[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99233.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c4eA.bssp"
#ERROR : Can't open dsspfile "2c49A.bssp"
#ERROR : Can't open dsspfile "3cqdA.bssp"
#ERROR : Can't open dsspfile "3b3lA.bssp"
#ERROR : Can't open dsspfile "3cqdB.bssp"
#ERROR : Can't open dsspfile "2c49B.bssp"
#ERROR : Can't open dsspfile "2awdB.bssp"
#ERROR : Can't open dsspfile "2afbA.bssp"
#ERROR : Can't open dsspfile "2abqA.bssp"
#ERROR : Can't open dsspfile "2awdA.bssp"
#ERROR : Can't open dsspfile "2dcnA.bssp"
#ERROR : Can't open dsspfile "1dgmA.bssp"
#ERROR : Can't open dsspfile "3bf5B.bssp"
#ERROR : Can't open dsspfile "2a9yA.bssp"
#ERROR : Can't open dsspfile "1dgyA.bssp"
#ERROR : Can't open dsspfile "2afbB.bssp"
#ERROR : Can't open dsspfile "1dh2A.bssp"
#ERROR : Can't open dsspfile "2absA.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "1dh1A.bssp"
#ERROR : Can't open dsspfile "2ajrA.bssp"
#ERROR : Can't open dsspfile "3bf5A.bssp"
#ERROR : Can't open dsspfile "2ddoB.bssp"
#ERROR : Can't open dsspfile "2ddoA.bssp"
#ERROR : Can't open dsspfile "1c3qA.bssp"
#ERROR : Can't open dsspfile "2ajpA.bssp"
#ERROR : Can't open dsspfile "2ajpB.bssp"
#ERROR : Can't open dsspfile "2ddmA.bssp"
#ERROR : Can't open dsspfile "2ddmB.bssp"
#ERROR : Can't open dsspfile "1ekqB.bssp"
#ERROR : Can't open dsspfile "3efyA.bssp"
#ERROR : Can't open dsspfile "1ekqA.bssp"
#ERROR : Can't open dsspfile "2ddwB.bssp"
#ERROR : Can't open dsspfile "3efyB.bssp"
#ERROR : Can't open dsspfile "1ekkA.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "2ax3A.bssp"
#ERROR : Can't open dsspfile "3bgkA.bssp"
#ERROR : Can't open dsspfile "1d5mC.bssp"

## Summary of PDB Search
:307
    2e-57  21%  2c4eA  [x.x.x] SUGAR KINASE MJ0406
    3e-55  21%  2c49A  [x.x.x] SUGAR KINASE MJ0406
    1e-54  23%  3cqdA  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    1e-53  14%  3b3lA  [x.x.x] KETOHEXOKINASE
    1e-53  23%  3cqdB  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    5e-53  21%  2c49B  [x.x.x] SUGAR KINASE MJ0406
    6e-50  18%  2awdB  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    1e-49  21%  2afbA  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    3e-49  17%  2abqA  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    6e-49  18%  2awdA  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    6e-47  21%  2dcnA  [x.x.x] HYPOTHETICAL FRUCTOKINASE
    3e-46  18%  1dgmA  [c.72.1] ADENOSINE KINASE
    4e-46  19%  3bf5B  [x.x.x] RIBOKINASE RELATED PROTEIN
    4e-46  16%  2a9yA  [x.x.x] ADENOSINE KINASE
    8e-46  17%  1dgyA  [x.x.x] ADENOSINE KINASE
    2e-45  21%  2afbB  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-44  17%  1dh2A  [x.x.x] ADENOSINE KINASE APO FORM
    2e-44  18%  2absA  [x.x.x] ADENOSINE KINASE
    5e-44  22%  1bx4A  [c.72.1] PROTEIN (ADENOSINE KINASE)
    8e-43  17%  1dh1A  [x.x.x] ADENOSINE KINASE
    3e-41  16%  2ajrA  [x.x.x] SUGAR KINASE, PFKB FAMILY
    1e-35  17%  3bf5A  [x.x.x] RIBOKINASE RELATED PROTEIN
    6e-35  18%  2ddoB  [x.x.x] PYRIDOXINE KINASE
    6e-33  17%  2ddoA  [x.x.x] PYRIDOXINE KINASE
    1e-29  14%  1c3qA  [c.72.1] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE)
    4e-29  14%  2ajpA  [x.x.x] PYRIDOXAL KINASE
    2e-26  15%  2ajpB  [x.x.x] PYRIDOXAL KINASE
    6e-25  17%  2ddmA  [x.x.x] PYRIDOXINE KINASE
    3e-23  19%  2ddmB  [x.x.x] PYRIDOXINE KINASE
