[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99372.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e98A.bssp"
#ERROR : Can't open dsspfile "2e99A.bssp"
#ERROR : Can't open dsspfile "2e9aA.bssp"
#ERROR : Can't open dsspfile "2e9dA.bssp"
#ERROR : Can't open dsspfile "2e98B.bssp"
#ERROR : Can't open dsspfile "2e9cB.bssp"
#ERROR : Can't open dsspfile "2d2rA.bssp"
#ERROR : Can't open dsspfile "2dtnA.bssp"
#ERROR : Can't open dsspfile "2e9aB.bssp"
#ERROR : Can't open dsspfile "2dtnB.bssp"
#ERROR : Can't open dsspfile "2d2rB.bssp"
#ERROR : Can't open dsspfile "2e9cA.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"
#ERROR : Can't open dsspfile "3bbnT.bssp"

## Summary of PDB Search
:260
    1e-87  43%  2e98A  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    4e-85  44%  2e99A  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    1e-81  42%  2e9aA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    1e-80  43%  2e9dA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    2e-80  42%  2e98B  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    8e-79  42%  2e9cB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    1e-77  40%  2d2rA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    6e-77  40%  2dtnA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    1e-76  44%  2e9aB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    1e-71  40%  2dtnB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    3e-71  40%  2d2rB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    6e-71  43%  2e9cA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    2e-32  14%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    1e-22  13%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130
    4e-09  12%  3bbnT  [x.x.x] RIBOSOMAL PROTEIN S20
:260

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLDFFNKKENMDEKRNKLKRELIPNHIAIIMDGNGRWAKKRHLPRIAGHKQGMETVKNITKVASNLGVKV
2e98A           ----------------------GCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2e99A           ----------------------GCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2e9aA           ----------------------GCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2e9dA           -----------------------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2e98B           -----------------------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2e9cB           -----------------------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2d2rA           ----------------------TLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
2dtnA           ----------------------TLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
2e9aB           -----------------------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2dtnB           -----------------------LKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
2d2rB           -----------------------LKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLEC
2e9cA           ----------------------GCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEA
2b7oA           VKLGPNTPELAVEYVERLDPHNKPGRLTLVSRGNHKVRDLLPPIVEKVQATGHQVIW----QCDPHGNTH
2eeeA           ----------------ELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYESLEAMKSHCLKNGVTD
3bbnT           ------------------------------------------------------SKKSEARTRMKKVLEA


                         .         .         *         .         .         .         .:140
query           LTLYAFSTENWKRPDKEVDFLMDLPVKFFNTFVPELIENNVRVNVMGYIDMLPKKTQKAVYDAIEQTSNC
2e98A           LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2e99A           LTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2e9aA           LTLYAFSSVSA---------LMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2e9dA           LTLYAFSAQ-------EVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2e98B           LTLYAFSSSALMELFVWA----------LDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2e9cB           LTLYAFSSSALME----------LFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2d2rA           LTLYAF----------EVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHF
2dtnA           LTLYAF----------EVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHF
2e9aB           LTLYAFSA------------LMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2dtnB           LTLYAMKMLKKYLKDERSTYLD----------------NNIRFRAIGDLEGFSKELRDTILQLENDTRHF
2d2rB           LTLYLMKMLKKYLKDERSTYLD----------------NNIRFRAIGDLEGFSKELRDTILQLENDTRHF
2e9cA           LTLYAFSSELDSE-------------------VKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGN
2b7oA           ESSTGFKTRHFDRIVDEVQGFFEVHRA------LGTHPGGIHVEITGENVTLAGRYETACDPRLNTQQS-
2eeeA           LSMPRIGCGLDRLQWENVSAMIEEVFEATD----------------------------------------
3bbnT           LEGLKKKTDAQADEIVTVEKLIGEAYSAIDKAVKVKAKNT------------------------------


                         +         .         .         .         .         *         .:210
query           TGMVLNFALNYGGRAELVSAIQSIASKVSENKLEIEKITEKVVDANLMTGKLAPYNDPDLLIRTSGEERI
2e98A           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL---APVDLVIRTGGEHRI
2e99A           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2e9aA           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2e9dA           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2e98B           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2e9cB           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2d2rA           KDFTQVLALNYGSKNELSRAFKSLLESPPSNISLLE-SLENEISNRLDTRNL---PEVDLLLRTGGEMRL
2dtnA           KDFTQVLALNYGSKNELSRAFKSLLESPPSNISLLE-SLENEISNRLDTRNL---PEVDLLLRTGGEMRL
2e9aB           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2dtnB           KDFTQVLALNYGSKNELSRAFKSLL----------ESPLENEISNRLDTRNLP---EVDLLLRTGGEMRL
2d2rB           KDFTQVLALNYGSKNELSRAFKSLLESPLENEIS----------NRLDTRNLP---EVDLLLRTGGEMRL
2e9cA           TGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELA---PVDLVIRTGGEHRI
2b7oA           ----LELAFLVAELRD------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
3bbnT           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SNFLLWQLAYSEFVFTDTLWPDYSEEDLLANIYTFQTRDRRFGRxxxxxx
2e98A           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----------
2e99A           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----------
2e9aA           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----------
2e9dA           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----------
2e98B           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF--------
2e9cB           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR------------
2d2rA           SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVR----------
2dtnA           SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKR------------
2e9aB           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERR---------
2dtnB           SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGE------
2d2rB           SNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGE------
2e9cA           SNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE-----------
2b7oA           --------------------------------------------------
2eeeA           --------------------------------------------------
3bbnT           --------------------------------------------------