[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99260.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bpxB.bssp"
#ERROR : Can't open dsspfile "3e6mD.bssp"
#ERROR : Can't open dsspfile "3bpvA.bssp"
#ERROR : Can't open dsspfile "3bddD.bssp"
#ERROR : Can't open dsspfile "3cdhB.bssp"
#ERROR : Can't open dsspfile "2a61A.bssp"
#ERROR : Can't open dsspfile "3e6mE.bssp"
#ERROR : Can't open dsspfile "3bddB.bssp"
#ERROR : Can't open dsspfile "3bddA.bssp"
#ERROR : Can't open dsspfile "3e6mG.bssp"
#ERROR : Can't open dsspfile "3bjaA.bssp"
#ERROR : Can't open dsspfile "3boqA.bssp"
#ERROR : Can't open dsspfile "3e6mA.bssp"
#ERROR : Can't open dsspfile "2a61B.bssp"
#ERROR : Can't open dsspfile "3e6mC.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2eb7A.bssp"
#ERROR : Can't open dsspfile "3e6mF.bssp"
#ERROR : Can't open dsspfile "3boqB.bssp"
#ERROR : Can't open dsspfile "3ecoB.bssp"
#ERROR : Can't open dsspfile "3ecoA.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2d1hB.bssp"
#ERROR : Can't open dsspfile "3deuB.bssp"
#ERROR : Can't open dsspfile "3echB.bssp"
#ERROR : Can't open dsspfile "3e6mB.bssp"
#ERROR : Can't open dsspfile "3cdhA.bssp"
#ERROR : Can't open dsspfile "3bpxA.bssp"
#ERROR : Can't open dsspfile "2d1hA.bssp"
#ERROR : Can't open dsspfile "3echA.bssp"
#ERROR : Can't open dsspfile "3bj6A.bssp"
#ERROR : Can't open dsspfile "3bj6B.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "2ek5B.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "2bv6A.bssp"
#ERROR : Can't open dsspfile "3broA.bssp"
#ERROR : Can't open dsspfile "2d45D.bssp"

## Summary of PDB Search
:146
    1e-11  17%  3bpxB  [x.x.x] TRANSCRIPTIONAL REGULATOR
    1e-09  16%  3e6mD  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-09  17%  3bpvA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-09  13%  3bddD  [x.x.x] REGULATORY PROTEIN MARR
    1e-08  18%  3cdhB  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    2e-08  16%  2a61A  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    3e-08  15%  3e6mE  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-07  13%  3bddB  [x.x.x] REGULATORY PROTEIN MARR
    1e-07  13%  3bddA  [x.x.x] REGULATORY PROTEIN MARR
    2e-07  15%  3e6mG  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    3e-07  17%  3bjaA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY, PUTATIVE
    3e-07  15%  3boqA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    4e-07  17%  3e6mA  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    4e-07  17%  2a61B  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    6e-07  17%  3e6mC  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    7e-07  12%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    1e-06  12%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-06  17%  2eb7A  [x.x.x] 146AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-06  15%  3e6mF  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    2e-06  13%  3boqB  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    2e-06  20%  3ecoB  [x.x.x] MEPR
    3e-06  20%  3ecoA  [x.x.x] MEPR
    3e-06  11%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    4e-06  12%  2d1hB  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    4e-06  18%  3deuB  [x.x.x] TRANSCRIPTIONAL REGULATOR SLYA
    5e-06  16%  3echB  [x.x.x] MULTIDRUG RESISTANCE OPERON REPRESSOR
    6e-06  15%  3e6mB  [x.x.x] MARR FAMILY TRANSCRIPTIONAL REGULATOR
    6e-06  12%  3cdhA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    7e-06  17%  3bpxA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    1e-05  12%  2d1hA  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    1e-05  17%  3echA  [x.x.x] MULTIDRUG RESISTANCE OPERON REPRESSOR
    1e-05  15%  3bj6A  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    2e-05  15%  3bj6B  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    3e-05  15%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    3e-05  12%  2ek5B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    8e-05  15%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    1e-04  17%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    7e-04  14%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    7e-04  14%  2bv6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
    8e-04  12%  3broA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    9e-04  15%  2d45D  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
