[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99303.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cimB.bssp"
#ERROR : Can't open dsspfile "2cjaB.bssp"
#ERROR : Can't open dsspfile "2dq0A.bssp"
#ERROR : Can't open dsspfile "1b76A.bssp"
#ERROR : Can't open dsspfile "1atiB.bssp"
#ERROR : Can't open dsspfile "2cimA.bssp"
#ERROR : Can't open dsspfile "1atiA.bssp"
#ERROR : Can't open dsspfile "2cjaA.bssp"
#ERROR : Can't open dsspfile "1asyA.bssp"
#ERROR : Can't open dsspfile "2cjbA.bssp"
#ERROR : Can't open dsspfile "1adjA.bssp"
#ERROR : Can't open dsspfile "2du5A.bssp"
#ERROR : Can't open dsspfile "2du3A.bssp"
#ERROR : Can't open dsspfile "3bjuC.bssp"
#ERROR : Can't open dsspfile "2dq2A.bssp"
#ERROR : Can't open dsspfile "2cj9A.bssp"
#ERROR : Can't open dsspfile "3e9hA.bssp"
#ERROR : Can't open dsspfile "2cj9B.bssp"
#ERROR : Can't open dsspfile "2d32C.bssp"
#ERROR : Can't open dsspfile "2dq3A.bssp"
#ERROR : Can't open dsspfile "1e1tA.bssp"
#ERROR : Can't open dsspfile "3bjuD.bssp"
#ERROR : Can't open dsspfile "3cmqA.bssp"
#ERROR : Can't open dsspfile "2cjbB.bssp"
#ERROR : Can't open dsspfile "1eiyA.bssp"
#ERROR : Can't open dsspfile "1bbuA.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "2du7A.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "2du5B.bssp"
#ERROR : Can't open dsspfile "2du3B.bssp"
#ERROR : Can't open dsspfile "1e1oA.bssp"
#ERROR : Can't open dsspfile "2du4A.bssp"
#ERROR : Can't open dsspfile "2eiuC.bssp"
#ERROR : Can't open dsspfile "2eiuE.bssp"
#ERROR : Can't open dsspfile "2eiuD.bssp"
#ERROR : Can't open dsspfile "3dsqA.bssp"
#ERROR : Can't open dsspfile "2bamB.bssp"
#ERROR : Can't open dsspfile "1bhmB.bssp"
#ERROR : Can't open dsspfile "3bamA.bssp"
#ERROR : Can't open dsspfile "3dsqB.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "3cw4A.bssp"
#ERROR : Can't open dsspfile "3d1tB.bssp"
#ERROR : Can't open dsspfile "2bamA.bssp"
#ERROR : Can't open dsspfile "11asA.bssp"
#ERROR : Can't open dsspfile "2e3cA.bssp"
#ERROR : Can't open dsspfile "1bhmA.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "2e1bA.bssp"
#ERROR : Can't open dsspfile "3bjuB.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "2e7gA.bssp"
#ERROR : Can't open dsspfile "3c2wC.bssp"
#ERROR : Can't open dsspfile "3biiD.bssp"
#ERROR : Can't open dsspfile "3cwiA.bssp"

## Summary of PDB Search
:649
    3e-65  12%  2cimB  [x.x.x] SERYL-TRNA SYNTHETASE
    5e-61  15%  2cjaB  [x.x.x] SERYL-TRNA SYNTHETASE
    5e-61  17%  2dq0A  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-60  16%  1b76A  [d.104.1 - c.51.1] PROTEIN (GLYCYL-TRNA SYNTHETASE)
    7e-60  16%  1atiB  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    1e-58  11%  2cimA  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-58  16%  1atiA  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    4e-57  15%  2cjaA  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-52  11%  1asyA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
    5e-52  12%  2cjbA  [x.x.x] SERYL-TRNA SYNTHETASE
    5e-51  14%  1adjA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    4e-50  10%  2du5A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    1e-49   9%  2du3A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-49  10%  3bjuC  [x.x.x] LYSYL-TRNA SYNTHETASE
    6e-49  15%  2dq2A  [x.x.x] SERYL-TRNA SYNTHETASE
    2e-48  13%  2cj9A  [x.x.x] SERYL-TRNA SYNTHETASE
    4e-46  10%  3e9hA  [x.x.x] LYSYL-TRNA SYNTHETASE
    6e-45  12%  2cj9B  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-42  11%  2d32C  [x.x.x] GLUTAMATE--CYSTEINE LIGASE
    2e-42  17%  2dq3A  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-42  12%  1e1tA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    5e-42   9%  3bjuD  [x.x.x] LYSYL-TRNA SYNTHETASE
    7e-42   8%  3cmqA  [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL
    5e-41  12%  2cjbB  [x.x.x] SERYL-TRNA SYNTHETASE
    8e-41  16%  1eiyA  [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-40  12%  1bbuA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    2e-36  13%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    1e-34   8%  2du7A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    5e-34  12%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    2e-33  12%  2du5B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    7e-33  12%  2du3B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    1e-32  11%  1e1oA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    7e-32  13%  2du4A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    8e-32   9%  2eiuC  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    2e-30  15%  2eiuE  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    2e-30  13%  2eiuD  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    6e-28  14%  3dsqA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    2e-27   8%  2bamB  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    4e-27   9%  1bhmB  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    1e-26   9%  3bamA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)
    2e-26  12%  3dsqB  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-25  16%  1b70A  [d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    4e-25   4%  3cw4A  [x.x.x] POLYMERASE BASIC PROTEIN 2
    8e-25   9%  3d1tB  [x.x.x] UPF0343 PROTEIN NGO0387