    2e-17  17%  1ekqB  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    8e-17  10%  3efyA  [x.x.x] CIF (CELL CYCLE INHIBITING FACTOR)
    8e-17  17%  1ekqA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    1e-16  25%  2ddwB  [x.x.x] PYRIDOXINE KINASE
    1e-15  10%  3efyB  [x.x.x] CIF (CELL CYCLE INHIBITING FACTOR)
    2e-13  16%  1ekkA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    3e-13  13%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    5e-13  14%  2ax3A  [x.x.x] HYPOTHETICAL PROTEIN TM0922
    4e-10  12%  3bgkA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-08   7%  1d5mC  [b.40.2 - d.15.6] ENTEROTOXIN TYPE B
:307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDVQGEM
2c4eA           --EKITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
2c49A           --EKITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
3cqdA           MVRIYTLTLAPSLDSATITPQIYPEGKLR-CTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGAT-GEH
3b3lA           ---QILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADF
3cqdB           MVRIYTLTLAPSLDSATITPQIY-PEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGAT-GEH
2c49B           --EKITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSG
2awdB           ---LIVTVTNPSIDISYLLDHLK-LDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGFH-GAF
2afbA           HHHKVVTFGEILRL------SPPDHKRIFQTDSFDVTYGGAEANVAAFLAQ-GLDAYFVTKLPNNPLGDA
2abqA           ----YTVTLNPSIDYIVQVENFQ-QGVVNRSERDRKQPGGKGINVSRVLKRLGHETKALGFLGGFT-GAY
2awdA           ---LIVTVTNPSIDISYLLDHLK-LDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGFH-GAF
2dcnA           ---KLITLGEILIEFNA-----LSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYN
1dgmA           --MRVFAIGNPILDLVAEVPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
3bf5B           ---FLAYFGHLNIDVLISVDSIPREGSVN-VKDLRPRFGGTAGNFAIVAQKFRIPFDLYSAVGKTHREY-
2a9yA           --MRVFAIGNPILDLVAEVPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
1dgyA           ---FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
2afbB           --HKVVTFGEILRL------SPPDHKRIFQTDSFDVTYGGAEANVAAFLAQGL-DAYFVTKLPNNPLGDA
1dh2A           ---FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
2absA           --MRVFAIGNPILDLVAEVPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
1bx4A           -----------NDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQQPHKAATFFGCIGIDKFGEI
1dh1A           ---FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQV
2ajrA           ----LTVTLNPALDREIFIEDFVNRLYRINDLSKTQSPGGKGINVSIALSKLGVPSVATGFVGGYGKILV
3bf5A           ---FLAYFGHLNIDVLISVDSIPREGSVN-VKDLRPRFGGTAGNFAIVAQKFRIPFDLYSAVGKTHREYL
2ddoB           ------------------------------------NDKSRALQADIVAVQS---QVVYGSVGNSIAVP-
2ddoA           -----------------------------------VVYGSVGNSIAVPAKQNGLNVFAVPTVLLSNTPHY
1c3qA           ----------------------------------------------------------------SMDAQS
2ajpA           -----------------------------------VIRGYVGNRAATFPQVLGFEIDAVNSVQFSNHTGY
2ajpB           -----------------------------------VIRGYVGNRAATFPQVLGFEIDAVNSVQFSNHT--
2ddmA           -----------------------------------VVYGSVGNSIAVPAKQNGLNVFAVPTVLLSNTPH-
2ddmB           ------------------------------------NDKSRALQADIVAV--QSQVVY-GSVGNSIAVPA
1ekqB           ----------------------------------------------------------------------
