[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99261.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b65A.bssp"
#ERROR : Can't open dsspfile "2ebdB.bssp"
#ERROR : Can't open dsspfile "2ebdA.bssp"
#ERROR : Can't open dsspfile "2ahbA.bssp"
#ERROR : Can't open dsspfile "2aj9A.bssp"
#ERROR : Can't open dsspfile "1eblA.bssp"
#ERROR : Can't open dsspfile "1cgkA.bssp"
#ERROR : Can't open dsspfile "2d3mA.bssp"
#ERROR : Can't open dsspfile "1ee0A.bssp"
#ERROR : Can't open dsspfile "1ee0B.bssp"
#ERROR : Can't open dsspfile "1d6iA.bssp"
#ERROR : Can't open dsspfile "2d51A.bssp"
#ERROR : Can't open dsspfile "3e1hA.bssp"
#ERROR : Can't open dsspfile "2d51B.bssp"
#ERROR : Can't open dsspfile "1cmlA.bssp"
#ERROR : Can't open dsspfile "2d3mB.bssp"
#ERROR : Can't open dsspfile "1d6hA.bssp"
#ERROR : Can't open dsspfile "1bq6A.bssp"
#ERROR : Can't open dsspfile "1bi5A.bssp"
#ERROR : Can't open dsspfile "1chwA.bssp"
#ERROR : Can't open dsspfile "2almA.bssp"
#ERROR : Can't open dsspfile "3e60A.bssp"
#ERROR : Can't open dsspfile "2buhA.bssp"
#ERROR : Can't open dsspfile "1afwA.bssp"
#ERROR : Can't open dsspfile "1e5mA.bssp"
#ERROR : Can't open dsspfile "1ek4A.bssp"
#ERROR : Can't open dsspfile "1b3nA.bssp"
#ERROR : Can't open dsspfile "2c7yA.bssp"
#ERROR : Can't open dsspfile "1dd8A.bssp"
#ERROR : Can't open dsspfile "1dluA.bssp"
#ERROR : Can't open dsspfile "2c7yB.bssp"
#ERROR : Can't open dsspfile "2btnA.bssp"
#ERROR : Can't open dsspfile "1afwB.bssp"
#ERROR : Can't open dsspfile "2bywA.bssp"
#ERROR : Can't open dsspfile "3cxbA.bssp"
#ERROR : Can't open dsspfile "1ejbA.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"

## Summary of PDB Search
:326
    9e-46   8%  1b65A  [d.154.1] PROTEIN (AMINOPEPTIDASE)
    2e-45  40%  2ebdB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    9e-42  40%  2ebdA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    9e-39  30%  2ahbA  [x.x.x] BETA- KETOACYL-ACP SYNTHASE III
    6e-37  30%  2aj9A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III
    4e-35  35%  1eblA  [c.95.1 - c.95.1] BETA-KETOACYL-ACP SYNTHASE III
    2e-30  18%  1cgkA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-30  15%  2d3mA  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    1e-28  15%  1ee0A  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    3e-28  15%  1ee0B  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    3e-28  15%  1d6iA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    7e-28  17%  2d51A  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    9e-28  14%  3e1hA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-27  17%  2d51B  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    2e-27  16%  1cmlA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-27  16%  2d3mB  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    4e-27  15%  1d6hA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    1e-25  16%  1bq6A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    3e-25  16%  1bi5A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    9e-23  17%  1chwA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    2e-19  12%  2almA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II
    7e-19  11%  3e60A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN ] SYNTHASE II
    5e-17  10%  2buhA  [c.95.1 - c.95.1 (1og8A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
    7e-17  12%  1afwA  [c.95.1 - c.95.1] 3-KETOACETYL-COA THIOLASE
    2e-16  15%  1e5mA  [c.95.1 - c.95.1] BETA KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    7e-16  10%  1ek4A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