    1e-24   8%  2bamA  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    3e-24   6%  11asA  [d.104.1] ASPARAGINE SYNTHETASE
    1e-22  15%  2e3cA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    5e-22   8%  1bhmA  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    7e-22  10%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    9e-22  13%  2e1bA  [x.x.x] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
    5e-19  10%  3bjuB  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-16   9%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    2e-14   7%  2e7gA  [x.x.x] PUTATIVE RIBOSOME-BINDING FACTOR A
    7e-10  15%  3c2wC  [x.x.x] BACTERIOPHYTOCHROME
    7e-05  12%  3biiD  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 1
    2e-04  14%  3cwiA  [x.x.x] THIAMINE-BIOSYNTHESIS PROTEIN THIS
:649

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSIKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIITKDSNDGL
2cimB           ----------------------------------------------------------------------
2cjaB           ---------------------------------------------------KLQFNLKAYFKTSAD----
2dq0A           ----------------------------------------------------------------------
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cimA           ----------------------------------------------------LQFNLKAYFKTSADPTPA
1atiA           ----------------------------------------------------------------------
2cjaA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
1adjA           ----------------------------------------------------------------------
2du5A           ----------------------------------------------------------------------
2du3A           ----------------------------------------------------------------------
3bjuC           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
3e9hA           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------
2d32C           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
1e1tA           ----------------------------------------------------------------------
3bjuD           ----------------------------------------------------------------------
3cmqA           ----------------------------------------------------------------------
2cjbB           ---------------------------------------------------HMKLQFNLKAYFADPTPAK
1eiyA           ----------------------------------------------------------------------
1bbuA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2du5B           ----------------------------------------------------------------------
2du3B           ----------------------------------------------------------------------
1e1oA           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
2e1bA           LLDQTIFYPTGGGQPHDRGTNGVEV-------LDVYKDEEGNVWHVVKEPEKFKVGDEVELKIDWDYRYK
3bjuB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           --ATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAA--VNQTLVSFDHPLTDGDEVAFFP-------
3cwiA           -----LTVGKPSTVDGAESLNVTELLSALKVAQAEYELNGEVLEREAFDATTVKDGDAVEFLY-------


                         .         .         *         .         .         .         .:140
query           VVLWRTAAQVLANALHELYPNMKFGMGDVTEHGFYFDTDNSESQVAETDFEKISQKMSEIIKANLPIERV
2cimB           -----SHMKLQFNLAYFKTSADPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKDRIELTLQSGRY
2cjaB           -------PTPAKDAIAALFEEANSTLAPEGQGAKVTEWKLGE------DRIELTLQSGRYVRVHDAIFRL
2dq0A           ----------------------------------------------------------------------
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cimA           -------KDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLGE------DRIELTLQSGRYVRVHDAIFRL
1atiA           ----------------------------------------------------------------------
2cjaA           ----------------------------------------------WKLRIELTLQSGRYVRVHDAIFRL
1asyA           ------------------------------NYGKLPLIQSRDSRVKFVDLDEAKDSDKEVLFRARVHNTR
2cjbA           ----------------------HMKLQFNLKAYFKTKDAANSTLLTRGAPEGQGATEWDRIELTLQSGRY
1adjA           ----------------------------------------------------------------------
2du5A           ----------------------------------------------------------------------
2du3A           ----------------------------------------------------------------------
3bjuC           ------------------------------------------------YYKIRSQAIHQLKVNGEDPYPH
2dq2A           ----------------------------------------------------------------------
2cj9A           --------------------------------QFNLKA-----YFAKDAIAALFEEANSTLLTRGAPEGQ
3e9hA           ------------------------------------------------QLRVRREKLKKIEELGVDPFGK
2cj9B           --------------------------------KLQFNLKAY--FKTSADPTPAKDAIAALFEEANSTLLT
2d32C           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
1e1tA           -----------AIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSD-QLHEEFDAKDNQELESLNIEVS
3bjuD           -----------------------------------------------------------------QYYKI
3cmqA           ----------------------------------------------------------------------
2cjbB           DAIAALFEEANSTLLTRGAPEGQ--------------------GAKVTEWKLGEDRIELTLQSGRYVRVH
1eiyA           ----------------------------------------------------------------------
1bbuA           ------------------------------------------------ELKTRREKLANLREQGIAFPND
