3csuA           TDVDKTPHAWYF----------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
2bsqE           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
2dx7A           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bsqH           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2dwuB           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2a5vC           ----------------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EDFDARLDSYND
3dmdC           ------------
3b5jA           ------------
3cmvG           ------------
3cmvH           ------------
3dmdB           ------------
3cmvC           ------------
2dwoA           ------------
3b60A           ------------
2d3wB           ------------
2d62A           ------------
2dwpA           ------------
2cgtH           ------------
2ccgA           ------------
2ccjB           ------------
2c03B           ------------
2ccgB           ------------
2b8wA           ------------
3dm5A           ------------
1e69A           ------------
2bifA           ------------
3eiuA           ------------
1bifA           ------------
3cmxA           ------------
2bjbA           ------------
2bc9A           ------------
1e9cA           ------------
2c61B           ------------
2b8tA           ------------
3cmvA           ------------
2a2zD           ------------
2akaB           ------------
1e9fA           ------------
2bbsA           ------------
2czvA           ------------
1e9rA           ------------
2dr3A           ------------
3b2qA           QKYHPA------
3c95A           ------------
2awnD           ------------
1d1cA           ------------
3eiuB           ------------
1e9sG           ------------
2awnB           ------------
2awnC           ------------
1e98A           ------------
1cr4A           ------------
2dr3E           ------------
2a30D           ------------
1e2dA           ------------
3cmtD           ------------
2c03A           ------------
1e9sF           ------------
3cmvE           ------------
3bjdB           ------------
2cckA           ------------
2c04A           ------------
2b92B           ------------
3b2qB           ------------
1e9sJ           ------------
2cjwB           ------------
2a30B           ------------
1e9sD           ------------
3bh0A           ------------
1e9dA           ------------
1dhjA           ------------
3a1wA           ------------
1aroP           ------------
2axzC           ------------
3dt2A           ------------
2b8wB           ------------
2bhjA           ------------
2d4hB           ------------
3dffA           ------------
1dekB           ------------
2awoA           ------------
1dkiA           ------------
2d4hA           ------------
1e9sB           ------------
2a2zA           ------------
2a2zB           ------------
1e4yA           ------------
2c9yA           ------------
2ctsA           ------------
4dcgA           ------------
2a5gA           ------------
3cmwC           ------------
3c8uA           ------------
2axpA           ------------
2awnA           ------------
1e3mA           ------------
3dtbB           ------------
3czpB           ------------
1e3aB           KSLWL-------
2eg5G           ------------
2c61A           NKYIQKYHP---
1e0jB           ------------
2c4rL           ------------
3dt4A           ------------
3da4A           ------------
3adkA           ------------
2d0kA           ------------
3ecpA           ------------
1cfrA           ------------
1cr2A           ------------
1bg0A           ------------
3b85A           ------------
3brwA           ------------
1e9rE           ------------
3dt7A           ------------
3d31A           ------------
3d7wA           ------------
1e0jA           ------------
1e2kA           ------------
2ahwD           QHGN--------
3be4A           ------------
2dr3B           ------------
3dt4C           ------------
2akaA           ------------
3bb1B           ------------
3cm0A           ------------
2a5jA           ------------
2c7cH           ------------
2a30A           ------------
3bb1F           ------------
1dg3A           ------------
3cddC           ------------
3bb1A           ------------
3bgwA           ------------
2bdtA           ------------
1ai4B           KHYEDQLKMYEN
3d3kA           ------------
1dhiA           ------------
421pA           ------------
3d3qA           ------------
2bofX           ------------
2b8tB           ------------
2awoC           ------------
3dlbB           ------------
1e9sM           ------------
1e9sI           ------------
1eilA           ------------
4atjA           ------------
1e2hB           ------------
2dr3D           ------------
1cr0A           ------------
1cr1A           ------------
2ahvA           ------------
3bb1H           ------------
3bpbA           ------------
3cr7C           ------------
3bgwD           ------------
3cddF           ------------
3bb1E           ------------
2bbtB           ------------
3dhwC           ------------
3czjA           ------------
2c9oC           ------------
2cvfA           ------------
2bwjA           ------------
2bkiA           ------------
1e2fA           ------------
2bx2L           ------------
2bkhA           ------------
3cddD           ------------
1cjaA           ------------
3dymA           K-----------
1e59A           ------------
1e9rF           ------------
2dflA           ------------
1b0uA           ------------
2bbsB           ------------
2cckB           ------------
1e9rD           ------------
3d3qB           ------------
2dr3C           ------------
2dr3F           ------------
2c0bL           ------------
1draA           ------------
3bb1C           ------------
2b8tC           ------------
2a1fF           ------------
3czpA           ------------
1e9sH           ------------
3dm9B           ------------
1bmfC           ------------
