[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cxcA.bssp"
#ERROR : Can't open dsspfile "2atwA.bssp"
#ERROR : Can't open dsspfile "2atwC.bssp"
#ERROR : Can't open dsspfile "2asbA.bssp"
#ERROR : Can't open dsspfile "2abjA.bssp"
#ERROR : Can't open dsspfile "2ba0A.bssp"
#ERROR : Can't open dsspfile "2a1aA.bssp"
#ERROR : Can't open dsspfile "2a19A.bssp"
#ERROR : Can't open dsspfile "2coiB.bssp"
#ERROR : Can't open dsspfile "2cojA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "2ba1A.bssp"
#ERROR : Can't open dsspfile "2annA.bssp"
#ERROR : Can't open dsspfile "2cogB.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "2abjG.bssp"
#ERROR : Can't open dsspfile "2cqoA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2ba0B.bssp"
#ERROR : Can't open dsspfile "2coiA.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "2cpqA.bssp"
#ERROR : Can't open dsspfile "2ckzD.bssp"
#ERROR : Can't open dsspfile "2cteA.bssp"
#ERROR : Can't open dsspfile "2c35B.bssp"
#ERROR : Can't open dsspfile "1dtjD.bssp"
#ERROR : Can't open dsspfile "1dtjC.bssp"
#ERROR : Can't open dsspfile "1dtjA.bssp"
#ERROR : Can't open dsspfile "1dt4A.bssp"
#ERROR : Can't open dsspfile "1ec6B.bssp"
#ERROR : Can't open dsspfile "1ec6A.bssp"
#ERROR : Can't open dsspfile "2anrA.bssp"
#ERROR : Can't open dsspfile "2ctlA.bssp"
#ERROR : Can't open dsspfile "2ctkA.bssp"

## Summary of PDB Search
:375
    7e-26  23%  2cxcA  [x.x.x] NUSA
    5e-22  51%  2atwA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    2e-20  51%  2atwC  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    8e-19  47%  2asbA  [x.x.x] TRANSCRIPTION ELONGATION PROTEIN NUSA
    2e-18   7%  2abjA  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    3e-18  11%  2ba0A  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4
    1e-16   9%  2a1aA  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    7e-15   9%  2a19A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA
    7e-15   8%  2coiB  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    3e-13   7%  2cojA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    2e-12  13%  3bzkA  [x.x.x] TEX
    3e-12  22%  2ba1A  [x.x.x] ARCHAEAL EXOSOME RNA BINDING PROTEIN CSL4
    3e-12  13%  2annA  [x.x.x] NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
    5e-12   7%  2cogB  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    5e-12  12%  3bzcA  [x.x.x] TEX
    1e-11   9%  2abjG  [x.x.x] BRANCHED-CHAIN-AMINO-ACID AMINOTRANSFERASE,
    6e-11  19%  2cqoA  [x.x.x] NUCLEOLAR PROTEIN OF 40 KDA
    1e-10  17%  2c4rL  [x.x.x] RIBONUCLEASE E
    1e-09  12%  2ba0B  [x.x.x] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4
    2e-09   7%  2coiA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE 1, CYTOSOLIC
    4e-07  17%  1d7qA  [b.40.4] TRANSLATION INITIATION FACTOR 1A
    1e-06  26%  2cpqA  [x.x.x] FRAGILE X MENTAL RETARDATION SYNDROME RELATED
    3e-06  17%  2ckzD  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 25 KD
    4e-06  23%  2cteA  [x.x.x] VIGILIN
    5e-06  10%  2c35B  [x.x.x] DNA-DIRECTED RNA POLYMERASE II 19 KDA
    1e-05  23%  1dtjD  [d.51.1] RNA-BINDING NEUROONCOLOGICAL VENTRAL ANTIGEN 2
    1e-05  28%  1dtjC  [d.51.1] RNA-BINDING NEUROONCOLOGICAL VENTRAL ANTIGEN 2
    2e-05  22%  1dtjA  [d.51.1] RNA-BINDING NEUROONCOLOGICAL VENTRAL ANTIGEN 2
    3e-05  23%  1dt4A  [d.51.1] NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
    4e-05  26%  1ec6B  [d.51.1] RNA-BINDING PROTEIN NOVA-2
    4e-05  23%  1ec6A  [d.51.1] RNA-BINDING PROTEIN NOVA-2
    5e-05  28%  2anrA  [x.x.x] NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
    6e-05  16%  2ctlA  [x.x.x] VIGILIN
    6e-05  20%  2ctkA  [x.x.x] VIGILIN
:375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxEKGVKKEIVIEALEAALVSAYKRNYGQAQNVEVEFDKIAGNIHVYAVKEVVNEVYD
2cxcA           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
2asbA           ----------------------------------------------------------------------
2abjA           ---------------------------------------GVTRRCILDLAHQWGEFKVSERYLTMDDLTT
2ba0A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2a19A           ----------------------------------------------------------------------
2coiB           -------------------------------------LPGVTRRCILDLAHQWGEFKVSERYLTMDDLTT
2cojA           ----------------------------------------------LDLAHQWGEFKVSERYLTMDDLTT
3bzkA           --------------GAFRTRDELKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVQRIAADT
2ba1A           ----------------------------------------------------------------------
2annA           ----------------------------------------------------------------------
2cogB           ----------------------------------------------LDLAHQWGEFKVSERYLTMDDLTT