1c0aA           --------------------------------------------------------MRTEYCGQLRLSHV
2du7A           ----------------------------------------------------------------------
1bbwA           ------------------------------------------------ELKTRREKLANLREQGIAFPN-
2du5B           ----------------------------------------------------------------------
2du3B           ----------------------------------------------------------------------
1e1oA           ----------------------------------------------FNDELRNRREKLAALRQQGVAFPN
2du4A           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
2e1bA           LMRIHTGLHLLEHVLNEVLGNWQLVGSGMSVEKGRYDIAYPENL--NKYKEQIISLFNKYVDEGGEVKIW
3bjuB           ------------------------------------------------YYKIRSQAIHQLKVNGEDPYPH
1b8aA           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EFSEEEALNLVSGDEYQEELVRDVANKNNGRVVAYKQGDFIDITDGVVLSSTGEVKIFKLLSVAGAYWKG
2cimB           VRVHDAIFRLRKQLAEALGKKYI--EVESFIIK-VPADHELRMLKVPYIKSMENIEGGI--QLELEVGEA
2cjaB           RKQLAEALGKKYKIGIRGIEVESFI------IKVPADHELRL--KVPYIKSENIEGGIQLELEVGEAEKN
2dq0A           ---------------------------------------------------------------------K
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cimA           RKQLAEA-------LGKKYKIGIRGIEVESFIIKVPADHELRMLKVPYIKSMENIEGGIQL--ELEVGEA
1atiA           ----------------------------------------------------------------------
2cjaA           RKQLAEALG----KKYKIGIRGI--EVESFIIKVPADHELRL--KVPYIKSENIEGGIQLELEVGEAEKN
1asyA           QQGATLAFLTLRQQASLIQGLVKA--NKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNL
2cjbA           VRVHDAIFRLQLAEIEVESFI-----------IKVPADHELRMLKVPYIKSMENIEGGIQLELEVGEAE-
1adjA           ----------------------------------------------------------------------
2du5A           ---------------------------------------GKEILAERSPNELYPRVGFSFGKEHPLFATI
2du3A           ---------------------------------------GKEILAERSPNELYPRVGFSFGKEHPLFATI
3bjuC           KFHVDISLTDFISHLQPGDHLTDITLKVAGRIHAGGKLIFYDLRGEGVKLQSRNYKSEEEFIHINNKLRR
2dq2A           ---------------------------------------------------DYYLWRLPNITHPSVPVGK
2cj9A           GAKVTEWDRIELTLQSGRYVRVHDAIFRLRKQLAVPADHELRMLKVPYIKSMENIEGGIQLELEV--GEA
3e9hA           RFERTHKAEELFYGDLSKEELEEQQIEVAGRIMTMGKAGFAHIQDVTGQ--IQIYVRQDDVGEQQYELFK
2cj9B           RGAPEGQGAKVTEWKLGEDRIHDAIFRLRKQLIKVPADHELRMLKVPYIKSMENIEGGIQLELEVGEAEM
2d32C           ----------------------------------------------------------------------
2dq3A           ---------------------------------------------------------------------E
1e1tA           VAGRMMTRRI------------------------MGKASFVTLQDVGGRIQLYVAR-DSLPEGVYNDQFK
3bjuD           RSQAIHQLKVNGEDPYPHKFHVDISLTDFIQK--YSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDL
3cmqA           ----------------------------------------------------------------------
2cjbB           DAIFRLRKQL-----AEALGKKYRGIEVESFIIKPADHELRML-KVPYIKSMENIEGGIQLE--LEVGEA
1eiyA           --------------------------------------------------------------------QN
1bbuA           FRRDHTSDQLHAEFDGKENEELEALNIEVGRMMTRIMGKFVTLQDVGGRI-QLYVARDDLPEGVYNEQFK
1c0aA           QVTLCGWVNRRRD---LGSLIFIDMRDREGIVQVFFDPDRADALKLAELRNEFCIQVTGTVRARDEKNIN
2du7A           ----------------------------------------------------------------------
1bbwA           DFRRDHTSDQLHFDGKENEELEALNIEVAGRMMTMGKASFVTLQDVGGRIQLY-VARDDLPEGVYNEQFK
2du5B           ----------------------------------------------------------------------
2du3B           ----------------------------------------------------------------------
1e1oA           DFRRDHTSDQLHFDAKDNQELESLNIEVSGRMMTRIMGKFVTLQDVGGRIQLYVAR-DSLPEGVYNDQFK
2du4A           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           ---------------------------------------------------------------------S
1b70A           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
1bhmA           -------------------------------------------------------------------FIT
2d6fD           ---------------------------------------RTELTDS---EPDHDIVRNLRPTRAAFEEAM
2e1bA           WEGDRRYT--------------------------QIRDFEVIPCGGTHVKDIKEIKKLKRSSIGRGKQR-
3bjuB           KFHVDISLTDFIQKYSHLQPGDHLTDITLGRIHAKGKLIFYDLRGEGVKLQVMA--NSRNYKSEEEFIHI
1b8aA           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ASSNPMLQRIYGTAFYKQKDLDAELQRQKEARERDHRVIGNELDLFFVDPKVGAGLPYWMPNGATIRRVI
2cimB           EMKNRVPDRILTLLEEKIEAAYEHWNLLWQREPMEHPFKEDPTQAMMKEGGSSRGQWIHGPQSARIFRTF
2cjaB           RVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPEHPFKEDPTQAKELKRGSSRGQWIHGPQSARIFRTF
2dq0A           DENDNVPIRFWGKARVWKGHLERFLEQSQEWKPKLHVDLLEILGGADFAKVSGSRFYYLLNEIVILDLAL
1b76A           -----------------------------ASSLDELVALCKRRGFIFQSSEIYGGVYDYGPLGVELKNNL
1atiB           -----------------------------ASSLDELVALCKRRGFIFQSSEIYGGVYDYGPLGVELKNNL
2cimA           EMKNRVPDRILTLLEEKYGAKAEHWNLLWQREPMEHPFKEDPTQAMMLKRGSSRGQWIHGPQSARIFRTF
1atiA           --------------------ASSLDELVALCKRRGFIFQSSEI------YGGLQGVYDYGPLGVELKNNL
2cjaA           RVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPEHPFKEDPTQAGWLKRGSSRGQWIHGPQSARIFRTF
1asyA           EIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVID---LRTVTNQAIFRIQAGV
2cjbA           -MKNRVPDRILTLLEEKIEAAQEHWNLLWQREPMEHPFKEDPTQAMMLKRGSSRGQWIHGPQSARIFRTF
1adjA           -------------------------------------------------ARAVRGTKDLFGKELRMHQRI
