[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99450.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bk1A.bssp"
#ERROR : Can't open dsspfile "3bk2A.bssp"
#ERROR : Can't open dsspfile "2dfwA.bssp"
#ERROR : Can't open dsspfile "1dcnC.bssp"
#ERROR : Can't open dsspfile "2az4B.bssp"
#ERROR : Can't open dsspfile "2az4A.bssp"
#ERROR : Can't open dsspfile "1e5dA.bssp"
#ERROR : Can't open dsspfile "2dkfA.bssp"
#ERROR : Can't open dsspfile "1dcnA.bssp"
#ERROR : Can't open dsspfile "3bv6B.bssp"
#ERROR : Can't open dsspfile "3bv6A.bssp"
#ERROR : Can't open dsspfile "2bc2A.bssp"
#ERROR : Can't open dsspfile "2bg2A.bssp"
#ERROR : Can't open dsspfile "1dcnD.bssp"
#ERROR : Can't open dsspfile "2br6A.bssp"
#ERROR : Can't open dsspfile "2cbnA.bssp"
#ERROR : Can't open dsspfile "2bflB.bssp"
#ERROR : Can't open dsspfile "2bg8A.bssp"
#ERROR : Can't open dsspfile "2bfzA.bssp"
#ERROR : Can't open dsspfile "1dd6B.bssp"
#ERROR : Can't open dsspfile "2bgaA.bssp"
#ERROR : Can't open dsspfile "2bfkB.bssp"
#ERROR : Can't open dsspfile "1dd6A.bssp"
#ERROR : Can't open dsspfile "2bg7A.bssp"
#ERROR : Can't open dsspfile "2bc2B.bssp"
#ERROR : Can't open dsspfile "1bvtA.bssp"
#ERROR : Can't open dsspfile "2a7mA.bssp"
#ERROR : Can't open dsspfile "2bg7B.bssp"
#ERROR : Can't open dsspfile "2bg2B.bssp"
#ERROR : Can't open dsspfile "2bfzB.bssp"
#ERROR : Can't open dsspfile "3dhaA.bssp"
#ERROR : Can't open dsspfile "1dxkA.bssp"
#ERROR : Can't open dsspfile "3bc2A.bssp"
#ERROR : Can't open dsspfile "1bmcA.bssp"
#ERROR : Can't open dsspfile "2bfkA.bssp"
#ERROR : Can't open dsspfile "1bmiA.bssp"
#ERROR : Can't open dsspfile "2bg8B.bssp"
#ERROR : Can't open dsspfile "1bc2A.bssp"
#ERROR : Can't open dsspfile "2bflA.bssp"
#ERROR : Can't open dsspfile "1bmiB.bssp"
#ERROR : Can't open dsspfile "2btnA.bssp"
#ERROR : Can't open dsspfile "3cqqA.bssp"
#ERROR : Can't open dsspfile "1a7tA.bssp"
#ERROR : Can't open dsspfile "1a8tA.bssp"
#ERROR : Can't open dsspfile "3dh8A.bssp"
#ERROR : Can't open dsspfile "2e7yB.bssp"
#ERROR : Can't open dsspfile "1a8tB.bssp"
#ERROR : Can't open dsspfile "2bufE.bssp"
#ERROR : Can't open dsspfile "2bibA.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "2d0pD.bssp"
#ERROR : Can't open dsspfile "2d0oB.bssp"
#ERROR : Can't open dsspfile "2e7yA.bssp"
#ERROR : Can't open dsspfile "2d0pB.bssp"
#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2d0oD.bssp"

## Summary of PDB Search
:565
    3e-89  32%  3bk1A  [x.x.x] METAL DEPENDENT HYDROLASE
    1e-87  32%  3bk2A  [x.x.x] METAL DEPENDENT HYDROLASE
    7e-59  12%  2dfwA  [x.x.x] SALT-TOLERANT GLUTAMINASE
    3e-46  12%  1dcnC  [a.127.1] DELTA 2 CRYSTALLIN
    1e-45  13%  2az4B  [x.x.x] HYPOTHETICAL PROTEIN EF2904
    7e-45  14%  2az4A  [x.x.x] HYPOTHETICAL PROTEIN EF2904
    1e-38  11%  1e5dA  [d.157.1 - c.23.5] RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
    3e-38  18%  2dkfA  [x.x.x] METALLO-BETA-LACTAMASE SUPERFAMILY PROTEIN
    2e-28  14%  1dcnA  [a.127.1] DELTA 2 CRYSTALLIN
    3e-27  10%  3bv6B  [x.x.x] METAL-DEPENDENT HYDROLASE
    9e-27  10%  3bv6A  [x.x.x] METAL-DEPENDENT HYDROLASE
    2e-24  15%  2bc2A  [d.157.1] METALLO BETA-LACTAMASE II
    1e-23  17%  2bg2A  [x.x.x] BETA-LACTAMASE II
    7e-23  13%  1dcnD  [a.127.1] DELTA 2 CRYSTALLIN
    8e-23  10%  2br6A  [x.x.x] AIIA-LIKE PROTEIN
    1e-22  11%  2cbnA  [x.x.x] RIBONUCLEASE Z
    3e-22  20%  2bflB  [x.x.x] BETA-LACTAMASE II
    4e-22  19%  2bg8A  [x.x.x] BETA-LACTAMASE II
    5e-22  16%  2bfzA  [x.x.x] BETA-LACTAMASE II
    7e-22  13%  1dd6B  [d.157.1] IMP-1 METALLO BETA-LACTAMASE
    1e-21  20%  2bgaA  [x.x.x] BETA-LACTAMASE II
    2e-21  17%  2bfkB  [x.x.x] BETA-LACTAMASE II
    3e-21  13%  1dd6A  [d.157.1] IMP-1 METALLO BETA-LACTAMASE
    3e-21  17%  2bg7A  [x.x.x] BETA-LACTAMASE II
    4e-21  19%  2bc2B  [d.157.1] METALLO BETA-LACTAMASE II
    5e-21  18%  1bvtA  [d.157.1] PROTEIN (BETA-LACTAMASE)
    6e-21  11%  2a7mA  [x.x.x] N-ACYL HOMOSERINE LACTONE HYDROLASE
    8e-21  19%  2bg7B  [x.x.x] BETA-LACTAMASE II
    9e-21  17%  2bg2B  [x.x.x] BETA-LACTAMASE II
    1e-20  18%  2bfzB  [x.x.x] BETA-LACTAMASE II
    2e-20  14%  3dhaA  [x.x.x] N-ACYL HOMOSERINE LACTONE HYDROLASE
    2e-20  16%  1dxkA  [d.157.1] CLASS B BETA-LACTAMASE
    2e-20  19%  3bc2A  [x.x.x] METALLO BETA-LACTAMASE II
    4e-20  17%  1bmcA  [x.x.x] METALLO-BETA-LACTAMASE
    2e-19  19%  2bfkA  [x.x.x] BETA-LACTAMASE II
    2e-19  16%  1bmiA  [d.157.1 (2bmiA)] METALLO-BETA-LACTAMASE
    2e-19  16%  2bg8B  [x.x.x] BETA-LACTAMASE II
    3e-19  16%  1bc2A  [d.157.1] METALLO-BETA-LACTAMASE II
    4e-19  15%  2bflA  [x.x.x] BETA-LACTAMASE II
    6e-19  18%  1bmiB  [d.157.1 (2bmiB)] METALLO-BETA-LACTAMASE
    7e-19  10%  2btnA  [x.x.x] AIIA-LIKE PROTEIN
    3e-18  14%  3cqqA  [x.x.x] SUPEROXIDE DISMUTASE [CU-ZN]
    6e-18  16%  1a7tA  [d.157.1] METALLO-BETA-LACTAMASE
    1e-17  16%  1a8tA  [d.157.1] METALLO-BETA-LACTAMASE
    4e-17  17%  3dh8A  [x.x.x] UNCHARACTERIZED PROTEIN PA1000
    8e-17  14%  2e7yB  [x.x.x] TRNASE Z
    1e-16  17%  1a8tB  [d.157.1] METALLO-BETA-LACTAMASE
    6e-15  12%  2bufE  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-15  16%  2bibA  [x.x.x] TEICHOIC ACID PHOSPHORYLCHOLINE ESTERASE/
    4e-14  13%  2cg2A  [x.x.x] SDSA1
    1e-11   8%  2d0pD  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    1e-11   8%  2d0oB  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    1e-11  14%  2e7yA  [x.x.x] TRNASE Z
    2e-11   7%  2d0pB  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
    8e-10  13%  2cg3A  [x.x.x] SDSA1
    2e-08  15%  2cfzA  [x.x.x] SDSA1
    2e-07  16%  2cfuA  [x.x.x] SDSA1
    2e-06   9%  2d0oD  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR SMALL
:565

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDIKIISLGGVRENAKNMYAVEVDDEIFILDCGLKYPENELLGIDFVIPDFSYLRENSRKIVGVFLTHG