3bzcA           --------------FRTRDELKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVQRIAADTER
2abjG           ------------------EEELATPPLDGIILPGVTRRCILDLAHQ------WGEFKVSERYLTMDDLTT
2cqoA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2ba0B           ----------------------------------------------------------------------
2coiA           -----------------------------------------------DLAHQWGEFKVSERYLTMDDLTT
1d7qA           ----------------------------------------------------------------------
2cpqA           ----------------------------------------------------------------------
2ckzD           ----------------------------------------------------------------------
2cteA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
1dtjD           ----------------------------------------------------------------------
1dtjC           ----------------------------------------------------------------------
1dtjA           ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
1ec6B           ----------------------------------------------------------------------
1ec6A           ----------------------------------------------------------------------
2anrA           ----------------------------------------------------------------------
2ctlA           ----------------------------------------------------------------------
2ctkA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SQLEISLKSALEINRAYEIGDTIREEVTPKDFGRIAAQTAKQVIMQRVRKEEREVIYNEYVQYEQEIVTG
2cxcA           ----------------------------------------------------------------------
2atwA           ----------------------------------------------------------------------
2atwC           ----------------------------------------------------------------------
2asbA           ---------------------------------------------------------------EGEIVAG
2abjA           ALEGNRVREMFSSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS-
2ba0A           -------------------GDLLSTNPRAAGYGTYVEGGKVYAKIIGLFDQTETHVKGRYTPSVGDVVIG
2a1aA           ----------------------------------------------------HCRFYENKYPEIDDIVMV
2a19A           ---------------------------------------------------SHCRFYENKYPEIDDIVMV
2coiB           ALEGNRVREMFGSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGRE----------
2cojA           ALEGNRVREMFGSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGR-----------
3bzkA           ERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPTAEFQEGVESLKDLKPGMVLEG
2ba1A           ----------------------------------FAAVAGKLIIKDRVAKVESISPIPEI--VKGDVVLG
2annA           ----------------------------------------------------------------------
2cogB           ALEGNRVREMFGSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGR-----------
3bzcA           DIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDPRPEFKTAEFQEGVESLKDLPGMVLEG
2abjG           ALEGNRVREMFSSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGR-----------
2cqoA           ----------------------------------------------------------ENLPALYTIFQG
2c4rL           ---------------AHIEGRHMKINATQQEELRVALVDGQRLYDLDIESPGHE-------QKKANIYKG
2ba0B           -------------------GDLLSTNPRAAGYGTYVEGGKVYAKIIGLFDQTETHVKGRYTPSVGDVVIG
2coiA           ALEGNRVREMFGSGTACVVCPVSDILYKGETI-HIPTMENGPKLASRILSKLTDIQYGR-----------
1d7qA           ---------------------------------------------RRRGKNENESEKRELVFKEDGQEYA
2cpqA           ----------------------------------------------------------------------
2ckzD           --------------------SAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQYINVTFRAVGEIVTG
2cteA           ----------------------------------------------------------------------
2c35B           ---------KQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDA
1dtjD           ----------------------------------------------------------------------
1dtjC           ----------------------------------------------------------------------
1dtjA           ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
1ec6B           ----------------------------------------------------------------------
1ec6A           ----------------------------------------------------------------------
2anrA           ----------------------------------------------------------------------
2ctlA           ----------------------------------------------------------------------
2ctkA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EVERRDNKFVYVNLGRIEAVLSRQDQIPGEEYKSHDKIKVYIYKVENTSKGPQVFVSRSHPDLLRRLFEQ
2cxcA           ----------------------------------------------------------------------
2atwA           ------------------GVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2atwC           -----------------EGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2asbA           VIQRDSRANARGLVVASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSL
2abjA           ----------------------------------------------------------------------
2ba0A           IIREVAANGWAVDIYVSENPEMKPNKKPNEVLDIGDAIIAKVLNIDPKMKTLTMKDRICRPIRFGRIVAI
2a1aA           NVQQIAEMGAYVKLLEYDNI---EGMILLSLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEK
2a19A           NVQQIAEMGAYVKLLEYNIEGMILLSSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSDIIKCEEKY
2coiB           ----------------------------------------------------------------------
2cojA           ----------------------------------------------------------------------
3bzkA           VVTNVTNFGAFVDIGHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRN--RVGLSMRMSD--------
2ba1A           RVVDLRNSIALIEVSSKKGENRGPSNRISEAVGYLDILKARVIGDEEEMGVLRALCSNCKTEMVREGDIL
2annA           ----------------------------------------------------------------------
2cogB           ----------------------------------------------------------------------
3bzcA           VVTNVTNFGAFVDIGHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRN--RVGLSMRMSD--------
2abjG           ----------------------------------------------------------------------
2cqoA           EVAMVTDYGAFIKIPHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVV-------NQ
2c4rL           KITRPSLEAAFVDYGAERHGFLPLKEIAREYFP-------------------------------------
2ba0B           IIREVAANGWAVDIYSPYQAFMKPNKKPNEVLDIGDAIIAKVLNIDPKMK--------------------
2coiA           ----------------------------------------------------------------------
1d7qA           QVIKLGNGRLEAMCFDGVKRLCHIRGKLRKWINTSDIILVGLRDYQDNKA--DVILKYNADEARSLKAYG
2cpqA           ----------------------------------------------------------------------
2ckzD           WISKCTAEGIKVSLLEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVPPAYALLGSCQTLVSWWEHH
2cteA           ----------------------------------------------------------------------
2c35B           VVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDED-----------------------
1dtjD           ----------------------------------------------------------------------
1dtjC           ----------------------------------------------------------------------
1dtjA           ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
1ec6B           ----------------------------------------------------------------------
1ec6A           ----------------------------------------------------------------------
2anrA           ----------------------------------------------------------------------
2ctlA           ----------------------------------------------------------------------
2ctkA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIPEIFDGTVEIVSISREAGDRAKVAVRSNEDGVDPVGTCVGPRGERVQAIVNELKGENMDIVEWREDPA
2cxcA           -------------------------------------------RGGRLIKLLREALGKNIEVVEYSSDLE
2atwA           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2atwC           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2asbA           EVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPA
2abjA           ----------------------------------------------------------------------
2ba0A           NPARVPRVIGKKGSMIKLLKSELDVQIVVGQNGLIWVNGDRRKVSIAEEAIYLIEQEAHTEGLT------
2a1aA           YQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHEAFKLSIIDETVWEGIEPPSKDVLD------
2a19A           QKSKTVHSILRYCAEKFQIPLEELYKTIAW-PLSRKFGHAYEAFKLSIIDETVWEGIEPPS-KDVLDELK
2coiB           ----------------------------------------------------------------------
2cojA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
2ba1A           KCPEC--GRVEKRKISTDYGKGE-----------------------------------------------
2annA           ---------------------------------SYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPG
2cogB           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
2abjG           ----------------------------------------------------------------------
2cqoA           GTGKDLDPNNVIIESGPSSG--------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2ba0B           ----------------------------------------------------------------------
2coiA           ----------------------------------------------------------------------
1d7qA           ELPEHAK---------------------------------------------------------------
2cpqA           ----------------------------------------------------------------------
2ckzD           H---------------------------------------------------------------------
2cteA           ----------------------------------------------------------------------
2c35B           ----------------------------------------------------------------------
1dtjD           ----------------------------------------------------------------------
1dtjC           ----------------------------------------------------------------------