2drcA           ------------
3bo6B           ------------
2d3wC           ------------
3cmvB           ------------
1e9sL           ------------
1afrA           ------------
1e3mB           ------------
3dauA           ------------
2ck3C           ------------
3crmA           ------------
2c5mD           ------------
2d4uA           ------------
3bb1G           ------------
2ausC           ------------
1av6A           ------------
1adoA           GHACTQKYSH--
1dekA           ------------
1e6cA           ------------
2d3wA           ------------
3dfnC           ------------
3bv4A           GHACTQKYSH--
2e85A           ------------
1e2iB           ------------
1eamA           ------------
3cbnA           ------------
3dfqA           ------------
1e2gA           ------------
2aumA           ------------
1d6jB           ------------
2d2eA           ------------
2boeX           ------------
1e9rG           ------------
2czvB           ------------
4dfrA           ------------
2bhvA           ------------
2bhvD           ------------
3cr7D           ------------
3bk7A           ------------
2d3wD           ------------
3dfqD           ------------
1e2mB           ------------
3dfoD           ------------
2a1fD           ------------
1d6jA           ------------
3dfpC           ------------
2d2fA           ------------
3d1mA           ------------
3ec1A           ------------
1ak2A           ------------
3cnlA           ------------
3dfnD           ------------
1bglA           ------------
3clvA           ------------
3dfnA           ------------
3ch4B           ------------
3d1mB           ------------
5dfrA           ------------
1dyhA           ------------
1aldA           ------------
3dfpD           ------------
3b55A           ------------
1drbA           ------------
3dftD           ------------
3cr7A           ------------
2awoD           ------------
3dfoC           RTVPP-------
2ccjA           ------------
2aumB           ------------
3a00A           ------------
1accA           ------------
3cmuA           ------------
2aunA           ------------
3dftC           ------------
3cioD           ------------
1ek0A           ------------
3dyoA           ------------
2a1fE           ------------
6aldA           ------------
1e2nA           ------------
3bb1D           ------------
2dpyB           ------------
1akeA           ------------
1dw9A           ------------
2a1fC           ------------
3dfqC           ------------
1bccF           ------------
3di4A           ------------
2dpyA           ------------
3bczC           ------------
3b85B           ------------
3b9qA           ------------
1e9sA           ------------
1e4vA           ------------
2a5vA           ------------
1e9sE           ------------
1dp0A           ------------
3bm2B           ------------
3cueF           ------------
2bbtA           ------------
2bv7A           ------------
1e2iA           ------------
3dm5B           ------------
2aunB           ------------
1e2mA           ------------
2cdnA           ------------
2a5vB           ------------
2anbA           ------------
1c9kC           ------------
2bkeA           ------------
2an9A           ------------
1e2jA           ------------
1e2kB           ------------
3c7kC           ------------
2c95B           ------------
2e85B           ------------
2d4uB           ------------
3e70C           ------------
3cnnA           ------------
1dvrA           ------------
2d7vA           ------------
2d7vB           ------------
3dvlD           ------------
1e2nB           ------------
2dftA           ------------
3a00B           ------------
2ancD           ------------
3c15C           ------------
3ed8A           ------------
1cjtC           ------------
2cbzA           ------------
3bjqB           ------------
2ancF           ------------
3cr7B           ------------
1ckeA           ------------
2dftC           ------------
1e9sK           ------------
1cjuC           ------------
3c14C           ------------
2ancB           ------------
1ckvA           ------------
1e2lA           ------------
1culC           ------------
1e2lB           ------------
1e9rB           ------------
1e1qB           ------------
3cr8B           ------------
3bwdD           ------------
2b0lC           ------------
2aexA           ------------
2c9oA           ------------
2bboA           ------------
1cs4C           ------------
3cqcA           ------------
3cphA           ------------
2b8tD           ------------
1d8jA           ------------
3csuA           ------------
3dmdA           ------------
2c9gA           ------------
1d2zD           ------------
1e2jB           ------------
1e2hA           ------------
3c85A           ------------
3e8aC           ------------
3dfdA           ------------
3dkvA           ------------
3do6A           ------------
1chdA           ------------
3cd9A           ------------
1azsC           ------------
3cddA           ------------
3bs4A           ------------
3cddE           ------------
2bsqE           ------------
3cbqA           ------------
3c7kA           ------------
2bwjB           ------------
2a78A           ------------
1d6aA           ------------
2axnA           ------------
3ci2A           ------------
2dx7A           ------------
2bhvC           ------------
1cjvC           ------------
1dwmA           ------------
2bwjD           ------------
1agpA           ------------
2bsqH           ------------
2c9oB           ------------
3dzvA           ------------
2bwjF           ------------
3dvlC           ------------
2b0lB           ------------
2dwuB           ------------
2ax4A           ------------
2ax4B           ------------
2bwjE           ------------
2a5vC           ------------
2bwjC           ------------
1dapA           ------------
1e6vC           ------------
2a5fA           ------------