3bk1A           -DHVEIIPLG-GGEIGKNITVFRFRDEIFVLDGGLAFPEEGP-GVDLLIPRVDYLIEHRHKIKAWVLTHG
3bk2A           --HVEIIPLG-GGEIGKNITVFRFRDEIFVLDGGLAFPEEGP-GVDLLIPRVDYLIEHRHKIKAWVLTHG
2dfwA           ----------------------------------------------------------------------
1dcnC           ----------------------------------------------------------------------
2az4B           -AKTTVTFHSGILTIGGTVIEVAYKDAHIFFDFGTEFRPNNRLVPELKDLYDPGAEDKDYQHTAVFLSHA
2az4A           -AKTTVTFHSGILTIGGTVIEVAYKDAHIFFDFGTEFRPELTLINNRLVPELKGAEDKDYQHTAVFLSHA
1e5dA           --RDFHGYTLSPMGTTYNAY-LVEDEKTTLFDTVKAEYKGELL-------CGIASVIDPKKIDYLVIQHL
2dkfA           ----RIVPFGAAREVTGSAHLLLAGGRRVLLDCGF--------QGKEEARNHAPFGFDPKEVDAVLLTHA
1dcnA           ----------------------------------------------------------------------
3bv6B           ---LSIDFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQPNLRT------SIFPLDPFAIKEIDAVLASHD
3bv6A           ---LSIDFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQPNLRT------SIFPLDPFAIKEIDAVLASHD
2bc2A           -KNVWVHTELGSEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2bg2A           -KNVWVHTELGSFAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
1dcnD           ----------------------------------------------------------------------
2br6A           ---NSALTPGKLLNLPVWCYLLETEEGPILVDTGMNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHL
2cbnA           -----------------LNLQHPTQSGLWLFDCGEGT-----------QHQLLHTAFNPGKLDKIFISHL
2bflB           ---WVHTELGSFGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
2bg8A           ---WVHTELGSFEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
2bfzA           -----VWVHTELGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
1dd6B           ---TSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTE--------KLVTWFVERGYKIKGSISSHF
2bgaA           -GTISISQLNLGSAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2bfkB           ---WVHTELGSFEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
1dd6A           ---TSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPF--------TAKDTEKLVTWFVERGYKIKGSISSHF
2bg7A           --------TELGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2bc2B           -GTISISQLNELGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
1bvtA           ---HTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2a7mA           ---NSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNTEEDRIVNILKRVGYEPDDLLYIISSHL
2bg7B           -KNVWVHTELGSEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
2bg2B           -GTISISQLNLGSAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2bfzB           --------TELGSAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
3dhaA           ---NSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNMTEEDRIVNILKRVGYEPDDLLYIISSHL
1dxkA           ---HTELGSFNGEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
3bc2A           -----VWVHTELGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
1bmcA           -GTISISQLNKHTELPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
2bfkA           -----HTELGSFNEAPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
1bmiA           ---VSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNW-------VTDSLHAKVTTFIPNHW
2bg8B           -KNVWVHTELGSEAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
1bc2A           -----VWVHTELGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEM-------VEKKFQKRVTDVIITHA
2bflA           --------HTELGAVPSNGLVLNTSKGLVLVDSSWDDKLTKELIEMV-------EKKFQKRVTDVIITHA
1bmiB           ---VSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWV-------TDSLHAKVTTFIPNHW
2btnA           ---NSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEQILPKMTEEDRIVNIPDDLLYIISSHL
3cqqA           ----------------------------------------------------------------------
1a7tA           ---VSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNW-------VTDSLHAKVTTFIPNHW
1a8tA           ---VSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWV-------TDSLHAKVTTFIPNHW
3dh8A           -----------------PVFLLRLGEASWALEGGISRDAELVW------ADLCRWVADPSQVHYWLITHK
2e7yB           ------MNIIGFSKAL-FSTWIYYSPERILFDAGEGVST--------------TLGSKVYAFKYVFLTHG
1a8tB           ---VSLAEIEGWGMVPSNGMIVINNHQAALLDTPINDAQTEMLVNWV-------TDSLHAKVTTFIPNHW
2bufE           ----------------------------------------------------------------------
2bibA           SSGNKIHFIN-VQEGGSDAIILESNGHFAMVDTGEDYDFPDGSDSRYYKHVLTLKELSVQKLDFILVTHT
2cg2A           -----IYQVRGFDLA--NITFIRGDSGWIVVDTLTTPATARAA------YELVSRELGERPIRTVIYSHA
2d0pD           ------------------------------------------------------------SAPAI-AIAV
2d0oB           -----------------------------------------------------------------IAIAV
2e7yA           -------------------TWIYYSPERILFDAGEGVST--------------TLGSKVYAFKYVFLTHG
2d0pB           ----------------------------------------------------------------AIAIAV
2cg3A           -----IYQVRGFDLA--NITFIRGDSGWIVVDTLTTPATARAA------YELVSRELGERPIRTVIYSHA
2cfzA           -----IYQVRGFDLA--NITFIRGDSGWIVVDTLTTPATARAA------YELVSRELGERPIRTVIYSHA
2cfuA           -----------------NITFIRGDSGWIVVDTLTTPATARAA------YELVSRELGERPIRTVIYSHA
2d0oD           -------------------------------------------------------------APAIAIAV-


                         .         .         *         .         .         .         .:140
query           HADAIGALPYFVSEFDVPVFGSELTIELAKIACENEEDARKFDDFHVIDESTEIDFENATISFFQTTHSI
3bk1A           HEDHIGGLPFLLPIFGKESPGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRTHSI
3bk2A           HEDHIGGLPFLLPIFGKESPGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRTHSI
2dfwA           --------------------------------------------ASLVTELGAVNPGETAQYIPVLAEAD
1dcnC           ----------------------------------------------ISEEWSKGVFV--VKQSDEDIHTA