    8e-15  11%  1b3nA  [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN
    1e-14  19%  2c7yA  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    2e-14  12%  1dd8A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
    2e-14  18%  1dluA  [c.95.1 - c.95.1] BIOSYNTHETIC THIOLASE
    5e-14  24%  2c7yB  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    5e-14  10%  2btnA  [x.x.x] AIIA-LIKE PROTEIN
    6e-12  17%  1afwB  [c.95.1 - c.95.1] 3-KETOACETYL-COA THIOLASE
    1e-11  10%  2bywA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    3e-10   8%  3cxbA  [x.x.x] PROTEIN SIFA
    2e-07  19%  1ejbA  [c.16.1] LUMAZINE SYNTHASE
    4e-04   8%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    4e-04   8%  2c44C  [x.x.x] TRYPTOPHANASE
    4e-04   8%  2c44B  [x.x.x] TRYPTOPHANASE
    9e-04   9%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNP
1b65A           -----------PFTGVTGPYNAITDVDGVGVGFQTIIENEPRPGRKRARSGVTAILPHMQSETPVPVYAG
2ebdB           -----------YLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKEETITYMATQAAKEALREANLSP
2ebdA           --GTKIIGTGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKEETITYMATQAAKEALREANLSP
2ahbA           -RSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTATGIKTRRFAADESAASMATEACRRALSNAGLSA
2aj9A           -RSVGLLSVGAYRPERVVTNDEICQHIDSSDEAIYTRTGIKTRRFAADESAASMATEACRRALSNAGLSA
1eblA           --------TGSYLPEQVRTNADLEK-VDTSDEWIVTRTGIRERHIAAPN-ETVSTGFEAATRAIEAGIEK
1cgkA           ------------------MYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPK
2d3mA           --------------------------LKKYPNITSYDEPSLNDRQDICVPGVPLGTEAAVKAIEEWGRPK
1ee0A           --------------AIKKRLALTEDYLQENPTMCEFMAPSLNARQDLVVTGVPLGKEAAVKAIDEWGLPK
1ee0B           --------------AIKKRLALTEDYLQENPTMCEFMAPSLNARQDLVTGVPMLGKEAAVKAIDEWGLPK
1d6iA           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVEVPRLGKEAAVKAIKEWGQPK
2d51A           --------------------------LKKYPNITSYDEPSLNDRQDICVPGVALGTEAAVKAIEEWGRPK
3e1hA           -LGLSITGLGVQYPPYSLGPDAIDILSKRKVLAINRYTGIDQRSSIFMSDGVPLAVEASRKAMAEARLVP
2d51B           ----------KKTMIGKRYFNYDEEFLKKYPNITSYDEPSLNDRQDIVPGVPALGTEAAVKAIEEWGRPK
1cmlA           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVEVPRLGKEAAVKAIKEWGQPK
2d3mB           ------------------------EFLKKYPNITSYDEPSLNDRQDIVPGVPALGTEAAVKAIEEWGRPK
1d6hA           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVEVPRLGKEAAVKAIKEWGQPK
1bq6A           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVRLGKEAAVKAIKEWGQPK
1bi5A           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPLGKEAAVKAIKEWGQPK
1chwA           ----------DKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVRLGKEAAVKAIKEWGQPK
2almA           -----------------------------------------------------------------QVLRL
3e60A           -----------------------------------------------------------EGIVEAGYTLR
2buhA           -----VWGNVKLDTTGLIDR-KVVRFMSSMEQAIADAGLSPEAYQNNPRVGGSGGGSPRFQVFGADAMRG
1afwA           ------SGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEEL
1e5mA           ------------------------------------------------------------------TILL
1ek4A           -----VWGNVKLDTTGLIDRKVV-RFMSSMEQAIADASPEAYQNNPRVGLIAGSGGSPRFQVFGADAMRG
1b3nA           ----------------------------------------------------------------------
2c7yA           --------------------------LYGDDVVIAHRTPLCKKRGNFKTYPDDLLAPVLRALIEKTNLNP
1dd8A           -----VWGNVKLDTTGLIDR-KVVRFMSSMEQAIADAGLSPEAYQNNPRVGLIGGGSPRFQVFGADAMRG
1dluA           ------------------------------------RTAVGSFNGAFNTPAHELGATVISAVLERAGVAA
