[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99339.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cpfA.bssp"
#ERROR : Can't open dsspfile "2eifA.bssp"
#ERROR : Can't open dsspfile "1eifA.bssp"
#ERROR : Can't open dsspfile "3cpfB.bssp"
#ERROR : Can't open dsspfile "1bkbA.bssp"

## Summary of PDB Search
:185
    3e-34  17%  3cpfA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 5A-1
    1e-32  31%  2eifA  [b.34.5 - b.40.4] PROTEIN (EUKARYOTIC TRANSLATION INITIATION
    7e-32  35%  1eifA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 5A
    1e-30  16%  3cpfB  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 5A-1
    7e-22  22%  1bkbA  [x.x.x] TRANSLATION INITIATION FACTOR 5A
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MISVNEFKNGLTIEVDGELWRVVEFQHVKPGKGSAFVRSKLKNLRTGAVQEKTFRAGEKVNQAQIDRKKM
3cpfA           -MQCSALRKNGFVVLKGRPCKIVEMSTSKTH---AKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDF
2eifA           QVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG
1eifA           QVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKG-AKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG
3cpfB           -MQCSALRKNGFVVLKGRPCKIVEMSVHLVGI----------DIFTGKKYEDICPSTHNMDVPNIKRNDF
1bkbA           YVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTA


                         .         .         *         .         .         .         .:140
query           QYLYADGDNYVFMDTNTYEQLELPGSQIEEELKYMKENMVVSIIMFGTETLGVELPxxxxxxxxxxxxxx
3cpfA           QLIGIQDGYLSLLQGEVREDLRLPEGDLGKEIEQKYDCILITVLSAMTEEAAVAI---------------
2eifA           QVLAIMGDMVQIMDLQTYETLELP---IPEGIEGLEPGGEVEYIEAVGQYKITR----------------
1eifA           QVLAIMGDMVQIMDLQTYETLELP----------------------------------------------
3cpfB           QLIGIQDGYLSLLQDSGEEDLRLPEGDLGKEIEKYDCGELITVLSAMTEEAAVAIK--------------
1bkbA           QILSVSGDVIQLD--RDYKTIEVPKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVK--------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cpfA           ---------------------------------------------
2eifA           ---------------------------------------------
1eifA           ---------------------------------------------
3cpfB           ---------------------------------------------
1bkbA           ---------------------------------------------