2az4B           HLDHSRMINYLDPAVPLYTLKETKMILNSLNRKGDFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDA
2az4A           HLDHSRMINYLDPAVPLYTLKETKMILGDFLIPSPFEEKNFTREMIGLNKNDVIKVGEISVEIVPVDHDA
1e5dA           ELDHAGALPALIEACQPKIFTSSLGQKAME-----SHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLH
2dkfA           HLDHVGRLPKLFREGYRPVYATRATVLLEIPFFGPEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGH-L
1dcnA           ----------------------------------------------------KISEEWSKGVFVVKQHTA
3bv6B           HADHIDVNVAAAVLQHVKFIGPQACVDLW------LGWGVPQERCIVAKVGDVLEIGDVKIRVLDSFDRT
3bv6A           HADHIDVNVAAAVLQHVKFIGPQACVDLW------LGWGVPQERCIVAKVGDVLEIGDVKIRVLDSFDRT
2bc2A           HADRIGGIKTLKERGIKAHSTAL--------TAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bg2A           HADCIGGIKTL-KERGIKAHSTALTA-------ELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1dcnD           ------------------------------------------------------------------IHTA
2br6A           HFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKE----CILPHLNYKIIEGDYEVVPGVQLLYTPGHSP
2cbnA           HGDHLFGLPGLLCSRSMSGIIQPLTIYVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPL
2bflB           HADCIGGIKTL-KERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bg8A           HADCIGGIKTLK-ERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bfzA           HADCIGGIKTL-KERGIKAHSTALT-------AELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1dd6B           HSDSTGGIEWLNSRSIPTYASELTNE--------LLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHT
2bgaA           HADCIGGIKTLK-ERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bfkB           HADCIGGIKTLKERGIKAHSTA--------LTAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1dd6A           HSDSTGGIEWLNSRSIPTYASELTNELLKK--------DGKVQATNSFSGVNYWLVKNKIEVFYPGPGHT
2bg7A           HADCIGGIKTL-KERGIKAHSTALTA-------ELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGK-G
2bc2B           HADRIGGIKTL-KERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1bvtA           HADRIGGIKTLK-ERGIKAHSTALTAELA-------KKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2a7mA           HFDHAGGNGAFTNTPIIVQRTEYEAAL----HREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSP
2bg7B           HADCIGGIKTL-KERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bg2B           HADCIGGIKTL-KERGIKAHSTALTA-------ELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bfzB           HADCIGGIKTLK-ERGIKAHSTALTAELA-------KKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
3dhaA           HFDHAGGNGAFTNTPIIVQ---RTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQL-LYTPGHSP
1dxkA           HADRIGGIKTLKERGIKAHSTALTAELAKK--------NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
3bc2A           HADRIGGIKTLK-ERGIKAHSTALTAELAK-------KNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1bmcA           HADRIGGIKTLKERGIKAHSTAL--------TAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bfkA           HADCIGGIKTL-KERGIKAHSTALTAELA-------KKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1bmiA           HGDCIGGLGYLQ-RKGVQSYANQMTIDL------AKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGHA
2bg8B           HADCIGGIKTLK-ERGIKAHSTALTA-------ELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1bc2A           HADRIGGIKTLKERGIKAHSTALTAELAKK--------NGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
2bflA           HADCIGGIKTLKERGIKAHSTAL--------TAELAKKNGYEEPLGDLQTVTNLKFGNMKVETFYPGKGH
1bmiB           HGDCIGGLGYLQ-RKGVQSYANQMTIDLAKEKG------LPVPEHGFTDSLTVSLDGMPLQCYYLGGGHA
2btnA           HFDHAGGNGAFTNTPIIVQRTEYEAA----LHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSP
3cqqA           ----------------------------------------------------------------------
1a7tA           HGDCIGGLGYLQ-RKGVQSYANQMTIDLA-------KEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGH
1a8tA           HGDCIGGLGYLQ-RKGVQSYANQMT-------IDLAKEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGH
3dh8A           HYDHCGLLPYLCPRLNVQVLASERTCQAWKSESAVRVVERLLPVRAVADGEWLELGPRHRLQVIEAHGHS
2e7yB           HVDHIAGLWGVVNIRNNEKPLDVFYPEGNRAVEEYTEFIKRFNVHPLKEGERVFLRNAGGFKRYVQPFRT
1a8tB           HGDCIGGLGYLQ-RKGVQSYANQMTIDLA-------KEKGLPVPEHGFTDSLTVSLDGMPLQCYYLGGGH
2bufE           ----------------------------------------------------------------------
2bibA           HSDHIGNVDELLSTYPVRVYLKKYSDSR--ITNSERLWDNLYGYDKVLQTATETGVSVIQNITQGDAHFQ
2cg2A           HADHFGGVRGLVEPQQVASGAVQIIAIKENVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARGPL
2d0pD           IDGCDGLWREVLLGIEEEGIPFRLQ-------HHPAGEVVDSAWQAARSSPL----------LVGIACDR
2d0oB           IDGCDGLWREVLLGIEEEGIPFR--------------LQHHPAGEVVDSAWQAARSS---PLLVGIACDR
2e7yA           HVDHIAGLWGVVNIRNNGMGDREKPLDVFYPEGNRAVEEY-TEFIKRANPDLRFSFNVHPLKEGERVFLR
2d0pB           IDGCDGLWREVLLGIE-------------EEGIPFRLQHHPAGEVVDSAW----QAARSSPLLVGIACDR
2cg3A           HADHFGGVRGLVEPQQVASGAVQIIAPAGAIVLAGNARRATYQYGTQLPKGPQGQVDAIGKGLARGPLSL
2cfzA           HADHFGGVRGLVEPQQVASGAVQIIAPAGFMEAAIKENVLAGNAMMR-----------------------
2cfuA           HADHFGGVRGLVEPQQVQIIAPAGFMEAAIVLAGNAMMRRATYQYGTQLPKGPQGQVDMAIGKGLARG--
2d0oD           IDGCDGLWREVL---------------------LGIEEEGIPFRLQHHPAGEVVDSAWQAARSVGIACDR


                         +         .         .         .         .         *         .:210
query           PESLGVVIKTENGNVVYTGDFKFDQSAEKGYRTDYARLTEIGREGVLALLSESANAENPRETVNERAIYD
3bk1A           PDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEEIAKE
3bk2A           PDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEEIA-K
2dfwA           PDRFGIALATPTGRLHCAGDADVEFTIQ-SASKPFTYAAALVDRGFAAVDRPSGEAFNELSLEAESHRPD
1dcnC           NERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISTHLLVERAAIEIDVILPGYTNLQKAQPI