2c7yB           ----------------------------------------------------------------------
2btnA           -----------LTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNEQILPKMTEEDRIVNILKRVGYEP
1afwB           ----------------------------------------------------------------------
2bywA           -------------------------AFLSMEQAIADAGLSPEAYQNNPRVGGSGGGSPRFQVFGADAMRG
3cxbA           ----------------------------------------------------------------------
1ejbA           ---------------------------DQVYDGSKIRVGIIHAR--WNRVIIDALVKGAIERMASLGVEE
2dgmC           ----------------------------------------------------------------------
2c44C           ----------------------------------------------------------------------
2c44B           ----------------------------------------------------------------------
2dgmB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NSLDLIIVATMSPNSFTPATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE
1b65A           VHRFNGNGEMTGT--HWIEDGGYFLGPVVITNTHGIGM-AHHATVRWMVDRYASTYQTDDFLWIMPVVAE
2ebdB           EELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAE
2ebdA           EELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAE
2ahbA           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
2aj9A           ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
1eblA           DQIGLIVVATTSATHAFPSAACQIQSLGIK-GCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSD
1cgkA           SKITHLIVCTTSGVDMPGADYQLTKLLGRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE
2d3mA           SEITHLVFCTSCGVDMPSADFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAE
1ee0A           SKITHLIFCTTAGVDMPGADYQLVKLLGLSPSVKRYMLYQQGAAGGTVLRLAKDLAENNKGSRVLIVCSE
1ee0B           SKITHLIFCTTAGVDMPGADYQLVKLLGLSPSVKRYMLYQQGAAGGTVLRLAKDLAENNKGSRVLIVCSE
1d6iA           SKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSE
2d51A           SEITHLVFCTSCGVDMPSADFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAE
3e1hA           AQITHMVSTTCTDSANPGYDHYVAKLGLSDRLEKVLLHGIGCSGGLAALRTAANLCLGGKPARILVLALE
2d51B           SEITHLVFCTSCGVDMPSADFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAE
1cmlA           SKITHLIVCTTSGVDMPGADYQLTKLLGRPYVKRYMMYQQGAFAGGTVLRLAKDLAENNKGARVLVVCSE
2d3mB           SEITHLVFCTSCGVDMPSADFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAE
1d6hA           SKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSE
1bq6A           SKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSE
1bi5A           SKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSE
1chwA           SKITHLIVCTTSGVDMPGADYQ--LTKLLGYVKRYMMYQQGSFAGGTVLRLAKDLAENNKGARVLVVCSE
2almA           HEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTE
3e60A           DKGPRRISPFFIPGRLINLASGYVSIKYGLRGP-NHSVVTACSTGAHAIGDAARLIALGDADVMLAGGTE
2buhA           PRGLKAVGPYVVTKAMASGVSACLATPFKI-HGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE
1afwA           QKNR-----EAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSI
1e5mA           DKGPSRCSPFMIPMMI-ANMASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQNGYAKAMICGGTE
1ek4A           PRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYS-ISSASATSAHCIGNAVEQIQLGKQDIVFAGGGE
1b3nA           ---GPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAE
2c7yA           SEVGDIVVGTVLAPGSASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE
1dd8A           PRGLKAVGPYVVTKAM-ASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE
1dluA           GEVNEVILGQVLPAGEGQNPARQAAKAGVPQEATAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGME
2c7yB           ----------------------------------------------------------------------