:146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKKLHLTPGTLTA
3bpxB           ---------------------------------NLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIAR
3e6mD           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTVGQLAT-LGVEQSTTSR
3bpvA           -------LKGLLSIILRSHRVFIGRELGHL---NLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIAR
3bddD           -------EEDLLYRLKVADETISNLFEKQL---GISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTR
3cdhB           ---------------------------------GLRVPEWRVLACLVDNDAITRLA----KLSLEQSRTR
2a61A           ---------------------------------GITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTG
3e6mE           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTV-GQLATLGVEQSTTSR
3bddB           -------EEDLLYRLKVADETISNLFEKQL---GISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTR
3bddA           -------EEDLLYRLKVADETISNLFEKQL---GISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTR
3e6mG           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTV-GQLATLGVEQSTTSR
3bjaA           -------LYGNIRDVYHLLQKNLDKAIEQY---DISYVQFGVIQVLAKSG-----KVSSKLIENGCVPSN
3boqA           ---------------------------------GLSLAKFDAAQLARN-PDGLSGKLSGALKVTNGNVSG
3e6mA           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTVGQLATL-GVEQSTTSR
2a61B           ---------------------------------GITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTG
3e6mC           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTVGQ-LATLGVEQSTTSR
2ek5A           ----------------------------------------------------STNELAAFHRINPATARN
2du9A           ----------------------------------------------------STNELAAFHRINPATARN
2eb7A           ---------------------------------NLSYLDFLVLRATSD-GPKTMAYLANRYFVTQSAITA
3e6mF           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTV-GQLATLGVEQSTTSR
3boqB           QQNQTRLWLNILRLHGLVFGDLNRQLLDET---GLSLAKFDAAQLARN-PDGLSGKLSGALKVTNGNVSG
3ecoB           ----------LFRMISHEMKQKADQKLEQF---DITNEQGHTLGYLHQQDGLTQNDIAKALQRTGPTVSN
3ecoA           ---------------------------------DITNEQGHTLGYLHQQDGLTQNDIAKALQRTGPTVSN
2ek5C           ----------------------------------------------------STNELAAFHRINPATARN
2d1hB           ---------------------LESKKDEIRCCYKITDTDVAVLLKVEIEKPITSEELADIFKLSKTTVEN
3deuB           LESP---LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLP--PDQSQIQLAKAIGIEQPSLVR
3echB           MNYPNPDLMPALMAVFQHVRTRIQSELDCQRL-DLTPPDVHVLKLI--DEQRGLNLQD----LGRQMITR
3e6mB           -GELNSFLPYLLTRITHIWSSELNQALASE---KLPTPKLRLLSSLSAYGELTVG-QLATLGVEQSTTSR
3cdhA           ---------------------------------GLRVPEWRVLACLVDNDAITRLAKLSLEQSRTRIVDQ
3bpxA           --DRDIPLKGLLSIILRSHRVFIGRELGHL---NLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIAR
2d1hA           ---------------------LESKKDEIRCCYKITDTDVAVLLKVEIEKPITSEELADIFKLSKTTVEN
3echA           YPVNPDLM-PALMAVFQHVRTRIQSELDCQRL-DLTPPDVHVLKLIDEQRGLNL---QDLGRQMCALITR
3bj6A           -TDQLYQAVQATRPLLRNITAAVERGTLRE---GVTVGQRAILEGLSLTPGATAPQ-LGAALQKRQYISR
3bj6B           -TDQLYQAVQATRPLLRNITAAVERGTLRE---GVTVGQRAILEGLSLTPGATAPQ-LGAALQKRQYISR
2d45B           ---------------------------------EISSAEWEVNIIWKKYAANNIIEEIQQKDWSPKTIRT
2ek5B           ----------------------------------------------------STNELAAFHRINPATARN
2d45A           ---------------------------------EISSAEWEVNIIWKKYAANNIIEEIQQKDWSPKTIRT
2acjD           --------------------------------SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINR
1biaA           --------------------------------------PLKLIALLANGEFHSGEQLGETLGMSRAAINK
2bv6A           ---------------------------------NLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSP
3broA           ----------RLLKIASNQSTRFDIFAKKYDLTGTQTIIDYLSRNK--NKEVLQRDLESEFSIKSSTATV
2d45D           ----------------------------------ISSAEWEVNIIWKKYAANNIIEEIQQKDWSPKTIRT


                         .         .         *         .         .         .         .:140
query           TIDRLCRKGYAEXXXXXXXXXXXXXXLTKKGRLVYRAHDAFHRMMVKSFLKDLNPDEIKTIEKAIHNLED
3bpxB           TLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAE
3e6mD           TVDQLVDEGLAARSISDADQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
3bpvA           TLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAE
3bddD           HLKLLEESGYII--------RKVLVWPTEQAREALITNPSAHHQAIKTSNQILTVEESEQFLATLDKLLI