2az4B           YGASALLIRTPDHFITYTGDLRLHGHNREETLAFCEKAKHTELEGVSISFPEREPDPAQIAVVSEEDLVQ
2az4A           YGASALLIRTPDHFITYTGDLRLHGHNREETLAFCEKTELLMMEGVSISFPEREPDPAQAVVSEEDLVQH
1e5dA           WPD-SMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQGAGVAPEFICP
2dkfA           PGSAFVVAQGEGRTLVYSGDLGNR-EKDVLPDPSLPPLADL-------VLAEGTYGDRPHRPYTVREFLE
1dcnA           NERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISIKTLVERAAIEIDVILPGYTNLQKAQPI
3bv6B           ALVTLPKGVSSYDKAILDGMDSVYHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMTSSDVL-R
3bv6A           ALVTLPKGVSSVNYLIETSGGSVYHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMTSSDVL-R
2bc2A           T-EDNIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
2bg2A           T-EDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
1dcnD           NERRLKELIGDIAGKLNTGRSRNDQVVTDLKLFMKNSLSIISIKTLVERAAIEIDVILPGYTNLQKAQPI
2br6A           GHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELSIKRLKEVVKKEKP---------------
2cbnA           ECYGYRIEEHDAPGALNAQALKAAGVPPGPFQELKAGKTITLEDGRQINGADYLAAPVPGKALAIFGDTD
2bflB           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
2bg8A           T-EDNIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
2bfzA           T-EDNIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
1dd6B           PDN--VVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKL
2bgaA           TED-NIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
2bfkB           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
1dd6A           PDNVVVWL--PERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKL
2bg7A           HTEDNIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
2bc2B           T-EDNIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
1bvtA           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
2a7mA           GHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAPELALSSIKRLKEVVKKEKPIEKSCRVFPE-----
2bg7B           TED-NIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
2bg2B           T-EDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEW-STSIENVLKRYRNIN-------------
2bfzB           TED-NIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
3dhaA           GHQSLFIETEQSGSVLLTIDASYT----------------------------------------------
1dxkA           TED-NIVVWLPQYNILVGGSLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
3bc2A           TED-NIVVWLPQYNILVGGLVKSTSAKDLGNVADAYVNEWSTIENVLKRYRNI-----------------
1bmcA           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEW-STSIENVLKRYRNIN-------------
2bfkA           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEW-STSIENVLKRYRNIN-------------
1bmiA           TD--NIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKDKVKAKFPSARYVGDYGGTELIEHTKQ
2bg8B           TED-NIVVWLPQYNILVGGCLVKSTSA-KDLGNVADAYVNEWSTSIENVLKRYRNIN-------------
1bc2A           TED-NIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
2bflA           T-EDNIVVWLPQYNILVGGCLVKSTSAKDLGNVADAYVNEWSTENVLKRYRNI-----------------
1bmiB           TD--NIVVWLPTENILFGGCMLKDNQATSIGNISDADVTAWPKDKVKAKFPSA-----------------
2btnA           GHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELSIKRLKEVVKKEKPGHDIEQEKSCRVFPE
3cqqA           ----------------------------------------------------------------------
1a7tA           ATD-NIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKDKVKAKFPSARYVGNYGGTELIEHTKQ
1a8tA           ATD-NIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKDKVKAKFPSA-----------------
3dh8A           DDH--VVFYDVRRRRLFCGDALGAFDEAEGVWRP------------------------------------
2e7yB           VSFGYHIFEVRRKLKKEFQGLDSKEISRLVKEKGRDFVTEEYHKKVLTISGDSLALDPEEIRGTELLIHE
1a8tB           ATD-NIVVWLPTENILFGGCMLKDNQTTSIGNISDADVTAWPKDKVKAKFPSA-----------------
2bufE           ----------------------------------------------------------------------
2bibA           FGDMDIQLYNYENETDSSGELKKI----------------------------------------------
2cg2A           SLLAPTRLIEGEGEDLVLDGVPFTFQNTPGTESPAEM---------------------------------
2d0pD           HMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARL--------------------------------
2d0oB           HMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARL--------------------------------
2e7yA           NAGGFKRYEVSFGYHIFEVRRKLKKEFQGLDSKEISRL---VKEKGRDFVTEEYHKKVLTISGDSLAL--
2d0pB           HMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARL--------------------------------
2cg3A           LAPTRLIEGEGEDLVLDGVPFTFQ----------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           HMLVVHYKNLPASAPLFTLMHHQDSQAHRNTGNNAARL--------------------------------


                         .         .         .         +         .         .         .:280
query           FISENFEYRKGRIIVACVASNILRVQQIFNAAAANNRKVALTGHDVEKVVKTAMRLNKLVLPEEDLLIPI
3bk1A           LDRVIGRAPG-RVFVTTFASHIHRIQSVIWAAEKYGRKVAEGRS--LKFSRIALELGYLKVKDR--LYTL
3bk2A           ELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAEGRS--LKFSRIALELGYLKVKDR--LYTL
2dfwA           NAINAGALAVHQLLVGPEASRKERLDRAVEISLLAGRRLSVDWETYESEAVSDRNLSLAHLRSGVLQDSA
1dcnC           ---------RWSQFLLSHAVALTRDSERLGEVKKRINVLPLGSGALAGNPLDIDREMLRSELEFASISL-
2az4B           HLVR--LELENPNRQITFNGYPANVERFAKIIEKSPRTVVLEANMAALLLEVFGIEVRYYYAESGKIPEL
2az4A           LVRLELENPNRQITFNGYPANVERFAKIIEKSPRTVVLEANMAALLLEVFGIEVRYYY---AESGKIPEL
1e5dA           DHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVLMWCKACHHS
2dkfA           IL-EKTLSQGGKVLIPTFAVE--RAQEILYVLYTHGHRLPRAPIYLDSPAGRVLSLYPRL----------
1dcnA           ---------RWSQFLLSHAVALTRDSERLGEVKKRINVLPLGS--------GALAGNPLDIDRE-MLRSE
3bv6B           AAESLDCQVVVPFHHDIWANFQNDPREIEVLWNMKKDRLQYQFAPF--FWQVGGKYTYPTDKGRMHYQHF
3bv6A           AAESLDCQVVVPFHHDIWANFQNDPREIEVLWNMKKDRLQYQFAP--FFWQVGGKYTYPTDKGRMHYQHF