2du5A           QRLREAYLS-IGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPNVGISAEKIRQIEAITKREVD
2du3A           QRLREAYLS-IGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPNVGISAEKIRQIEAITKREVD
3bjuC           GDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHGLKDKETRYRQRY-LDLILNDFVRQKFIIRSKI
2dq2A           DENDNVPIRFWGKARVWKGHLERFLEQILEWKPKLHVDLLEILGGADFAKVSGSRFYYLLNEIVILDLAL
2cj9A           EMKNRVPDRILTLLEEKIEAAKAEWNLLWQREPMEHPFKEDPTQAMMLKRGSSRGQWIHGPQSARIFRTF
3e9hA           ISDLGDIVGVRGTMFKKVGELSIKVSSYEFLTKALRPLPEKDIEQRYRQRYLDLIMNPESKKTFITRSLI
2cj9B           KNRVPDRILTLLEEKIEAAQYAEHWNLLWQREPMEHPFKEDPTQAMMLKRGSSRGQWIHGPQSARIFRTF
2d32C           ----------------------------------------------------------------------
2dq3A           DEKDNVEVRRWGEPR------------KFDFEPKPHWEIGERLDFKRGAKLSGSRFTVIAGWGARLERAL
1e1tA           KWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYRQRY-LDLIANDKSRQTFVVRSKI
3bjuD           RGEGVKLQVMQGNPGKTKKGELSIIPYEITLLSPCLHMLPKDKETRYRQRYLDLILNDFVRQKFIIRSKI
3cmqA           ----------------------------GKSYPQDDHSNLTRKVLT-------RVGRNLHNQQHHPLWLI
2cjbB           EMKNRVPDRILTLLEEKIEAAQYEWNLLWQREPMEHPFKEDPTQAMMLKRGSSRGQWIHGPQSARIFRTF
1eiyA           ARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEVSLPGASLFSGGLHPITLM
1bbuA           KWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDDQEARYRQRYLDLISNDESRNTFKVRSQI
1c0aA           RDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRR----------PEMAQRLKTRAKI
2du7A           -----------------RFDIKKVLELAEKDFETAWRETRALIKDKHID-NKYPRLKPVYGKPHPVMETI
1bbwA           KWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDQEARYR-QRYLDLISNDESRNTFKVRSQI
2du5B           ----------------DPQKYRELAEKDFEAAWKAGKEILAERSPNELYP----RVGFSFG-KEHPLFAT
2du3B           ----------------DPQKYRELAEKDFEAAWKAGKEILAERSPNELYP----RVGFSFG-KEHPLFAT
1e1oA           KWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYR-QRYLDLIANDKSRQTFVVRSKI
2du4A           ----------------DPQKYRELAEKDFEAAWKAGKEILAERSPNELYP----RVGFSFGKE-HPLFAT
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           ---------------------------------SDALSRDRAFQGIEH-----QLMSQGKRHLEQLRTVK
2bamB           ----------------------------------TFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKP
1bhmB           ---------------------------------KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKP
3bamA           ---------------------------------KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKP
3dsqB           SFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQ-----LRTVKHRPALLEL
1b70A           ------------------------------------------------------GASLFSGGLH-PITLM
3cw4A           ----------------------------------------------------------------------
3d1tB           ---NLPINQVGIKDLRFPI---------TLKTAEGTQSTVARLTTVYLPKGTHSRFVALEQHTEVQLHRL
2bamA           --------------------------------------------------PIKELCYTLLEDTYNYREKP
11asA           ---------------------------------------------------------------QRQISFV
2e3cA           ------------------SQTDRLEVLLNPKDESGKPFRELESELLSRRKK-DLQQIYA-EERENYLGKL
1bhmA           DEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKP
2d6fD           RKLHFHYENYHEETCLVEAD-----EEPPHPLNPEALEIAVTIALLLNMRVVD-EFHTMRKQVIDGSNTG
2e1bA           ----------------------------------------------------------------------
3bjuB           NNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPKETRYRQRYLDLILNDFVRQKFIIRSKI
1b8aA           ---------------------------------------------------------AELDTRLNNRFMD
2e7gA           -TPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVP-----PIVFVQDKGNAALAEL
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELRPMNCPSHIQVYNHHK
2cimB           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDIGGMCYAQCPPFWMYVAGET
2cjaB           EKIVLEELLEPLGYREIFPKLVTWEVWK-SGHAKGVYPEIYYVCPPQIAEPIGGCYAQCPPFWYVAGET-
2dq0A           IRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVED----EDLYLIPTAEHPLAGMHANEI
1b76A           KQAWWRRNVYDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRLRPETAQGIFVNFKNVL
1atiB           KQAWWRRNVRDDMEGLDASVLTHRLVLHYSGHEATFADPMVDWTPPRYFNMMFLRPETAQGIFVNFKNLD
2cimA           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDIGGMCYAQCPPFWMYVAGET
1atiA           KQAWWRRNVYDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMLRPETAQGIFVNFKNVL
2cjaA           EKIVLEELLEPLGYREIFPKLVTWEVWK-SGHAKGVYPEIYYVCPPQIAEPIGGCYAQCPPFWYVAGET-
1asyA           CELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKG----------KAYLAQSPQF-------NKQ
2cjbA           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQAEPIGGMCYAQCPPFWMYVAGET
1adjA           VATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDGGRSLTLRPEGTAAMVRAYLEHG
2du5A           SKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEPISSTLTLRSHMTTGWFITLSHI-
2du3A           SKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEPISSTLTLRSHMTTGWFITLSHI-
3bjuC           ITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD-------------MNLYMRIAPEL--YHK
2dq2A           IRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVED----EDLYLIPTAEHPLAGMHANEI
2cj9A           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQAEPIGGMCYAQCPPFWMYVAGET
3e9hA           IQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALD-------------MTLYMRIAIELH--LK