3cdhB           IVDQDARGLVTRVADARVRVR-----LTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLD
2a61A           LVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKG
3e6mE           TVDQLVDEGLAARSISRKRTVV----LTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
3bddB           HLKLLEESGYII-------RKEVLVWPTEQAREALITNPSAHHQAIKTSNQILTVEESEQFLATLDKLLI
3bddA           HLKLLEESGYIIRKRNPDNQREVLVWPTEQAREALITNPSAHHQAIKTSNQILTVEESEQFLAT---LDK
3e6mG           TVDQLVDEGLAARSISQRKRTVV---LTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
3bjaA           TTIQRKRDGYVTEKNPNDQRETLVY-LTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKK
3boqA           LVNRLIKDGVVKAFSAK---------LTDAGLTTFKQASEAHNRILAELLRAVSDQDVEASAALRGILE-
3e6mA           TVDQLVDEGLAARSIDQRKRTVV---LTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
2a61B           LVKRLEADGYLT----RTPDRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKG
3e6mC           TVDQLVDEGLAARSISDRKRTVV---LTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
2ek5A           GLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAES--
2du9A           GLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAES--
2eb7A           SVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILK
3e6mF           TVDQLVDEGLAA---RSISQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
3boqB           LVNRLIKDGV--------VKASFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDVEASAALRGILE-
3ecoB           LLRNLERKKLIYRYVKNIG-------LTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS
3ecoA           LLRNLERKKLIY--RYVDAQRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS
2ek5C           GLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESRG
2d1hB           SLKKLIELGLVVRTKTPKYYYSISSNILEKIRNDLLNCAKREL---------------------------
3deuB           TLDQLEDKGLISRRIKLTEKAEPLIAEMEEVIHKTRG----------EILAGISSEEIELLIKLIAKLEH
3echB           KIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLA
3e6mB           TVDQLVDEGLAARSISDQRKRTVV--LTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK
3cdhA           DARGLVTRVARVRVRLTDDGRALAESLVASARAHETR-----------LLSALADTDAARIKGVLRTLLD
3bpxA           TLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKMCRRLAEEAVR
2d1hA           SLKKLIELGLVVRTKTPKYYYSISSNILEKIRNDLLNCAKREL---------------------------
3echA           KIRELEGRNLVR----------RQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQAT----------
3bj6A           ILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEAKL-------------------------
3bj6B           ILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEAKL-------------------------
2d45B           LITRLYKKGFID--RKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEE
2ek5B           GLTLLVEAGILYKKRGIGFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAES--
2d45A           LITRLYKKGFID--RKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIE-
2acjD           VLYSLAKKGK------------------------------------------------------------
1biaA           HIQTLRDWGVDV----------------------------------------------------------
2bv6A           LLKR-EQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASSLSQDEVKELNRLLGKVIHAF--
3broA           LLQRE-IKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYDSDQ-------------------------
2d45D           LITRLYKKGFID--RKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEE


                         +         .         .         .         .         *         .:210
query           FLKEHx
3bpxB           EAVR--
3e6mD           GKTDY-
3bpvA           EAVR--
3bddD           GLQN--
3cdhB           VL----
2a61A           VMERN-
3e6mE           GKTDY-
3bddB           GLQN--
3bddA           LLIGL-
3e6mG           GKTDY-
3bjaA           HL----
3boqA           ------
3e6mA           ------
2a61B           VMERN-
3e6mC           ------
2ek5A           ------
2du9A           ------
2eb7A           RIEE--
3e6mF           GKTDY-
3boqB           ------
3ecoB           SLQ---
3ecoA           SLQ---
2ek5C           ------
2d1hB           ------
3deuB           NIME--
3echB           ------
3e6mB           GKTDY-
3cdhA           VL----
3bpxA           MRGE--
2d1hA           ------
3echA           ------
3bj6A           ------
3bj6B           ------
2d45B           LRN---
2ek5B           ------
2d45A           ------
2acjD           ------
1biaA           ------
2bv6A           ------
3broA           ------
2d45D           L-----