2bc2A           ----------------------------------------------------------------------
2bg2A           ----------------------------------------------------------------------
1dcnD           RWS-----QFLLSHAVALTRDSERLGEVKKRINVLPGSGALAG--------NPLDIDR------EMLRSE
2br6A           ----------------------------------------------------------------------
2cbnA           AALDLAKGVDVMVHEATLDITMSSTRQAATLAREAGVGKLIITHVSSRYDDKGCQHLLRECRSIFPATEL
2bflB           ----------------------------------------------------------------------
2bg8A           ----------------------------------------------------------------------
2bfzA           ----------------------------------------------------------------------
1dd6B           TLEQ------------------------------------------------------------------
2bgaA           ----------------------------------------------------------------------
2bfkB           ----------------------------------------------------------------------
1dd6A           TLEQAVKG--------------------------------------------------------------
2bg7A           ----------------------------------------------------------------------
2bc2B           ----------------------------------------------------------------------
1bvtA           ----------------------------------------------------------------------
2a7mA           ----------------------------------------------------------------------
2bg7B           ----------------------------------------------------------------------
2bg2B           ----------------------------------------------------------------------
2bfzB           ----------------------------------------------------------------------
3dhaA           ----------------------------------------------------------------------
1dxkA           ----------------------------------------------------------------------
3bc2A           ----------------------------------------------------------------------
1bmcA           ----------------------------------------------------------------------
2bfkA           ----------------------------------------------------------------------
1bmiA           IVNQYIESTS------------------------------------------------------------
2bg8B           ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
2bflA           ----------------------------------------------------------------------
1bmiB           ----------------------------------------------------------------------
2btnA           YI--------------------------------------------------------------------
3cqqA           ----------------------------------------------------------------------
1a7tA           IVNQ------------------------------------------------------------------
1a8tA           ----------------------------------------------------------------------
3dh8A           ----------------------------------------------------------------------
2e7yB           CTFLDARDRR--------YKNHAAIDEVMESVKAAGVKKVILYHISTRYIRQLKSVIKKYREEMPDVEIL
1a8tB           ----------------------------------------------------------------------
2bufE           ----------------------------------------------------------------------
2bibA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2d0pD           ----------------------------------------------------------------------
2d0oB           ----------------------------------------------------------------------
2e7yA           -DPEEIRGTELLIHECTFLNHAAIDEVMESVKAAGVKKVILYHI--------------------------
2d0pB           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KKINDYNDDEIVILETGRSGEPLKSLQKMAMGRHRFVNLHEGDLVFITTTPSHAMETKVARTRDMIYRSG
3bk1A           EEVKDLPDHQVLILATGSQGQPSV--LHRLAFEGHAKAIKPGDTVILSSSPIPGNEEAVNRVINRLYALG
3bk2A           EEVKDLPDHQVLILATGSQGQPSVL--HRLAFEGHAKAIKPGDTVILSSSPIPGNEEAVNRVINRLYALG
2dfwA           EEIVAGYVAQCAVLVTVKDLAVGACLATGGIHPMTGERMLPSIVARRVVSVTSSGYDAAGQ---WLADVG
1dcnC           NSMDAISERDFVVEFLSFATLLMIHLSKMA-----------EDLIIYSTSEFGFLTLSDAPDSLELIRSK
2az4B           NPALEIPYDTLLKDKTDYLWQVVNQFDNLQEGSL---------YIHSDAQPLGDFDPQYRVFLDLLAKKD
2az4A           NPALEIPYDTLLKDKTDYLWQVVNQFDNLQ----------EGSLYIHSDAQPLGDFDPQYRVFLDLLAKK
1e5dA           QIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFG--WSGESTKVLAEWLTGMG
2dkfA           --VRYFSEEVQAHFLQGKNPFRPAGLEVVEHTEASKALNRAPGPVVLAGSGLAGGRYQPQGGLGAEIIAR
1dcnA           LEFASISLNSMDISERDFVVEFLSFATLLMIHLSKMAE----DLIIYSTSEFGFLTLSDAFSSLELIRSK
3bv6B           RGFQDIFKNE------------------------------------------------------------
3bv6A           RGFQDIFKNE------------------------------------------------------------
2bc2A           ----------------------------------------------------------------------
2bg2A           ----------------------------------------------------------------------
1dcnD           LEFASISLNSMDISERDFVVEFLSFATLLMIHLSKMAE----DLIIYSTSEFGFLTLSDAFSSLELIRSK
2br6A           ----------------------------------------------------------------------
2cbnA           -----ANDFTVFNV--------------------------------------------------------
2bflB           ----------------------------------------------------------------------
2bg8A           ----------------------------------------------------------------------
2bfzA           ----------------------------------------------------------------------
1dd6B           ----------------------------------------------------------------------
2bgaA           ----------------------------------------------------------------------
2bfkB           ----------------------------------------------------------------------
1dd6A           ----------------------------------------------------------------------
2bg7A           ----------------------------------------------------------------------
2bc2B           ----------------------------------------------------------------------
1bvtA           ----------------------------------------------------------------------
