[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99160.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbo1.bssp"

## Summary of PDB Search
:82
    9e-19  27%  3bbo1  [x.x.x] RIBOSOMAL PROTEIN L31
:82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGR
3bbo1           -KKELHPEFHEDAKVYCNGELVMTTGGT--------------KKEYVVDVWSGNHPFYLGNRSAMVDADQ


                         .         .         *         .         .         .         .:140
query           VDRFNKKYGxxx
3bbo1           VEKFRKRFA---