[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99672.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2detA.bssp"
#ERROR : Can't open dsspfile "2derB.bssp"
#ERROR : Can't open dsspfile "2deuA.bssp"
#ERROR : Can't open dsspfile "2derA.bssp"
#ERROR : Can't open dsspfile "1ebfA.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "2e21A.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "2e89D.bssp"
#ERROR : Can't open dsspfile "2e21B.bssp"
#ERROR : Can't open dsspfile "1bsuB.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "3bl5E.bssp"
#ERROR : Can't open dsspfile "3dpiA.bssp"
#ERROR : Can't open dsspfile "3b9xC.bssp"
#ERROR : Can't open dsspfile "3bl5A.bssp"
#ERROR : Can't open dsspfile "1bgbB.bssp"
#ERROR : Can't open dsspfile "2d13C.bssp"
#ERROR : Can't open dsspfile "3b9xA.bssp"
#ERROR : Can't open dsspfile "3dpiB.bssp"
#ERROR : Can't open dsspfile "1b97A.bssp"
#ERROR : Can't open dsspfile "2d13B.bssp"
#ERROR : Can't open dsspfile "2d13A.bssp"
#ERROR : Can't open dsspfile "3b9xD.bssp"
#ERROR : Can't open dsspfile "2dt6A.bssp"
#ERROR : Can't open dsspfile "2d13D.bssp"

## Summary of PDB Search
:375
    e-106  56%  2detA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    e-106  54%  2derB  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    5e-76  56%  2deuA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    1e-75  53%  2derA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    1e-36  15%  1ebfA  [c.2.1 - d.81.1] HOMOSERINE DEHYDROGENASE
    5e-34  11%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    8e-34   9%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-31  11%  2e21A  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    3e-31  18%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    3e-30  16%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    4e-30  17%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    6e-29  10%  2e89D  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    3e-28  11%  2e21B  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    4e-28   9%  1bsuB  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    3e-26  16%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-25  21%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    4e-25   8%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    6e-25  14%  3bl5E  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    9e-25  11%  3dpiA  [x.x.x] NAD+ SYNTHETASE
    7e-21   8%  3b9xC  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    3e-18  14%  3bl5A  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    9e-17  10%  1bgbB  [c.52.1] ECORV ENDONUCLEASE
    3e-16  11%  2d13C  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    8e-16  11%  3b9xA  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-15  11%  3dpiB  [x.x.x] NAD+ SYNTHETASE
    7e-15  10%  1b97A  [c.52.1] RESTRICTION ENDONUCLEASE ECORV
    3e-14  17%  2d13B  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-13  11%  2d13A  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-12  12%  3b9xD  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    3e-07  18%  2dt6A  [x.x.x] SPLICING FACTOR 3 SUBUNIT 1
    6e-06  15%  2d13D  [x.x.x] HYPOTHETICAL PROTEIN PH1257
:375

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPY
2detA           ----------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIEL
2derB           ----------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIEL
2deuA           ----------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIEL
2derA           ----------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIEL
1ebfA           ----------------------LISKDFSPLNVGSD----WKAALAASTTKTLPLDDLIAHLKTSPKPVI
3dlaD           ----------------------LIVATHAMDREGRPRSDIL--------AFALPGFNNAIKLARALGVTF
3dlaC           ----------------------LIVATHAMDREGRPRSDILAFALP-------GFKNNAIKLARALGVTF
2e21A           ----------------------TDVLLKLKNYFSLKEVALAHFNHMLR-ESAERDEEFCKEFAKERNMKI
2c5sA           ----------------------AYLTMKRGVSVEAVHFHSPP-------FTSERAKQKVIDLAQELTKYC
2dplB           ----------------------AVLAHKAIGDRLHAVFVNTGFLRKG------EPEFVVKTFRDEFGMNL
2dplA           ----------------------AVLAHKAIGDRLHAVFVNTGFLRKG------EPEFVVKTFRDEFGMNL
2e89D           ----------------------TDVLLKLKNYFSLKEVALAHFNHMLR-ESAERDEEFCKEFAKERNMKI
2e21B           ----------------------TDVLLKLKNYFSLKEVALAHFNHMLR-ESAERDEEFCKEFAKERNMKI
1bsuB           ----------------------SDLINALYDEVCGIISAEGKIYPLG------SDTKVLSTIFELFSRPI
3a4iA           ----------------------VLAHKAIGDRLHAVFVNTGFLRKG-------EPEFVVKTFRDEFGMNL
2e18A           ----------------------AYLATKAKEKVLGLIMPYFEN----------KDVEDAKLVAEKLGIGY
3dlaB           ----------------------LIVATHAMDREGRPRSDIL--------AFALPGKNNAIKLARALGVTF
3bl5E           ----------------------LLWALKEFEEVETVTFHYN--------QRHSQEVEVAKSIAEKLGVKN
3dpiA           ----------------------GRLAQLAVERLRASGYDARFVAMR---LPYGAEADARRALAFVRADET
3b9xC           ----------------------MMAAKHPAIDLLGITIVAGN-------QTLDKTLINGLNVCQKLEINV
3bl5A           ----------------------LLWALKEFEEVETVTFHYN--------QRHSQEVEVAKSIAEKLGVKN
1bgbB           ----------------------VCGIISAEGKIYPLGS-------DTKVLS-TIFELFSRPIINKIAEKH
2d13C           ----------------------LYWALKSGLRVRYLVSMVS--------------EELTSLQARALGIPI
3b9xA           ----------------------MMAAKHPAIDLLGITIVAGN-------QTLDKTLINGLNVCQKLEINV
3dpiB           ----------------------GRLAQLAVERLRASGYDARFVAMRL--PYGAQEADARRALAFVRADET
1b97A           ----------------------LGSDTKVLSTIF--------------ELFSRPIINKIAEKHGYIVEEP
2d13B           ----------------------LYWALKSGLRVRYLVSMVS------------ENVELTSLQARALGIPI
2d13A           ----------------------LYWALKSGLRVRYLVSMVSENNVELTSLQARAPIIKGFTEKEKEVEDL
3b9xD           ----------------------MMAAKHPAIDLLGITI-------VAGNQTLDKTLINGLNVCQKLEINV
2dt6A           ------------------------------------------DKTASFVARNGPEFEARIR-QNEINNPK
2d13D           ----------------------LYWALKSGLRVRYLVSMVSLTS----------------LQARALGIPI


                         .         .         *         .         .         .         .:140
query           YSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQLRRDEDGRV
2detA           HTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAELGADYIATGHYVR-RADVDGKS
2derB           HTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAELGADYIATGHYVR-RADVDGKS
2deuA           HTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEAAEDLGADYIATGHYVR-RADVDGKS
2derA           HTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEAAEDLGADYIATGHYVR-RADVDGKS
1ebfA           LVDNTSSAYIAGFYTKFVENGISIATPNKKAFSSDLATWKALFSNKPTNGFVYHEATVGFLREIIQTGDE
3dlaD           SEIDIG-DTARLMLHTIGHPYSVGEKVYDVTFENAGLRTDYLFRIANQRGGIVLGTGDLSELAGVGDQMS
3dlaC           SEIDIG-DTARLMLHTIGHPYSVGEKVYDVTFENVQAGLRTDYRIANQRGGIVLGTGD------------