2a7mA           ----------------------------------------------------------------------
2bg7B           ----------------------------------------------------------------------
2bg2B           ----------------------------------------------------------------------
2bfzB           ----------------------------------------------------------------------
3dhaA           ----------------------------------------------------------------------
1dxkA           ----------------------------------------------------------------------
3bc2A           ----------------------------------------------------------------------
1bmcA           ----------------------------------------------------------------------
2bfkA           ----------------------------------------------------------------------
1bmiA           ----------------------------------------------------------------------
2bg8B           ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
2bflA           ----------------------------------------------------------------------
1bmiB           ----------------------------------------------------------------------
2btnA           ----------------------------------------------------------------------
3cqqA           ----------------------------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1a8tA           ----------------------------------------------------------------------
3dh8A           ----------------------------------------------------------------------
2e7yB           ----------------------------------------------------------------------
1a8tB           ----------------------------------------------------------------------
2bufE           --------------------DDAAQVAKVLSEALPYIRRFVGKTLVIKYGGN---AMESEELKAGFARDV
2bibA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2d0pD           ----------------------------------------------------------------------
2d0oB           ----------------------------------------------------------------------
2e7yA           ----------------------------------------------------------------------
2d0pB           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADVKAIFDELNSSGHASKNDLQLMMNLVKPRYVIPVQGEYRMLSAHAELARELGIPSENIFLLKKGDVLE
3bk1A           AYVLYPPTYKVHSGHASQEELKLILNLTTPRFFLPWHGEVRHQNFKW--LAESSRPPEKTLIGENGAVYR
3bk2A           AYVLYPPTYVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQNFKW--LAESSRPPEKTLIGENGAVYR
2dfwA           IPAK------------------------------------------------------------------
1dcnC           SGRVFGRLAILMVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLA
2az4B           ITFV----RLACSGHAIPEDLDKIIALIEPQVLVPIHTLKPEKLENPY---------GERILPERGEQIV
2az4A           DITFVR---LACSGHAIPEDLDKIIALIEPQVLVPIHTLKPEKLENPY---------GERILPERGEQIV
1e5dA           FDM--PATPVKVKNVPTHADYEQLKTMAQ-----------------------------------------
2dkfA           PPLRASVHTLGGSGHAGQDELLDWLQ--GEPRVVLVHGEEEKLLALGKLLALRGQ---EVSLARFGEGVP
1dcnA           SGR--VFGRLASVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLA
3bv6B           ----------------------------------------------------------------------
3bv6A           ----------------------------------------------------------------------
2bc2A           ----------------------------------------------------------------------
2bg2A           ----------------------------------------------------------------------
1dcnD           SGR--VFGRLASVLKGLPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENMEKALTPEMLA
2br6A           ----------------------------------------------------------------------
2cbnA           ----------------------------------------------------------------------
2bflB           ----------------------------------------------------------------------
2bg8A           ----------------------------------------------------------------------
2bfzA           ----------------------------------------------------------------------
1dd6B           ----------------------------------------------------------------------
2bgaA           ----------------------------------------------------------------------
2bfkB           ----------------------------------------------------------------------
1dd6A           ----------------------------------------------------------------------
2bg7A           ----------------------------------------------------------------------
2bc2B           ----------------------------------------------------------------------
1bvtA           ----------------------------------------------------------------------
2a7mA           ----------------------------------------------------------------------
2bg7B           ----------------------------------------------------------------------
2bg2B           ----------------------------------------------------------------------
2bfzB           ----------------------------------------------------------------------
3dhaA           ----------------------------------------------------------------------
1dxkA           ----------------------------------------------------------------------
3bc2A           ----------------------------------------------------------------------
1bmcA           ----------------------------------------------------------------------
2bfkA           ----------------------------------------------------------------------
1bmiA           ----------------------------------------------------------------------
2bg8B           ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
2bflA           ----------------------------------------------------------------------
1bmiB           ----------------------------------------------------------------------
2btnA           ----------------------------------------------------------------------
3cqqA           ------------------------VCVLKGDG--PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFFGD
1a7tA           ----------------------------------------------------------------------
1a8tA           ----------------------------------------------------------------------
3dh8A           ----------------------------------------------------------------------
2e7yB           ----------------------------------------------------------------------
1a8tB           ----------------------------------------------------------------------
2bufE           VLMKAVGINPHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIG
2bibA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2d0pD           ----------------------------------------------------------------------
2d0oB           ----------------------------------------------------------------------
2e7yA           ----------------------------------------------------------------------
2d0pB           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YKKDEMTISSSVEVGNTMIDGTGVGDIGNIVLRDRKILSEDGIFIAVVTIDRKKRKIVDTPKITSRGFVY
3bk1A           LTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRR-HAEEGLVVITALAGEDPV-----VEVVSRGFVK
3bk2A           LTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRR-HAEEGLVVITALAGEDPV-----VEVVSRGFVK
2dfwA           ----------------------------------------------------------------------
1dcnC           TDLALYLVRSGKAVHLAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQY----TALAGTAKSS
2az4B           ----------------------------------------------------------------------
2az4A           ----------------------------------------------------------------------
1e5dA           ----------------------------------------------------------------------
2dkfA           ----------------------------------------------------------------------
1dcnA           TDLALYLVRKGVPFRQAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQY----TALAGTAKSS
3bv6B           ----------------------------------------------------------------------
3bv6A           ----------------------------------------------------------------------
2bc2A           ----------------------------------------------------------------------
2bg2A           ----------------------------------------------------------------------
1dcnD           TDLALYLVRSGKAVHLAETKGITINNLSLEDLKSISPQFSSDVSQVFNFVNSVEQY----TALAGTAKSS
2br6A           ----------------------------------------------------------------------
2cbnA           ----------------------------------------------------------------------
2bflB           ----------------------------------------------------------------------
2bg8A           ----------------------------------------------------------------------
2bfzA           ----------------------------------------------------------------------
1dd6B           ----------------------------------------------------------------------
2bgaA           ----------------------------------------------------------------------
2bfkB           ----------------------------------------------------------------------
1dd6A           ----------------------------------------------------------------------
2bg7A           ----------------------------------------------------------------------
2bc2B           ----------------------------------------------------------------------
1bvtA           ----------------------------------------------------------------------
2a7mA           ----------------------------------------------------------------------
2bg7B           ----------------------------------------------------------------------
2bg2B           ----------------------------------------------------------------------
2bfzB           ----------------------------------------------------------------------
3dhaA           ----------------------------------------------------------------------
1dxkA           ----------------------------------------------------------------------
3bc2A           ----------------------------------------------------------------------
1bmcA           ----------------------------------------------------------------------
2bfkA           ----------------------------------------------------------------------
1bmiA           ----------------------------------------------------------------------
2bg8B           ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
2bflA           ----------------------------------------------------------------------
1bmiB           ----------------------------------------------------------------------
2btnA           ----------------------------------------------------------------------
3cqqA           NTAGCTSAGPHFNPLSRKHGGRHVGDLRNVT------ADKDGVADVSIEDSVIS---LSGDHIIGRTLVV
1a7tA           ----------------------------------------------------------------------
1a8tA           ----------------------------------------------------------------------
3dh8A           ----------------------------------------------------------------------
2e7yB           ----------------------------------------------------------------------
1a8tB           ----------------------------------------------------------------------
2bufE           LTGKDAELIRAKKLTVTIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIG-------------------
2bibA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2d0pD           ----------------------------------------------------------------------
2d0oB           ----------------------------------------------------------------------
2e7yA           ----------------------------------------------------------------------
2d0pB           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IKTSKDLMVESRDIVAKIVQRDLDNKEFDWSQLKQDIRENLNNFLYEQTKRHPVILPVIMExxxxxxxxx
3bk1A           --AGERLLGEVRRALEALKNGVR--EKKPLERIRDDIYYPVKKFLKKATGRDP-ILPVVIE---------
3bk2A           --AGERLLGEVRRALEALKNGVR--EKKPLERIRDDIYYPVKKFLKKATGRDP-ILPVVIE---------