2cj9B           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQAEPIGGMCYAQCPPFWMYVAGET
2d32C           --------------------------------------------------------------IPDVSQAL
2dq3A           IN-FLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERD----NLYLIPTAEVPLTNLYREEI
1e1tA           LAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMY--------LRIAPEL-------YLK
3bjuD           ITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD-------------MNLYMRIAPEL--YHK
3cmqA           KERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDYLNRTHMLRAHTSAHQW
2cjbB           EKIVLEELLPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTEPIGGMCYAQCPPFWMYVAGET
1eiyA           ERELVEIFRALGYQAVEGPEVESEFFNFDALHPARDMWDTFWLTGEGFGEEVEGRLLLRT-HTSPMQVRY
1bbuA           LSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDM--------YLRIAPEL-------YLK
1c0aA           TSLVRRFMDDHGFLDIETPML--------TKATPEGARDYLVPSRVHKG-----KFYALPQSPQL--FKQ
2du7A           E-RLRQAYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRPDVGLGNEKVEIIKNLGIDIDEEKKERLR
1bbwA           LSGIRQFMVNRGFMEVETPMMQVIPAARFITHHNALDLDMYLRIAP----ELYLKRLVVGGFERVFEIRN
2du5B           IQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFNLKPISSTLTLRSHMTTGWFITLSHI-
2du3B           IQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFNLKPISSTLTLRSHMTTGWFITLSHI-
1e1oA           LAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEIRN
2du4A           IQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATISSTLTLRSHMTT-GWFITLSHI
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           HRPALLELHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKC-----LRPMLAPNLYTLWREL-
2bamB           LDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSM----NKLLLGLKHGEIDLA---IIL
1bhmB           LDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRS----MNKLLLGLKHGEIDLA---IIL
3bamA           LDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSM----NKLLLGLKHGEIDLA---IIL
3dsqB           EEKLAKALHQQGFVQVVTPTIITKSALAKMTHPLFSQVFWLD-------GKKCLRPMLAPNLYTLWR-EL
1b70A           ERELVEIFRALGYQAVEGPEVESEALNIPEHHPARDMWDTFWLTGEGFGEEVEGR-LLLRTHTSPMQVRY
3cw4A           -------------------------MWEINGPESLVNTYQWI----IRNWETVKIQWSQNPTMLYNKMEF
3d1tB           TAEVALLDSRAGKISVSFPFFRKKTAPV-SGIRSLLDYDVSLTGEKDGHSKVIPVTSLCPCSKEISQYGA
2bamA           LDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETG---NISSAHRSMNKLL-LGLKHGEIDLAIIL---
11asA           KSHFSRQLERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKA-LPDAQFEVVHSLA---KWKRQTLG
2e3cA           EREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFR---VDKNFCLRPMLAPNLYNYLRKLD
1bhmA           LDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSM----NKLLLGLKHGEID---LAIIL
2d6fD           GFQRTGLVATDGHLETPQGTVENLCLEEDAARRIRETGDGVVFRL---------DRLGIPLVEITTDPSM
2e1bA           ----------------------------------------------------------------------
3bjuB           ITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD-------------MNLYMRIAPEL--YHK
1b8aA           LRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTEL-FPMKYFEEDAFLAESPQLYKE
2e7gA           DQLL------------------------------------------------------------------
3c2wC           ------------------------------------------FGALAHPDDGIAALIPCDGALVMLGGRT
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEPDHIEDEIKTLIKLMTEVYNDFDITD
2cimB           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIE
2cjaB           LPNEEIPVKVFDRGTSHRYE-SGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYHIFNDILDIEW
2dq0A           LDGKDLPLLYVGVSPCFRKEAGTATKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIPY
1b76A           DTSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSR
1atiB           ATSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSR
2cimA           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIE
1atiA           DTSRKLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSR
2cjaA           LPNEEIPVKVFDRGTSHRYE-SGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYHIFNDILDIEW
1asyA           QLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEI
2cjbA           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIE
1adjA           MKVWPQPVRLWMAGPMFRAERPQKG----RYRQFHQVNYEALGSENPILDAE--AVVLLYECLKELGLRR
2du5A           ADKLPLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFR
2du3A           ADKLPLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFR
3bjuC           MLVVGGIDRVYEIGRQFRNEGIDLTTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEG
2dq2A           LDGKDLPLLYVGVSPCFRKEAGTATKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIPY
2cj9A           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDIL---
3e9hA           RLIVGGLEKVYEIGRVFRNEGI----STRHNPEFTMLELYEAYFRDIMKLTENLIAHIATEVLGTTKI--
2cj9B           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIE
2d32C           AWLEKHPQALKGIQRTLRVNADGTLATTGHPEALGSALTHKWITTDFAEALLEFITPVDGDIEHMLT---
2dq3A           LKEENLPIYLTAYTPCYRREAGAYIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPY
1e1tA           RLVVGGFERVFEINRNFRNEGISV----RHNPEFTMMELYMAYYHDLIELTESLFRTLAQEVLGTTKV--
3bjuD           MLVVGGIDRVYEIGRQFRNEGIDLTTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEG
3cmqA           DLLHAGLDAFLVVGDVYRRDQIDS----QHYPIFHQLEAVRLFSKH--ELFAGIKDGESLQLFEQSSRSA
2cjbB           LPNEEIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIE
1eiyA           MVAHTPPFRIVVPGRVFRFEQTDAT----HEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALF----GPD
1bbuA           RLVVGGFERVFEINRNFRNEGISV----RHNPEFTMMELYMAYYKDLIELTESLFRTLAQDILGKTEV--
1c0aA           LLMMSGFDRYYQIVKCFRDEDL----RADRQPEFTQIDVESFMTAPQVREVMEALVRHLWLEVKGVDLGD
2du7A           EVLHLYKKGAIDGDDLVFEIAKALNVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLLIKK
1bbwA           FRNEGISVHNPEFTMMELYMAYADYKDLIELTE------------SLFRTLAQDILGKTEVTYGDV----
2du5B           ADKLPLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFEN----
2du3B           ADKLPLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFEN----
1e1oA           FRNEGISVHNPEFTMMELYMAYADYHDLIETESLFRTLAQEVLGTTKVTYGE---------HVFDFGKPF
2du4A           ADKLPLPIKLFSIDRCFRREQGE---DATRLYTYFSASCVLVDEELSVDD----GKAVAEALLRQFGFEN
2eiuC           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
3dsqA           ERLWDKPIRIFEIGTCYRKESQ----GAQHLNEFTMLNLTELGTPLEERHQR--LEDMARWVLEAAGIRE
2bamB           MPIKQLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKWKDK-
1bhmB           MPIKQLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKW----
3bamA           MPIKQLAYYLTDRVTNFEELEPYF--ELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKW----
3dsqB           ERLWDKPIRIFEIGTCYRKESQ----GAQHLNEFTMLNLTELGTPEERHQRLEDMARWVLEAAGIREF-E
1b70A           MVAHTPPFRIVVPGRVFRFEQTDA----THEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVR
3cw4A           PFQSLVPKAIRGQYSGFVRTLFQQMRGTFDTAQIIKLLPFAAAPPKQSRMQFSSFTVNVRGSGMRILVRG
3d1tB           HNQRSHVTVSLTSDAEVGIEEVIDYVEASCQLYLKRPDEKYVTEKAYENKFVEDVRDVATSLIADKRIKS
2bamA           MPIKQLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEA-YNSNVPLIPKGSDGMSKRS-------
11asA           QHDFSAGEGLYTHMKALRPDEDRL--SPLHSVYVDQWDWEVMGDGERQFSTLKSTVEAIWAGIKATEAAV
2e3cA           RAL-PDPIKIFEIGPCYRKESD----GKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFDLEL
1bhmA           MPIKQLAYYLTDRVTNFEELEPYF--ELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGM------------
2d6fD           SDPQQLREVAYQIGQILRST------RVKRGLGTIRQDLNSIRDGARVEVKGVQDLDLIPEIVEREVKRQ
2e1bA           ----------------------------------------------------------------------
3bjuB           MLVVGGIDRVYEIGRQFRNEGIDLTTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEG
1b8aA           IMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKEL
2e7gA           ----------------------------------------------------------------------
3c2wC           LSIRGDFERQAGLQRLQRDPERDIYCGVLAIRFHRQESGWIFWFRHEEVHRIR-----------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YRFRLSYRDPKNTEKYFDDDEMWEKSQSKLKAAMDDMGLXXXXXXXXXXXXXPKIDVQTKTALGGEETLS
2cimB           WRKARVTNTVGTTDYEACLPYRG------------------------------------PDGEWLEFQNV
2cjaB           RKARVNT-------VGTTDYEACLPYRGPDG-----EWLEFQNVSINGDKYPKGFNVKLQSGDELWSGCS
2dq0A           RVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVS----------------------------------A
1b76A           ENLVPYQQPPESSAHYAKDILYRFPHGSLELEGIAQRTDFDL----------------GSHTKDQEALGI
1atiB           ENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQ-------------RTDFDLGSHTKDQEALGI
2cimA           WRKARVTNTVGTTDYEACLPYRG----------PDGEWLEFQNVSINGDKYPKGFNVKLQ----------
1atiA           ENLVPYQQPPESSAHYAKATVDIL------------YRFPHGSLELEGIAQRTDFDLGSH-TKDQEALGI
2cjaA           RKARVNTVGTTDYEACLPYRGPDGEWLEFQNVSINGD------------KYPKGFNVKLQSGDELWSGCS
1asyA           ELVRKQYPVEEFKLAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKY
2cjbA           WRKA--------------RVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE--------WLEFQN
1adjA           LKVKLSSVGDPEDRYNAYLREVLSPHREALSEDILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVE
2du5A           KD-----------EKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVM
2du3A           KD-----------EKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVM
3bjuC           QAYDVDFTPPFRRINM---VEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKL
2dq2A           RVVNICTGDLGYVAAKKYDIEAWMPGQG-----------------------------------KFREVVS
2cj9A           -----------DIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE--------WLEFQN
3e9hA           -QYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQP
2cj9B           WRKA--------------RVTPWFMAQEGLLGLAEENTV-------GTTDYEACLPYRGPDGEWLEFQNV
2d32C           ----FMRDLHRYTARNMGDERMWPLSMPSYIADIELAQYGTSNTGRFKTLYREGLK---NRYGALMQTIS
2dq3A           RVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRNTRFKDSKTGKNRFVHTLNGSGLA
1e1tA           -TYGEHVFDFGKPFEKLTMREAIKTDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLI
3bjuD           QAYDVDFTPPFRRINM---VEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKL
3cmqA           HKQETHTM-----EAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINEWLEVLGCGV
2cjbB           WRKA--------------RVTPWFMAQEGLLGLAEENTV-------GTTDYEACLPYRGPDGEWLEFQNV
1eiyA           SKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLG
1bbuA           -TYGDVTLDFGKPFEKLTMREAIKKDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLI
1c0aA           FPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEF--------AVFAGPANDPKGRVAALRVPGGAS
2du7A           RKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVDDGKVVAEGLLAQFGFTKFKFKPDEKKS-KYYTPET
1bbwA           -TLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLI
2du5B           --FRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFG-----IYSPTALAEYDIPYPVM
2du3B           --FRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFG-----IYSPTALAEYDIPYPVM
1e1oA           EKLTMREA----IKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFI
2du4A           FRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDG-------WIEIATFGIYSPTALAEYDIPYPVM
2eiuC           ----------------------------------------------------VPGNYPLT-----AENLF
2eiuE           ----------------------------------------------------PAIFTKVEGVPGNYENLF
2eiuD           ------------------------------------------------------HEGKVEGVPGTAENLF
3dsqA           FELVTESSV--VYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMA
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           LVTESSVVG----DTVDVMKGDLELASGAMGPHFLDEKW-------------------------------
1b70A           FQPVYFPF----VEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLG
3cw4A           NSPVFNYNK----ATKRLTVLGKDAGTLTEDPDEGTAGVESAVLRGFLILGKEDKR-----YGPALSINE
3d1tB           FVVESE-----NFESIHNHSAYAY----------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           SEEFGLAPFLPDQIHFVHSQELLS----------------------------------------------
2e3cA           SSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL-------------
1bhmA           ----------------------------------------------------------------------
2d6fD           LS-LVEIRDTLQERGAVVEDKIFDVSEVFADTESRII---------------------------------
2e1bA           ----------------------------------------------------------------------
3bjuB           QAYDVDFTPPFRRINM---VEELEKALGMKLPETNLFETEETRKILDDICVAKAVECDKLVGEFLEVTCI
1b8aA           DILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMPSEAKPFYIMKYDNKPEI
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TIQLDFLLPERFDLKYIGADGEEHRPVMVHRGIVSTMERFTAYLTEMYKGAFPTWLAPHQVDIIPVKNDL
2cimB           SINGDK-YPKGFNVKLQ------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPKGI
2cjaB           GVGLERWAAVFLAQKG----LDPANWPEEFRNRVGEPKG-------------------------------
2dq0A           SNCTDWQA-RRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDPKVLWKGFKEIVPVE---
1b76A           TARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPQLAPIKVAVIPLNRPE
1atiB           TARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPQLAPIKVAVIPLNRPE
2cimA           -----------------------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPKGI
1atiA           TARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTRELKPQLAPIKVAVIPLNRPE
2cjaA           GVGLERWAAVFLAQKG----LDPANWPEEFRNRVGEPKG-------------------------------
1asyA           SNSYDFFMREILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERV------
2cjbA           VSINGDKYPKGFNVKLQ------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEM----
1adjA           RHLERLSVPYELEPALVRGLFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGKGPDLYLIP-LTEE
2du5A           NLGLGVERLAMILYGYD-----DVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQT-AVGLKIAQSIVETA
2du3A           NLGLGVERLAMILYGYD-----DVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQT-AVGLKIAQSIVETA
3bjuC           VGEFLEVTCINPTFICHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQA-K
2dq2A           ASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVLWKYTG----
2cj9A           VSINGDKYPKGFNVKL------QSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK--
3e9hA           TFIYGHPVEISPLAKKNPDDPRFTDRFEFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMD
2cj9B           SINGDK-YPKGFNVKLQ------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEM----
2d32C           GVHYNFSLPMAFWQAKISGADAKEKISAGYFRVIRNYYRFGWVIPYLF-GASPAISSSFSLPFEKTYLPY
2dq3A           VGRTLAAILENYQ----QEDGSVVVPEVLRDYVG--TDVI------------------------------
1e1tA           QPTFITEYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEA
3bjuD           VGEFLEVTCINPTFICDHPQIMSLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEE-QAK
3cmqA           MEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSFWLPS
2cjbB           SINGDK-YPKGFNVKLQ------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEM----
1eiyA           VERLAMLRYGIPDIR----YFFGGRLKFLE----------------------------------------
1bbuA           QPTFITEYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAA--------
1c0aA           LTRKQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADN
2du7A           QTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIVMNLGLGVERLAMIIYGYVYPQFYEYRLSDRDIVDKV
1bbwA           QPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAE-------DQAQRFLDQVYDED
2du5B           NLGLGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAV-
2du3B           NLGLGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAV-
1e1oA           TEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA---------------------------
2du4A           NLGLGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAV-
2eiuC           RIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFLSET
2eiuE           RIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEF-QPL
2eiuD           RIGLALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEF-QPL
3dsqA           R-SLSYLDGVRLNI--------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1b70A           VERLAM---LRYGIPDIRYFGGRLKFLEQFKG--------------------------------------