2btnA           DDLLYIISSHLHFDHAGG--NGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQ
1afwB           ----------------------------------------------------------------------
2bywA           PRGLKAVGPYVVTKAMASGVSACLATPFKIHGV-NYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGE
3cxbA           ----------------------TRERLTEIFFELKELACASQRDRFQVHNPHENDATIIL-RIMDQNEEN
1ejbA           NNIIIETVPGS---YELPWGTKRFVDRQAKLG-KPLDVVIPIGVLIKG----------------------
2dgmC           ----------------------------------------------------------------------
2c44C           ----------------------------------------------------------------------
2c44B           ----------------------------------------------------------------------
2dgmB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NLSKLIDWNDRSTAVLFGDGAAGALIELKEDTDSKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRK
1b65A           TYDGLNDINGFPVTEADVRKALDNVASGPVQEGNMITYGFKGGTGTASRVVEFGRSFTIGALVQ-ANHGQ
2ebdB           KLSEAVDWEDRSTCVLFGDGAGAVVVTRSEDKSDILATRMYAEGSLEEL----------------LHADN
2ebdA           KLSEAVDWEDRSTCVLFGDGAGAVVVT--RSEDKSDILATRMYAEGSLEELLHAD--------------N
2ahbA           KLSPTIDMYDAGNCFIFADGAAAVV-----VGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGP
2aj9A           KLSPTIDMYDAGNCFIFADGAAAVV-----VGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGP
1eblA           VLARTCDPTDRGTIIIFGDGAGAAVLA--ASEEPGIISTHLHADGSYGELLTNADRVNPENSIHL-----
1cgkA           VTAVTFRGPSDTGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDG--------HLRE
2d3mA           LTIMMLRAPNETHLDNAI-GISLFGDGAAALIIGSDPIIGVEKPMFEIVCTKQTVIPNTEDVIHLHLRET
1ee0A           ITAILFHGPNENHLSLVAQALFGDGAAALIVGSGPHLAVERPIFEIVSTDQTILPDTEKAMKLHLRE---
1ee0B           ITAILFHGPNENHLDSLVAQALFGDGAAALIVGSGPH---LAVERPIFEIVSTDQTILPDTEKAMKLHLR
1d6iA           VTAVTFRGPSDTHLSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSE---GAIDGHLRE
2d51A           LTINETHLDNAIGISLFGDGAAALIIGSDPIIGVEKPMF-------EIVCTKQTVIPNTEDVIHLHLRET
3e1hA           VSTTMALQETRIGIALFSDCASA--VILSNGIGEAPGKPAIYDLLGWENRVIPEHDLGFDVDPMGWKVVL
2d51B           LTIMETHLDNAIGISLFGDGAAALIIGSDPI-------IGVEKPMFEIVCTKQTVIPNTEDVIHLHLRET
1cmlA           VTAVTFRGPSDTHLDSLVGQALFGDGAAA-LIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHL-RE
2d3mB           LTIMMLRAPNETHLDNAIGISLFGDGAAALIIGSDPIIGVEKPMF-EIVCTKQTVIPNTEDVIHLHLRET
1d6hA           VTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDP---VPEIEKPIFEMVWTAQTIAPDSEGAIDGHLR
1bq6A           VTAVTFRGPSDTHLSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTI---APDSEGAIDGHLRE
1bi5A           VTAVTFRGPSDTHDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHL---RE
1chwA           VTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPI-FEMVWTAQTIAPDSEGAIDGHL-RE
2almA           ASITPFAIAGFQALTALSTTEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGA--TILAEVVGY
3e60A           SPINRISLAGFSACRALSTCRNDDPERASRPYDV-DRDGFVMGEGAAIVVLEELEHAKKRGARIYAEIIG
2buhA           ELCWEMACEFDAMGALSTKYNDKASRTYDAHRDGFVIAGG----GGMVVVEELEHALARGAHIYAEIVGY
1afwA           C---QSDEGPRPNVTAESL--------SSIRPAFIGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLG
1e5mA           AAITPLSYAGFA--------SARALSFRNDDPLHASRPFDKDRDGVMGEGSGILILEELESAIYGEMVGY
1ek4A           ELCWEMACAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAH----IYAEIVGY
1b3nA           KASTPLGVGGFGAARALSTRN------DNPQAASRPWDKERDGLGDGAGMLVLEEYEHAKKRGAKIYAEV
2c7yA           SMTTNPKFADQAAVDSHRKAAAAIPVKTKLVDPKTGDESVDDGIRPTTTLASLGKLKPVFKKDGTTTAGN
1dd8A           ELCWEMACEFDAMGALSTKYN------DTPEKASRTYDAH------RDGFVIAGVVEELEHALRGAHIYV