2e21A           FVGKEDVRAFA------------KENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLN-DLLETSLL
2c5sA           KRVTLHLVPFTEVQ----KTINKEIPSSYSMTVMRRMMMRITERIAEERNALAITTGESL----------
2dplB           HYVDAQDR--------FFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGAEYLIQGTIL-----KLIEP
2dplA           HYVDAQDRFFS--------ALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGAEYLIQGTIAP-----LNLK
2e89D           FVGKEDVRAFA------------KENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLN-DLLETSLL
2e21B           FVGKEDVRAFA------------KENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLN-DLLETSLL
1bsuB           INKIAEKHGYIVEEPKQQNHYPDFTLYKPSENKKIAIDIKTTYTNFTLGGYTSFIRNNTK--------NI
3a4iA           HYVDAQDRFFS--------ALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGAEYLIQGTIA--PNLKLIEP
2e18A           KVIN-----IKPIVDSFVENL--ELNLDRKGLGNIMSRTRMIMAHANSLGRIVLGTSNR-----------
3dlaB           SEID-----IGDTARLMLHTIGHVTFEN----VQAGLRTDYLFRIANQRGGIVLGTGD------------
3bl5E           HLLDM----------SLLNQLAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCE------TDFS
3dpiA           LTVDVKPAADAMLAALAAGGLAYLDHAQQDFVLGARERMIAQYAVAGARNGVVIGTDHA-----------
3b9xC           PVYAGMPQMRQQIVATGLDGPVFEPLTRQAESTHAVKYIIDTL-MASDGDITLVPVGPLS----NIAVAM
3bl5A           HLLDMSLLNQ----------LAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCEGYPDCRDEF-
1bgbB           GYIVEEP-----KQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKIKFTLYTSFIRNN-------------
2d13C           IKGFTKKEVEDLKNVLEGLK---VDGIVAGALASR-YQKERIENVARELGLKVYTPAWEK---DPYQYML
3b9xA           PVYPIMRQQIVADNIHGDTGLDGPVFEPLTRQAESTHAVKYIIDTLMASDITLVPVGPLSNI--------
3dpiB           LTVDVKPAADAMLAALAAGGLAYLDHAQQDFLGNIKARERMIAAVAGARNGVVIGTDHAA----------
1b97A           KQLNHYPDF--TLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLIRNNTKNIVYPFDQYIAH---------
2d13B           IKGFTEVEDLKNVLEGLKGALQKERIENVARELGLKVYTPAWEKDPYQYMLEIIKLGFKVVFVASAYGLN
2d13A           KNVLEGLKVDGIVAGALASRYQKERIENVARELGLKVYTPAWEKDPYQYMLEIIKLGFKVVFVAVS----
3b9xD           PVYAGPQPIMRQQIVAIHGDTGLDGPVFEPLQAESTHAVKYIIDTLMASDGDITLVPV------------
2dt6A           FNFLNPNDPYHAYYRHKVSEFKEGKAQEP-----------------------------------------
2d13D           IKGFTVEDLKNVLAGALASRYQKERIENVARELGLKVYTPAWEKDPYQYMLEIIKLGFKV----------


                         +         .         .         .         .         *         .:210
query           HLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFIGERNFSKF
2detA           RLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREF
2derB           RLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGL------VTTGICFIGERKFREF
2deuA           RLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREF
2derA           RLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIA----------------EDLGLVKFREF
1ebfA           VEKIEGIFSGTLSYIFNEFSTSQANDVKFSAKKLGYTEPDPRDDLNGLVARKVTIVGRISGVEVESPTSF
3dlaD           HYNVNAGVPKTLIQHLIRSAGEFGEKVGEVLQSVLDTEEAKVGPFAFQVLRYGFRPSKIAFLAWHAWNDA
3dlaC           --------LSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEAKV
2e21A           FFTRGTGLDGLIGFL------PKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRV
2c5sA           ------GQVASQTLDMHTINEVTNYPVIRPLITMDKLEIIKIAEEIGTYDISIRPYKPKREKANRFFTPL
2dplB           LRDLYKDEVRELAKFLG-LPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEVERAGLRPWQAF
2dplA           LIEPLRDLYKDEVRELAGLPEKIYNRMPFPGPGLAVRVIGEVTPEKI----RIVREANAIVEEEVERAGL
