[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "3dpuB.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "2egzC.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2cqjA.bssp"
#ERROR : Can't open dsspfile "1dm9B.bssp"

## Summary of PDB Search
:298
    4e-37  20%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    3e-35  21%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    8e-35  20%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-34  15%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    2e-31  13%  3dpuB  [x.x.x] RAB FAMILY PROTEIN
    2e-28  14%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    3e-15  22%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    5e-15  23%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    8e-13  17%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    5e-11  13%  2egzC  [x.x.x] 3-DEHYDROQUINATE DEHYDRATASE
    9e-11  18%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    2e-09  17%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    3e-09  19%  2cqjA  [x.x.x] U3 SMALL NUCLEOLAR RIBONUCLEOPROTEIN PROTEIN
    4e-09  27%  1dm9B  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSDYKVLADKTGRLDKVVTNIFTDYTRSQLKKMIDDGNIKVNGDVKKANYKVNLGDEITFDKPEVKKLSL
3dh3B           ------------RLNKYISESG-ICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREA
3dh3A           ------------RLNKYISESG-ICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREA
3dh3C           ------------RLNKYISESG-ICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREA
2ab4A           ----------------------------------------------------------------------
3dpuB           -----------YRIINSSKTKNGHLNTSALGYILNEENNKFTYTLLEQRYLLDIMKQFELCSNLPTQIDN
2apoA           --------------------------------------LIVKEEVET---------NWDYGCNPYERKIE
1c05A           ------------RLDNLVYRLGLARTRRQARQLVTHGHILVDGSVNIPSYRVKPGQTIAV-REKSRNLQV
2ausA           ----------------------------------------------------------------------
1dm9A           ------------RLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVI
2egzC           ------------RVD-----QFSDTSLNYVKEKLEEVHSQGLKTILTIRSPEEGGREVKNREELFEELSP
3bbnD           STGQVLLQLLEMRLDNILFRLGMAPTIPGARQLVNHRHILVNGRVDIPSYRCKPQDTIMARDEQKSI-AL
2ausC           ---------------------------------------DIKREVIVKDDKAETNPKWGFPPDKRPIELH
2cqjA           ------------RLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVTDPAFLVTRSMEDFVTWVDSSKISG
1dm9B           ------------RLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDER---


                         .         .         *         .         .         .         .:140
query           EPENIPLXXXXXXXXXXXXNKPQGMVVHPSPGHFEHTLVNALLYHSPLSTINGTYRPGIVHRIDKDTSGL
3dh3B           EDLVL-----------IALNKPVGIVSTTEDGERDNIVDFVNHSK----------RVFPIGRLDKDSQGL
3dh3A           EDLVLIAL-----------NKPVGIVSTTEDGERDNIVDFVNHSK----------RVFPIGRLDKDSQGL
3dh3C           EDLVLIAL-----------NKPVGIVSTTEDGERDNIVDFVNHSK----------RVFPIGRLDKDSQGL
2ab4A           -------------------YKPKGPTSHDVVDEVRK--------------KLKTRKVGHGGTLDPFACGV
3dpuB           EPEGEPLRFIMKYDYLPSTIIPRLMIAMQH------QILDRMQWRYGM----------VLKSQDHEGALA
2apoA           DLIK---------YGVVVVDKPRGPTSHEVSTWVKKIL--------------NLDKAGHGGTLDPKVTGV
1c05A           IKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEINEAL---------------------------
2ausA           -------------------DKPPGPTSHEVVAW--------------IKRILNLEKAGHGGTLDPKVSGV
1dm9A           VKAITEQRRPASEAALLYEETAESVEKR------------------------------------------
2egzC           LSDYTDIELSSRGLLVKLYNITKEISYHNFELTPPNWIIREVLREGY--RYGGIPKIAVKANSYEDVARL
3bbnD           IQNSLDLSPREELPKHLTLNPYKGLVNQIID----------------------------SKWVGLKINEL
2ausC           IQYGVINL-----------DKPPGPTSHEVVAW--------------IKRILNLEKAGHGGTLDPKVSGV
2cqjA           P---------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMVAKNDMAHQSLAKQLKDKTNTREYVALVHGNIKEDSGTIDAPLGRSKVDRKKQAVVKDGRNAVTHFEV
3dh3B           IFLTNHGDLVNKILRAGNDHE--KEYLVTVDKPITEEFI-----------RGMSAGVPILGTVTKK---C
3dh3A           IFLTNHGDLVNKILRAGNDHE--KEYLVTVDKPITEEFIRGMSAGVPILGTVTKKCKV------------
3dh3C           IFLTNHGDLVNKILRAGNDHE--KEYLVTVDKPITEEFIRGM----------SAGVPILGTVTKKCKVKK
2ab4A           LIIGVNQGTRILEFYKDLKK----VFWVKMRLGLITETFDITSFVGEYDQVPPAYSAKKLPPKRVKIFKI
3dpuB           KVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKILDVKEFIPLPGHPDEKELLGLEKMGRDRYVSGKL
2apoA           LPVALERATKT----IPMWHIPPKEYVCLMHLHRDASEEDILRVFKEFTGRI-------YQRRIRKIHEL
1c05A           ----------------------------------------------------------------------
2ausA           LPVALERATRVVQALLPAGKE----YVALMHLHGDVPEDKIRAVMKEFEGE--------IIQRKVYYIEI
1dm9A           ----------------------------------------------------------------------
2egzC           LCISRQVEGEKILISMGDYGKISRLAGYVFGSVITYCSLKAFAP-GQIPLEEMVELRKKFY---------
3bbnD           LVV-------------------------------------------------------------------
2ausC           LPVALERATR--VVQALLPAGKE--YVALMHLHGDVPEDKIRAVMKEFEGE--------IIQRTRKVYYI
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LKRYGDYTLVKCVLETGRTHQIRVHMKYIGHPLVGDQLYGPRKTLGNSGQFLHAEKLGFVHPRTNEYLEF
3dh3B           KVKKEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERT------RIMNVSLSGIPLGEWRDLTDDELID
3dh3A           --KKEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIM------NVSLSGIPLGEWRDLTDDELID
3dh3C           E----APFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIM------NVSLSGIPLGEWRDLTDDELID
2ab4A           WDVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELV-----RESVGPHTIEESLNVFEAAPEE
3dpuB           EKVFSVSKMLDSVIS-------------------------------------------------------
2apoA           ELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQELR-----RTKSGCFEEKDAVYLQDLLDAY
1c05A           ----------------------------------------------------------------------
2ausA           LEIDGRDVLFRVGVEAGTRSLIHHIGLALGVGAHMAELR-------------------------------
1dm9A           ----------------------------------------------------------------------
2egzC           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
2ausC           EILEIDGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMAELR---------------------------
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TAPLPENFKKLLESLDKR
3dh3B           LFKLIENSSSEV------
3dh3A           LFKLIENSS---------
3dh3C           LFKLIENS----------
2ab4A           IENRIIPLEKCLEWLPRV
3dpuB           ------------------
2apoA           VFWKEDGDEEELRR----
1c05A           ------------------
2ausA           ------------------
1dm9A           ------------------
2egzC           ------------------
3bbnD           ------------------
2ausC           ------------------
2cqjA           ------------------
1dm9B           ------------------