1dluA           SMSMAPHCAHLRGGVKMGDF--------------------------------------------IQPLGR
2c7yB           ----------------------------------------------------------------------
2btnA           LLYTPGHSPGHQSLFIKTEQSGSVLLT----IDASYTKENFEDE------VPFAGFDPELALSSIKRLKE
1afwB           ----------------------------------------------------------------------
2bywA           ELCWEMACEFDAMGALSTKYNDTPEKASRAHRDGFVIAGGGGMVVVEELEHALARGAH----IYAEIVGY
3cxbA           ELLRITQNTDTFSCEVMGNLYFL-------------------MKDRPDILKSHPQMTAMIKRRYSEIVDY
1ejbA           ----------------------------------------------------------------------
2dgmC           -------------------------------------------------AVCFKLKDGEDPGYTLYDLSE
2c44C           -------------------------------------------------------------------AVE
2c44B           -------------------------------------------------------------------AVE
2dgmB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPINIDS
1b65A           RDWLTIAGVPVGQHMRDGTPQS-------------QLSIIVVLATDLPLMPHQLKRLARRASIGIGRNGT
2ebdB           CGYIRMKGRELFKVAVRSMEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKEKVFVNIQK
2ebdA           CGYIRMKGRELFKVAVRSMEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKEKVFVNIQK
2ahbA           RPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLLRPDAVVANDIEH
2aj9A           RPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVANDIEH
1eblA           -----TAGNEVFKVAVTELAHIVDETLAANNNDRSQLDWLVPHQANLRIISATAKKLGSDNVVV--TLDR
1cgkA           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
2d3mA           GMMFSKGSPMTISNNVEACLIDVFKSVGITPPEDWNSLFWIPHPGGRAILDQVEAKLKLRPEKFRAARTD
1ee0A           GGLTFQLHRDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRHVLSE
1ee0B           EGGLTQLHRDVPLMVAKNIENAAEKALSPLGITDWNSVFWMVHPGGRAILDQVERKLNLKEDKLRASRHE
1d6iA           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAQPGGPAILDQVEQKLALKPEKMNATREE
2d51A           GMMFSKGSPMTISNNVEACLIDVFKSVGITPPEDWNSLFWIPHPGGRAILDQVEAKLKLRPEKFRAARTD
3e1hA           SPRVPVLAKASLQPTYADLLSSLQDQLPSSYQK-PADFDWAMHPGGATILSGAESAMGLTPEHMRASYDN
2d51B           GMMFSKGSPMTISNNVEACLIDVFKSVGITPPEDWNSLFWIPHPGGRAILDQVEAKLKLRPEKFRAARTD
1cmlA           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
2d3mB           GMMFSKGSPMTISNNVEACLIDVFKSVGITPPEDWNSLFWIPHPGGRAILDQVEAKLKLRPEKFRAARTD
1d6hA           EGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
1bq6A           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
1bi5A           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
1chwA           AGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREE
2almA           GNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVAYVNAAGTSTPANEKGESGAIVAVLGKEVPVSS
3e60A           YLSGDAYHITAPSESGEGAQRSMMAALKRAQVNVSELDYINAHGTSTMADVIELAAVEYYAPQVSMSAPA
2buhA           GATSDGADM----VAPSGEGA-VRCMKMAMHGVDTPIDYLSTPVGDVKELAAIREVFGDKSPAISATKAM
1afwA           RYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGA
1e5mA           AMTCDAYHITAPVPDGRGATRAIAWALKDSGLKPEMVSYINAHGTSTPANRAIKQALGNHAYNIAVSSTM
1ek4A           GAT--SDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSVGDVKELAAIREVFGDKSPAISATKAM
1b3nA           GFGMSSDAYHMTSPPENGAGAALANALRDAGIEASQIGYVNAHGTSTPAGDKVKTIFGEAASRVLVSSTM
2c7yA           SSQVMQKGLPVLGFAAVGVDPAIMGAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGA
1dd8A           GYGATSDGADMVAPSGEGAVRCMKMA---MHGVDTPIDYLSTPVGDVKELAAIREVFGDKSPAISATKAM
1dluA           IVSWATVGVDPKVMGTGPIP-ASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVN---
2c7yB           -------------------------AVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGMA
2btnA           VV--KKEKPIIF----------------------------------------------------------
1afwB           -------------------------VLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGIA
2bywA           GATSDGADM----VAPSGEGA-VRCMKMAMHGVDTPIDYLSTPVGDVKELAAIREVFGDKSPAISATAAM
3cxbA           PLPSTLCLNPAGAPILSVPLDNIEGYLYTELRKGHLDGWKAQEK-----ATYLAAKIQSGIEKTTRILH-
1ejbA           ----------------------------------------------------------------------
2dgmC           RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLL------EDYKASLKYLSDHPK--------
2c44C           IGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFII------EAFKHVKENASNIKGLTF-----
2c44B           IGSFLLGRDPKTGKQLPCPAELLRLTIPRATYTQTHMDFII------EAFKHVKENASNIKGLTFTKVLR
2dgmB           ---------PAFTLGGEATDIVVMRIMCRRGFEMDFAELLL------EDYKASLKYLSDHPK--------


                         .         *         .         .         .         .         +:350
query           FGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY
1b65A           PGGNNSGDIFIAFSTANQRPMHRSAPFLDVEMVNDEPL--------
2ebdB           YGNTSAASIPIALHEAIKEGKVKRGDLILMTAMGGGLTWGAVLLRY
2ebdA           YGNTSAASIPIALHEAIKEGKVKRGDLILMTAMGGGLTWGAVLLRY
2ahbA           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRM
2aj9A           TGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRM
1eblA           HGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFTWGSALVRF
1cgkA           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
2d3mA           YGNMVSASVGYILDEMRRKSAAKGLETYVLLGFGPGITVETILLH-
1ee0A           YGNLISACVLFIIDEVRKRSTGEGLDCGVLFGFGPGMTVETVVLR-
1ee0B           YGNLISACVLFIIDEVRKRSMAEGLDCGVLFGFGPGMTVETVVLR-
1d6iA           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
2d51A           YGNMVSASVGYILDEMRRKSYGEGLEWGVLLGFGPGITVETILLH-
3e1hA           HGNSSSATIFSVLNRLREKDMDALAPGGVGCAFGPGINVEMCMLK-
2d51B           YGNMVSASVGYILDEMRRKSYGEGLEWGVLLGFGPGITVETILLH-
1cmlA           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
2d3mB           YGNMVSASVGYILDEMRRKSAAKGLEWGVLLGFGPGITVETILLH-
1d6hA           YGAMSSACVLFILDEMRKKSTQNGLEWGVLFGFGPGLTIETVVLR-
1bq6A           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
1bi5A           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
1chwA           YGNMSSACVLFILDEMRKKSTGEGLEWGVLFGFGPGLTIETVVLR-
2almA           TGHLLGAAGAVEAIVTI-----------------------------
3e60A           TLNLENPSIETKIDLVPHKPRERKIDTVLSNSFGFGGTNASLVMR-
2buhA           TGHSLGAAGVQEAIYSLEHGFIAPSINIMSNSFGFGGT-NATLV--
1afwA           LGHPLGCTGARQVATILRELKKDQI-GVVSMCIGTGMGAAAIFIK-
1e5mA           TGHLLGGSGGIELDYVPGQSRALIVDVALSNSFGFGGH-NVTLA--
1ek4A           TGHSLGAAGVQEAIYSLEHGFIRELTTVMSNSFGFGGT-NATLV--
1b3nA           TGHLLGAAGAVESIYSI-----------------------------
2c7yA           IGHPLGATGARCVATLLHEMRRGKDCRFGVSMCIGTGMGAAAVFE-
1dd8A           TGHSLGAAGVQEGLNIVTETTDRELTTVMSNSFGFGGT-NATLV--
1dluA           -GGAIAIGHPILLFEMKRRG-ARKGLATLCIGGGMG----------
2c7yB           IGHPLGATGARCVATLLHKRRGKDCRFGVVSMCIGTGMGAAAVFE-
2btnA           ----------------------------------------------
1afwB           LGHPLGCTGARQVATILRELKKDQIG-VVSMCIGTGMGAAAIFIK-
2bywA           TGHSLGAAGVQEAIYNIVTETTDRELTTVMNSFGFGGT-NATLV--
3cxbA           HANISESTQQNAFLETMAMCGLKQL---------------------
1ejbA           ----------------------------------------------
2dgmC           ----------------------------------------------
2c44C           ----------------------------------------------
2c44B           --HFTAKLKEV-----------------------------------
2dgmB           ----------------------------------------------