3cw4A           LSNLAKGEKANVLIQGDVVLVMKRKRDS------------------------------------------
3d1tB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bjuB           NPTFICDHPQIMSPLAKWHRSKEGLTERFELFV---------MKKEICNAYTELNDPMRQRQLFEEQAK-
1b8aA           CRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERL------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEEVSNGTVTVRKYGEEKTNTMT
2cimB           --RFL-----------------------------------------------------------------
2cjaB           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
1b76A           ITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLH
1atiB           ITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLH
2cimA           --RFL-----------------------------------------------------------------
1atiA           ITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLH
2cjaA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
1adjA           AVAEAFYLAEALRP-RLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLS
2du5A           EK--------HASEPSPCSFLAFEGEMMGRNVRVYVVNENENTKLCGPAYANEVVVYKGDIYGIPKTKKW
2du3A           EK--------HASEPSPCSFLAFEGEMMGRNVRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKW
3bjuC           AKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPA-----------
2dq2A           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
3e9hA           EDFLEALEYGMPPTGGLGIGVD------------------------------------------------
2cj9B           ----------------------------------------------------------------------
2d32C           ATSLRLSDLGYTNQSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAP
2dq3A           ----------------------------------------------------------------------
1e1tA           MFYDEDYVTALEYGLPPTAGLGIGIDRMIHTIRDVI----------------------------------
3bjuD           AKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPA-----------
3cmqA           ENYAENDFYDLVRTIGVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLG---
2cjbB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
1bbuA           ----------------------------------------------------------------------
1c0aA           KKIV------------------------------------------------------------------
2du7A           PILDEFYNFANELIDICIANKDKESPCSVEVKREFNFNGERIKVEIFENEPNKKLLGPSVLNEVYVYDGN
1bbwA           YVTALEHGLPPTAGLGIGI---------------------------------------------------
2du5B           GLKIAQSIVETAEKHASEPSPCFEGEMMGRNVRVYVVNENENTKLCGPAYANEVVVYKGDIYGIPKTKKW
2du3B           GLKIAQSIVETAEKHASEPSPCFEGEMMGRNVRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKW
1e1oA           ----------------------------------------------------------------------
2du4A           GLKIAQSIVETAEKHASEPSPCSEGEMMGRNVRVYVVEEEENTKLCGPAYANEVVVYGDIYGIPKTKKWR
2eiuC           DIKKLESILFIPKKTGEDIGSF------------------------------------------------
2eiuE           SETDIKKL--ESILFGRAPIPKKTGEDIGFK---------------------------------------
2eiuD           SETDIKKL--ESILFGRAPIPKKTGEDIGFK---------------------------------------
3dsqA           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bjuB           AKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPA-----------
1b8aA           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
3cwiA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KAEFKNLLFEDIENYSREK
2cimB           -------------------
2cjaB           -------------------
2dq0A           -------------------
1b76A           VDELEGFLRERLR------
1atiB           VDELEGFLRERLR------
2cimA           -------------------
1atiA           VDELEGFLRERLR------
2cjaA           -------------------
1asyA           -------------------
2cjbA           -------------------
1adjA           REEVPGYLLQAL-------
2du5A           RSFFEEGVPTGIRYI----
2du3A           RSFFEEGVPTGIRYI----
3bjuC           -------------------
2dq2A           -------------------
2cj9A           -------------------
3e9hA           -------------------
2cj9B           -------------------
2d32C           IRPKRVTRSGESPSD----
2dq3A           -------------------
1e1tA           -------------------
3bjuD           -------------------
3cmqA           -------------------
2cjbB           -------------------
1eiyA           -------------------
1bbuA           -------------------
1c0aA           -------------------
2du7A           IYGIPPTFEGVKEQY----
1bbwA           -------------------
2du5B           RSFFEEGVPTGIRYIDGFA
2du3B           RSFFEEGVPTGIRYIDGFA
1e1oA           -------------------
2du4A           SFFEEGV------------
2eiuC           -------------------
2eiuE           -------------------
2eiuD           -------------------
3dsqA           -------------------
2bamB           -------------------
1bhmB           -------------------
3bamA           -------------------
3dsqB           -------------------
1b70A           -------------------
3cw4A           -------------------
3d1tB           -------------------
2bamA           -------------------
11asA           -------------------
2e3cA           -------------------
1bhmA           -------------------
2d6fD           -------------------
2e1bA           -------------------
3bjuB           -------------------
1b8aA           -------------------
2e7gA           -------------------
3c2wC           -------------------
3biiD           -------------------
3cwiA           -------------------