3efyA           -------------------------------------------------CGVTANAIMKLFLDKDGFSYC
1ekqA           ----------------------------------------------------------------------
2ddwB           ----------------------------------------------------------------------
3efyB           -------------------------------------------------CGVTANAIMKLFLDKDGFSYE
1ekkA           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
2ax3A           ----------------------------------------------------------------------
3bgkA           ----------------------------------------------------------------------
1d5mC           ------------------------------------------SQPDPKPDELHKSSKFTGLMENMKVSAI


                         .         .         *         .         .         .         .:140
query           MLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTTVIQNAMNDIKDSDFLVAQFE
2c4eA           YERYLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEI--VHIATGDPE
2c49A           YERYLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNF--NTEIVHIATGDPE
3cqdA           LVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDERQLEEQVLEIESGAILVISGS
3b3lA           LVADFRRRGVDVSQVAWQSKTPSSCCIINNSNGNRTIVLHDTSLPDVEKVDLTQFKWIHIEGRNASEQVK
3cqdB           LVSLLADENVPVATVEAKDWTQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGG
2c49B           YERYLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEI--VHIATGDPE
2awdB           IANELKKANIPQAFTSIKEERDSIAILHEGNQTEILEAGPTVSPSNFLENFDQLIKQAEIVTISGSLAKG
2afbA           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAEDFDWEKILDGARWFHPLGK
2abqA           VRNALEKEEIGLSFIEVEGDTRINVKIKGKQETELNGTAPLIKKEHVQALLEQLTELEKGDVLVLAGSVP
2awdA           IANELKKANIPQAFTSIKEERDSIAILHEGNQTEILEAGPTVSPEEISNFLENFDQLIKQAEIVTISGSG
2dcnA           AIEWLRGQGVDVSHMKIDPSATGIFFIQRPLKSESIYYRKGSAGSKLSPEDVDEEYVKVHSSGITLAISS
1dgmA           LKELCDKEGLATRFMVAPGQSTGVCAVLINE-KERTLCTHLGACGSFRLPEDWTTFGALIFYATAYTLTA
3bf5B           ---LAIESGINTGHV-EKFEDESGPICYIATDGKKQVSFHQGAAA---------------WAPQLADEYE
2a9yA           LKELCDKEGLATRF-MVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFGALIFYATAYTLTA
1dgyA           LKELCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALFYATAYTLTA
2afbB           AAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHISEAKREDFDWEKILDGSGITPPLGK
1dh2A           LKELCDKEGLATRFMVAPGQSTGTCAVLINE-KERTLCTHLGACGSFRIPEDWTTFGALIFYATAYTLTA
2absA           LKELCDKEGLATRFMVAPGQSTGVCAVLINE-KERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTA
1bx4A           LKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWVEKARVCYIALT
1dh1A           LKELCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALIFYATATLTA
2ajrA           EELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDDVNHFLRRYKTLSKVDCVVISGS
3bf5A           AIESGINTGHVEKFE---DESGPICYIATDGKKQVSFHQGAAAWA-----------------PQLADEYE
2ddoB           ---AIKQNGLNVFAVPTVLLSNTPHYD---------TFYGGAIPDEWFSGYLRALQERDALRQLRAVGTA
2ddoA           DTFYGGAIPDE-------WFSGYLRALQERDALRQLRAVTTGYMG--------TASQIKILAEWLTALRK
1c3qA           AAKCLTAVRRHSPLVH-----SITNNVVTNFTANGLLALGASPVMAYAKEEVADM---AKIAGALVLNIG
2ajpA           --AHWKGQVLNSDEL------QELYEGLRLNNMNKYDYVLTGYTRDKSF--LAMVVDIVQELKQQNPRLV
2ajpB           --------GYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLV
2ddmA           -YDTFYGGAIPDEWFSGYLRA-----LQERDALRQLRAVTTGYM--GTASQIKILAEWLTALRKDHPDLL