2dfwA           ----------------------------------------------------------------------
1dcnC           V---TTQIEQLRELMKK-----------------------------------------------------
2az4B           ----------------------------------------------------------------------
2az4A           ----------------------------------------------------------------------
1e5dA           ----------------------------------------------------------------------
2dkfA           ----------------------------------------------------------------------
1dcnA           V---TTQIEQLRELMKK-----------------------------------------------------
3bv6B           ----------------------------------------------------------------------
3bv6A           ----------------------------------------------------------------------
2bc2A           ----------------------------------------------------------------------
2bg2A           ----------------------------------------------------------------------
1dcnD           V---TTQIEQLRELMKK-----------------------------------------------------
2br6A           ----------------------------------------------------------------------
2cbnA           ----------------------------------------------------------------------
2bflB           ----------------------------------------------------------------------
2bg8A           ----------------------------------------------------------------------
2bfzA           ----------------------------------------------------------------------
1dd6B           ----------------------------------------------------------------------
2bgaA           ----------------------------------------------------------------------
2bfkB           ----------------------------------------------------------------------
1dd6A           ----------------------------------------------------------------------
2bg7A           ----------------------------------------------------------------------
2bc2B           ----------------------------------------------------------------------
1bvtA           ----------------------------------------------------------------------
2a7mA           ----------------------------------------------------------------------
2bg7B           ----------------------------------------------------------------------
2bg2B           ----------------------------------------------------------------------
2bfzB           ----------------------------------------------------------------------
3dhaA           ----------------------------------------------------------------------
1dxkA           ----------------------------------------------------------------------
3bc2A           ----------------------------------------------------------------------
1bmcA           ----------------------------------------------------------------------
2bfkA           ----------------------------------------------------------------------
1bmiA           ----------------------------------------------------------------------
2bg8B           ----------------------------------------------------------------------
1bc2A           ----------------------------------------------------------------------
2bflA           ----------------------------------------------------------------------
1bmiB           ----------------------------------------------------------------------
2btnA           ----------------------------------------------------------------------
3cqqA           HEKADDLN-AGSRLACGVIGI-------------------------------------------------
1a7tA           ----------------------------------------------------------------------
1a8tA           ----------------------------------------------------------------------
3dh8A           ----------------------------------------------------------------------
2e7yB           ----------------------------------------------------------------------
1a8tB           ----------------------------------------------------------------------
2bufE           ----------------------------------------------------------------------
2bibA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2d0pD           ----------------------------------------------------------------------
2d0oB           ----------------------------------------------------------------------
2e7yA           ----------------------------------------------------------------------
2d0pB           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2d0oD           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxx
3bk1A           -----
3bk2A           -----
2dfwA           -----
1dcnC           -----
2az4B           -----
2az4A           -----
1e5dA           -----
2dkfA           -----
1dcnA           -----
3bv6B           -----
3bv6A           -----
2bc2A           -----
2bg2A           -----
1dcnD           -----
2br6A           -----
2cbnA           -----
2bflB           -----
2bg8A           -----
2bfzA           -----
1dd6B           -----
2bgaA           -----
2bfkB           -----
1dd6A           -----
2bg7A           -----
2bc2B           -----
1bvtA           -----
2a7mA           -----
2bg7B           -----
2bg2B           -----
2bfzB           -----
3dhaA           -----
1dxkA           -----
3bc2A           -----
1bmcA           -----
2bfkA           -----
1bmiA           -----
2bg8B           -----
1bc2A           -----
2bflA           -----
1bmiB           -----
2btnA           -----
3cqqA           -----
1a7tA           -----
1a8tA           -----
3dh8A           -----
2e7yB           -----
1a8tB           -----
2bufE           -----
2bibA           -----
2cg2A           -----
2d0pD           -----
2d0oB           -----
2e7yA           -----
2d0pB           -----
2cg3A           -----
2cfzA           -----
2cfuA           -----
2d0oD           -----