1dtjA           ----------------------------------------------------------------------
1dt4A           ----------------------------------------------------------------------
1ec6B           ----------------------------------------------------------------------
1ec6A           ----------------------------------------------------------------------
2anrA           ----------------------------------------------------------------------
2ctlA           ----------------------------------------------------------------------
2ctkA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EYIANALNPAKVLDVRFDDENEHACTVVVPDDQLSLAIGKRGQNARLAARLTGYKIDIKSESDAADLNNV
2cxcA           RIVKNLFPGVKIESINRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEK----------
2atwA           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAP-------
2atwC           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAP-------
2asbA           RFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPPPPP---
2abjA           ----------------------------------------------------------------------
2ba0A           ----------------------------------------------------------------------
2a1aA           ----------------------------------------------------------------------
2a19A           NYI-------------------------------------------------------------------
2coiB           ----------------------------------------------------------------------
2cojA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
2ba1A           ----------------------------------------------------------------------
2annA           TTERVCLIQGTIEALNAVHDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQNRVVTVSGEP
2cogB           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
2abjG           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
2ba0B           ----------------------------------------------------------------------
2coiA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
2cpqA           ----------------KQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDT-------
2ckzD           ----------------------------------------------------------------------
2cteA           --------SGSSGDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDP------
2c35B           ----------------------------------------------------------------------
1dtjD           -------------------------EMAVPENLVGAILGKGGKTLVEYQELTGARIQISRNRRVTITGSP
1dtjC           -------------------------EMAVPENLVGAILGKGGKTLVEYQELTGARIQISTR---------
1dtjA           -------------------------EMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRN
1dt4A           -------------------------EIAVPENLVGAILGKGGKTLVEYQELTGCRIQISKKGEFLPGTR-
1ec6B           -------------------------EIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGE-------
1ec6A           -------------------------EIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTR-
2anrA           -------------------------KVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDF------
2ctlA           ------------------ALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDD-------
2ctkA           ------------------ALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPEL-------


                         .         .         .         .         *         .         .:420
query           EADNNDIDDEDQLMSDSxxxxxxxx
2cxcA           -------------------------
2atwA           -------------------------
2atwC           -------------------------
2asbA           -------------------------
2abjA           -------------------------
2ba0A           -------------------------
2a1aA           -------------------------
2a19A           -------------------------
2coiB           -------------------------
2cojA           -------------------------
3bzkA           -------------------------
2ba1A           -------------------------
2annA           EQNRKAVELIIQKIQED--------
2cogB           -------------------------
3bzcA           -------------------------
2abjG           -------------------------
2cqoA           -------------------------
2c4rL           -------------------------
2ba0B           -------------------------
2coiA           -------------------------
1d7qA           -------------------------
2cpqA           -------------------------
2ckzD           -------------------------
2cteA           -------------------------
2c35B           -------------------------
1dtjD           AA-----------------------
1dtjC           -------------------------
1dtjA           R------------------------
1dt4A           -------------------------
1ec6B           -------------------------
1ec6A           -------------------------
2anrA           -------------------------
2ctlA           -------------------------
2ctkA           -------------------------