2ddmB           ----IKQNGLNV---------FAVPTVLLSNTPHYDTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTA
1ekqB           ---------------------HSITNNVVTNFTANGLLALGASPVMAYA--KEEVADMAKIAGALVLNSK
3efyA           NEQTLSLEQLQER------------LSCMPECKSFVLRVNDGALGHAYIVDIPKGENSCRPAFLYQSDLG
1ekqA           ---------------TAVRRHSPLVHNVVTNFTANGLLALGASPVMAYA--KEEVADMAKIAGALVLNIK
2ddwB           ----------------------------------------------------------------------
3efyB           NEQTLSLEQLQ------------ERLSCMPECKSFVLRVNDGALGHAYIVDIPKGENCRPAFLYQSDLGE
1ekkA           -----------------------------TNFTANGLLALGASPVMAYA--KEEVADMAKIAGALVLNSK
3dzvA           ------------------------------CESANALLYIDAKPIADDPREFPQFQQTSALVLNLGHLSQ
2ax3A           ------------------------NLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPG
3bgkA           ---------------------SGAGLVTVATHKDNITALHSHLPEAAFDVEKDRLSEQITAADVVLGPGD
1d5mC           NVKSIDQFLYFDLIYSIKDTLGNYDNVRVEFKNKDLADKYKDKYVDV-----------------------


                         +         .         .         .         .         *         .:210
query           TPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDLIIPNETEAELLTGIKVVDEDTCRQAADKLI
2c4eA           FNLKCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERASN--------LLNFEIDDY
2c49A           FNLKCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERASN--------LLNFEIDDY
3cqdA           LPPGVKLEKISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIV
3b3lA           MLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEAL----RGLYGR
3cqdB           VKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIV
2c49B           FNLKCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERASN--------LLNFEIDDY
2awdB           LPSDFYQELVQKAHAQEVKVLLDTSGDSLRQVLGPWKPYLIKPNLEELEGLLGQDFSEPLAAVQTALTKP
2afbA           ELPLILEDALKVANEKGVTVSCDLNYRAAQKVIPFEYVDVLIANEEDIEKVLGISVNREAYAKIAEEVTR
2abqA           QAPQTIYRSTQIAKERGAFVAVDTSGE-ALHEVLAAKPSFIKPNHHELSELVSKPIASIEDAIPHVQRLI
2awdA           LPSDFYQELVQKAHAQEVKVLLDTSGDSRQVLQGPWKPYLIKPNLEELEGLLGQDFSEPLAAVQTALTKP
2dcnA           TAKEAVYKAFEIASNRSFDTNIRLKLWSAEEAKRKFHLKFLITDTDDSKIILG------ESDPDKAAKAF
1dgmA           TPKNAFEVAGYAHGIPNAIFTLNLSAYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVTGALRLLTAGQN
3bf5B           YVHFSTGPNYLDAKSIRSKIIFDPSQE----------IHKYSKDELKKFHEISYSIFNDHEYRVFRETGL
2a9yA           TPKNALEVAGYAHGIPNAIFTLNLELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSTGQN
1dgyA           TPKNALEVAGYAHGIPNAIFTLNLSAYKDAMQSLLLHTNILFGNEEEFAHLAKVHAEKVALSVANKEHAV
2afbB           ELPLILEDALKVANEKGVTVSCDLNYEEAQKVIPFEYVDVLIANEEDIEKVLGISVEREAYAKIAEEVTR
1dh2A           TPKNALEVAGYAHGIPNAIFTLNLSAYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAADKTANKEHAV
2absA           TPKNALEVAGYAHGIPNAIFTLNLSAYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVNKEHALLTAGQN
1bx4A           VSPESVLKVAHHASENNRIFTLNLSAYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKQALPKMN
1dh1A           TPKNALEVAGYAHGIPNAIFTLNLSAYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKVANKEHAV
2ajrA           IPPGVNEELVRLARERGVFVFVEQTPRLERIYEGPEFPNVVKPDRGNHASFLGVDLKTFDDYVKLAEKLA
3bf5A           YVHFSTGPNYLDAKSIRSKIIFDPSQE----------IHKYSKDELKKFHEISYSIFNDHEYRVFRETGL
2ddoB           SQIKILAEWLTALRKDHPDLLVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLL
2ddoA           DHPDLLIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLL
1c3qA           TLVEAMIIAGKSANEHGVPVILDPVGAGATPFRREVRLAAIRGNAAEIAHTVGVTDWLIKGVDAGEGGGD
2ajpA           YVCDP---VLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2ajpB           YVCD----PVLGDKWDGEGSMYVPEDLLPYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLH
2ddmA           IMVD------PVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLL
2ddmB           SQIKILAEWLTALRKDHPDLLIKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLL
1ekqB           ESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTEVRLAAIRGNAAEIAHTVG-----GGDIIRLAQQAA
3efyA           EVTRKLRFEDWMTHKALT---------PILLDDICNYFSCMSQNKTDLEQIATLFDIDG----------N
1ekqA           ESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIRGNAAEIAHTVGGDIIR------LAQQAA
2ddwB           -----------------VDPVIGPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLL
3efyB           GVTRKLRFEDWMTHKALT---------PILLDDICNYFSCMSQNKTDLEQIATLFDIDG---------NV
1ekkA           ESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTEVRLAAIRGNAAEIAHTVGVTDWLGGDIIRLAQQAA
3dzvA           EREQSLLAASDYARQVNKLTVVDLVGYGASEKLVHNQPTVVKGNLSERTFCQLVSHAIEELIQALRQQTQ
2ax3A           NNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERAVLTPHPGEARLV-KKTVGDVKYNYELAEEFA
3bgkA           DLAQTTFDVVWQAIEPKQTLIIDGSAINLLKAIWPTKQIILTPHQKEWERLSGLTIPEQIEAATQT-ALA
1d5mC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DQGINNVIITLGKQGAYYKTKDGVCELVPAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKA
2c4eA           LERVDALIVTKGSKGSVIYTKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYD-LEKCGLIGAAT
2c49A           LERVDALIVTKGSKGSVIYTKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYD-LEKCGLIGAAT
3cqdA           NSGAKRVVVSLGPQGALGVDSENCIQ-VVPPPVKSQSTVGAGDSMVGAMTLKLAENAS-LEEMVRFGVAA
3b3lA           VRKGAVLVCAWAEEGADALGPDGKLLHDAFPPPRVVDTLGAGDTFNASVIFSLSQGRS-VQEALRFGCQV
3cqdB           NSKAKRVVVSLGPQGALGVDSENCIQ-VVPPPVKSQSTVGAGDSMVGAMTLKLAENAS-LEEMVRFGVAA
2c49B           LERVDALIVTKGSKGSVIYTKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYD-LEKCGLIGAAT
2awdB           FAGIEWIVISLGKDGAIAKHHDQFYR-VKIPTIQAKNPVGSGDATIAGLAYGLAKDAP-AAELLKWGAAG
2afbA           KYNFKTVGITLRESISATVNYNGQPHFSNRYEIHIVDRVGAGDSFAGALIYGS--LGFDSQKKAEFAAAA
2abqA           GEGIESILVSFAGDGALFASAEGFH--VNVPSGEVRNSVGAGDSVVAGFLAALQEGKS-LEDAVPFAVAA
2awdA           FAGIEWIVISLGKDGAIAKHHDQFYR-VKIPTIQAKNPVGSGDATIAGLAYGLAKDAP-AAELLKWGAAG
2dcnA           SDYAEIIVMKLGPKGAIV-YYDGKKYYSSGYQVPVEDVTGAGDALGGTFLSLYYKGFE-MEKALDYAIVA
1dgmA           TGATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYALSQGKT-VKQCIMCGNAC
3bf5B           SSPKVTTIVTNGERGSSLFDGKKY---DFPAIPSSGDTVGAGDSFRAGLYLALYNRRS-IEKGIYGTIIA
2a9yA           TSATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYALSQGKT-VKQCIMCGNAC
1dgyA           EGATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYGLSQGKT-VKQCIMCGNAC
2afbB           KYNFKTVGITLRESISATVNYNGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLG--FDSQKKAEFAAAA
1dh2A           EGATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYGLSQGKT-VKQCIMCGNAC
2absA           TSATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYALSQGKT-VKQCIMCGNAC
1bx4A           SKRQRIVIFTQGRDDTIMATESEVTAFLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKP-LTECIRAGHYA
1dh1A           TGATKLVVMTRGHNPVIAAEQTADGTVVVVAAEKIVDTNGAGDAFVGGFLYGLSQGKT-VKQCIMCGNAC
2ajrA           EKSQ-VSVVSYEVKNDIVATREGVWLIRSKEEIDTSHLLGAGDAYVAGVYYFIKHGAN-FLEA-KFGFAS
