[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD98951.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bemA.bssp"
#ERROR : Can't open dsspfile "3bemB.bssp"
#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "2b67A.bssp"
#ERROR : Can't open dsspfile "3e39B.bssp"
#ERROR : Can't open dsspfile "3e39A.bssp"
#ERROR : Can't open dsspfile "3bm1B.bssp"
#ERROR : Can't open dsspfile "3ek3A.bssp"
#ERROR : Can't open dsspfile "3e10A.bssp"
#ERROR : Can't open dsspfile "3bm1A.bssp"
#ERROR : Can't open dsspfile "3bm2A.bssp"

## Summary of PDB Search
:214
    4e-31  24%  3bemA  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    2e-29  24%  3bemB  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    2e-28  21%  1bkjA  [d.90.1] NADPH-FLAVIN OXIDOREDUCTASE
    5e-27  25%  2b67A  [x.x.x] COG0778: NITROREDUCTASE
    5e-26  24%  3e39B  [x.x.x] PUTATIVE NITROREDUCTASE
    8e-26  24%  3e39A  [x.x.x] PUTATIVE NITROREDUCTASE
    1e-23  17%  3bm1B  [x.x.x] PROTEIN YDJA
    9e-23  20%  3ek3A  [x.x.x] NITROREDUCTASE
    1e-22  24%  3e10A  [x.x.x] PUTATIVE NADH OXIDASE
    4e-22  17%  3bm1A  [x.x.x] PROTEIN YDJA
    3e-19  15%  3bm2A  [x.x.x] PROTEIN YDJA
:214

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTPEGKDKLRSFF
3bemA           -----HAEFTHLVNERRSASNFLSG-HPITKEDLNEFELVALAPSAFNLQHTKYVTVLDQDVKEKLKQAA
3bemB           -----HAEFTHLVNERRSASNFLSG-HPITKEDLNEFELVALAPSAFNLQHTKYVTVLDQDVKEKLKQAA
1bkjA           ------NNTIETILAHRSIRKFT-AVPITDEQRQTIIQAGLAASSSSMLQVVSIVRVTDSEKRNELAQFA
2b67A           --------FLELNKKRHATKHFT-DKLVDPKDVRTAIEIATLAPSAHNSQPWKFVVVREKNAELAKL--A
3e39B           -----ENPVLQAIRQRRSIRRYT-DEAVSDEAVRLILEAGIWAPSGLNNQPCRFLVIRADDPRCDILA-A
3e39A           -----ENPVLQAIRQRRSIRRYT-DEAVSDEAVRLILEAGIWAPSGLNNQPCRFLVIRADDPRCDILA-A
3bm1B           -------DALELLINRRSASRLAEP-APTGEQLQNILRAGMRAPDHKSMQPWHFFVIEGEGRERFSAV--
3ek3A           ------NEVLETIKARRSVRAYD-RKQIPADDLNAILEAGAYAPSG-HYETWHFTAVCNTVKLEELNE--
3e10A           -----------IINNRRSIRNYKGK-KVEKEKIEKLLR-AAQAPSAGNQQPWEFIVLEDRENIDKLSNFS
3bm1A           -------DALELLINRRSASRLAEP-APTGEQLQNILRAGMRAPDHKSMQPWHFFVIEGEGRERFSAV-L
3bm2A           -------DALELLINRRSASRLA-EPAPTGEQLQNI-------LRAGRAQPWHFFVIEGEGRERFSAV--


                         .         .         *         .         .         .         .:140
query           MKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILNTFLPLYENADKQLLTADAMV
3bemA           --NGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENRGEQFK----RDE
3bemB           --NGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENRGEQFK----RDE
1bkjA           --GNQAYVESAAEFLVFCIDYQRHATINPDVQADFTELTLI--------------------------GAV
2b67A           YGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFS--EEQLQYFKNLPAEFARYSEQQVSDYLAL
3e39B           HTRYGHIVRGAKVIILVFLDREAYNEVKD----------------------------------------H
3e39A           HTRYGHIVRGAKVIILVFLDREAYNEVKD----------------------------------------H
3bm1B           LEQGAIAAGSDDK---------AIDKARNAPFR-------------APLIITVVAKCEENHKVPRWEQEM
3ek3A           ----------------RIKGAFAKSDDKHLRERGHSETYCCYYHAPTLVIVSNEPKQWW----------A
3e10A           --KYANSLKTAPLAIVLLADEEKK-----------------------------------------ISEWE
3bm1A           EQGAIAAGSDDKAID--------------KARNAPFRAPLII---------TVVAKCEENHKVPRWEQEM
3bm2A           LEQGAIAAGSDDKAIDKARNAPFR-----------------------------------APLIITVVAKC


                         +         .         .         .         .         *         .:210
query           DSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPERYVPVMAIAVGKADSQSTDIKSTRYSVDDV
3bemA           AIRNASLSAFLSAAAAGWDTCPI-GFDAEAVKRILNI-DDQFEVVITIGKEKTESRRP--RGYRKPVNEF
3bemB           AIRNASLSAFLSAAAAGWDTCPI-GFDAEAVKRILNI-DDQFEVVITIGKEKTESRRP--RGYRKPVNEF
1bkjA           DSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGPENSAVLFGMCLGHPDQNPE--VKPRLPAHVV
2b67A           NAGLVA-NLVLALTDQGIGSNIILGFDKSKVNEVLEI-EDRFRPELLITVGYTDEKLE--PSYRLPVDEI
3e39B           QAAGAAVQNLLAAHALQLGAVWLGEIINQAATPALALDPARLSFEAAIAAGHPA----------------
3e39A           QAAGAAVQNLLAAHALQLGAVWLGEIINQAATPALALDPARLSFEAAIAAGHPA----------------
3bm1B           SAGCAVMAMQMAAVAQGFGGIWRSGTESPVVREAFGC-REQDKIVGFLYLGTPQ----------------
3ek3A           GDCACAIENFLAATSLGIASCWINQPEVRAYLTSLGV-PENHKVYGCVALGYKAEGAL--LKEKTVKAGT
3e10A           QDAAAAENILLEAAYLDLGAVWLGAEERVKNLKEFNL-KSNIKPFCVISVGYPENSEN--KFIDRFDAKR
3bm1A           SAGCAVMAMQMAAVAQGFGGIWRSGTESPVVREAFGC-REQDKIVGFLYLGTPQ----------------
3bm2A           EQESAGCAVAQAAVAQGFGGIWRSGAESPVVREAFGC-REQDKIVGFLYLGTPQLSIN--VPDPTPFVTY


                         .         .         .         +         .         .         .:280
query           IEFQ
3bemA           VEY-
3bemB           VEY-
1bkjA           VHEN
2b67A           IE--
3e39B           ----
3e39A           ----
3bm1B           ----
3ek3A           ITI-
3e10A           IHI-
3bm1A           ----
3bm2A           F---