3bf5A           SSPKVTTIVTNGERGSSLFDGKKY---DFPAIPSSGDTVGAGDSFRAGLYLALYNRRS-IEKGIYGTIIA
2ddoB           SDTLKWVVVTSASENQEMQVVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKA-LTDAVHRAGLR
2ddoA           SDTLKWVVVTSEMQVVVV---TADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKA-LTDAVHRAGLR
1c3qA           IIRLAQQVIAITGEVDVIADTSHVYT-LHNGHKLLTKVTGAGCLLTSVVGAFCAVEEN-PLFAAIAAISS
2ajpA           SMGPDTVVITSSDLPSPQGSNYLIVLIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVST
2ajpB           SMGPDTVVITSSDLPSPQGSNYSVVMERIRMDIRKVVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVST
2ddmA           SDTLKWVVVTSQEMQVVVVTADSV--NVISHSRVKTDLKGTGDLFCAQLISGLLKGKA-LTDAVHRAGLR
2ddmB           SDTLKWVVVTSASGENQEMQVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKA-LTDAVHRAGLR
1ekqB           QKLNTVIAITGE--VDVIADTSHVYTLHNGHKLLTVTGAGLLTSVVGAFCAVEENPLFAAIAAISSYGVA
3efyA           VKMLRKENIQYQKHDNFSFQLFEYDTDNIEKNIEIIKSLCSGA---------------------------
1ekqA           QKLNTVIAIT----GEVDVIADTSHVYTLHNGHKLLTKVTGAGLLVGAFCAVEENPLFAAIAAISSYGVA
2ddwB           SDTLKWVVVTSASGNVVVVTADSV--NVISHSRVKTDLKGTGDLFCAQLISGLLKGKA-LTDAVHRAGLR
3efyB           KMLRKENIQYQKHDNFSFQLFEYDT-DNIEKNIEIIKSLCSGAAAL------------------------
1ekkA           QKLNTVIAITGEV----DVIADTSHVYTLHNGHKLLTKVTGAGLLTSVVGAFCAVEEN-PLFAAIAAISS
3dzvA           KFPQTVFLATGI--QDVLVSQEQV--IVLQNGVPELDCFTGTGDLVGALVAALGNAPTAAVAAVSYFNLC
2ax3A           KENDCVLVLK----SATTIVTDGEKTLFNITGNTGLSKGGSGDVLIAGFIAQGLSPLEASTVSVYLHGFA
3bgkA           HFPKETILVAKSH-QTKIYQGQKI-GHIQVGGPY--QATGGGDTLAGIAGFVAQFHTDRF-EVAAAAVFL
1d5mC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSLAVQRLGAIPSIPYKDDVEKQLNSK
2c4eA           ASFVVEAKGCQTNLPTWDKVVERLEK-
2c49A           ASFVVEAKGCQTNLPTWDKVVERLEK-
3cqdA           GSAATLLCSHDDTQKIYAYLS------
3b3lA           AGKKCGLQGFDGIV-------------
3cqdB           GSAATLNQGT--RLCSHDDTQKIYA--
2c49B           ASFVVEAKGCQTNLPTWDKVVERLEK-
2awdB           ANAQERTGHVDV-ENVKKHLNIQVV--
2afbA           SCLKHTIPGDFVVLSI-EEIEKLAS--
2abqA           GSATAFSDGF-----------------
2awdA           ANAQERTGHDVENVKKHLNIQVVE---
2dcnA           STLNVMIRGDQENLPTTKDIETFLRE-
1dgmA           AQDVIQHVGFSLSFTSL----------
3bf5B           HHVIDDGIELNEDLERETENYRR----
2a9yA           AQDVIQHVGFSLSFTF-----------
1dgyA           AQDVIQHVGFSLS--------------
2afbB           SCLKHTIPGDFVVLSI-EEIEKLAS--
1dh2A           AQDVIQHVGF-----------------
2absA           AQDVIQHVGFSLS--------------
1bx4A           ASIIIRRTGCFPEKP------------
1dh1A           AQDVIQHVGFSLS--------------
2ajrA           ALAATRRKEKYPDLEAIKKEYDHFTVE
3bf5A           HHVIDDGIENFSLNEDLERETEN----
2ddoB           VLEVMRYTQQHESDE------------
2ddoA           VLEVMRYTQQHESDE------------
1c3qA           YGVAAQLAAQQTADKGPGSFQ------
2ajpA           LHHVLQRTIQCAKAQAGEGVR------
2ajpB           LHHVLQIQCAKAQSPMQLELR------
2ddmA           VLEVMRYTQQHESDEL-----------
2ddmB           VLEVMRYTQQHESDE------------
1ekqB           AQLAAQQTADKGPGSFQIELLNKL---
3efyA           ---------------------------
1ekqA           AQLAAQQTADKGPGSFQIELLNKL---
2ddwB           VLEVMRYTQQHES--------------
3efyB           ---------------------------
1ekkA           YGVAAQLAAQQTA--------------
3dzvA           GEKAKTKSQGLADFR------------
2ax3A           AELFEQD--------------------
3bgkA           HSYIADQLSK-----------------
1d5mC           ---------------------------