2e89D           FFTRGTGLDGLIGFL------PKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRV
2e21B           FFTRGTGLDGLIGFLPKEE------VIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRV
1bsuB           VYPFDQYIAHWII------------GYVYTRVSLKTYNINELNEIPKPFLQDKWVIAGDLA---------
3a4iA           LRDLYKDEVRELAKFLGL-PEKIYNRMPFPGPGLAVRVIGEVTPEKIR----IVREANAIVEEEVERAGL
2e18A           ----------SEFLTGYFTKWGDGASDYAPIINLYKTEVWEIAKRIGVRIVKKKPSAGLWE-GQTDEDEL
3dlaB           --------LSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVL-------QSV
3bl5E           GYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLPACHLRSKGYEEY
3dpiA           ----------AESVMGFFTKFGDGGADVLPLAGLTKRRVRALARMLGADLVLKTPTADLETLRPQRPHAY
3b9xC           RMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTSGPLVMMGLDLTNQTVCTPDVAGEL
3bl5A           ---------VKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLPACHLRSKGYEEY
1bgbB           --------TKNIVYPFDQYIAHWIIGYVYTRVSLKTYNINELNEIPKP----------------------
2d13C           EIIKLGFKVVFVAVSAYGLNESWLGRELHIAGEGGEFETFVLDMPFVIDDAEKFWDGLSGKF--------
3b9xA           ----------------------------------------------------------------------
3dpiB           --------------------ESVMGADVLPLAGLTKRRVRALARMLGADEPAYGITYEQIDD--------
1b97A           -----------------WIIGYVYTRVATRKSSLKTYNINELNEIPKPYKGVKVF---------------
2d13B           ESWLGRELNYKNLEELKKLSEKYGIHIAGEGG--------------------------------------
2d13A           ----------------------------------------------------------------------
3b9xD           ----GPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAE--------------------------
2dt6A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LGEFLPAQPGEMVTLDGEVKGNHFGLMNYTIGQRKGLGIGGDGKSNEPWFVIGKDLKTNTLLVGQGYHNE
2detA           LGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTEGTEEPWYVVDKDVENNILVVAQGHEHP
2derB           LGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKGTEEPWYVVDKDVENNILVVAQGHEHP
2deuA           LGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKGTEEPWYVVDKDVENNILVVAQGHEHP
2derA           LGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKGTEEPWYVVDKDVENNILVVAQGHEHP
1ebfA           PVQSLIPKPLESVK-SADEFLEKLSDYDKDLTQLKKEAATEN---KVLRFIGKVDVATKSVSVGEKYDYS
3dlaD           ERGNWPPGFPKSERPSIRHWLQIFVQRFYSFSQFKRSALPNGPK--VSHGGALSPRGDWRAPSDMSARIW
3dlaC           GPFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNWPPGPKSERPSYSLAEIRHWLQIFVQRFYSFS
2e21A           IPELKRINENLEDTFEREFLEEEAQKLYKEVKKGNCLDVKK----LKEKPLALQRRVIRKFIGEKDYEKV
2c5sA           IDEAVAKETMVLQTVE------------------------------------------------------
2dplB           AVLLGVKTVGVQG---------DIRAYKETIAVRIVESIDGMT---ANAMNVPWEVLQRIAFRITSEIPE
2dplA           RPWQAFAVLLG---VKTVGVQGDIRAYKETIAVRIVESIDGANAMNVPWEVLQRIAFRITSEIPEVGRVL
2e89D           IPELKRINEVKVLRAEREFLEEEAQKLYKEVKKGNCLDVKKLKEKPLAL----QRRVIRKFIGEKDYEKV
2e21B           IPELKRINENLEDTFLKMVKEEEAQKLYKEVKKGNCLDV----KKLKEKPLALQRRVIRKFIGEKDYEKV
1bsuB           ----------------------------------------------------------------------
3a4iA           RPWQAFAVLLGVKTVGVQGDIRA---YKETIAVRIVESIDGANAMNVPWEVLQRIAFRITSEIPEVGRVL
2e18A           LDEILWIGKEEIAKIPLSLVERVEELIKKSEHKRR-----------------------------------
3dlaB           LDTEITSEAKVGPF------ALQDFSLFQVL--RYGFRPSKIA---FLAWHAWNDAERGNWPPGFPKSER
3bl5E           M---------------------------------------------------------------------
3dpiA           GITYQIDDFLEGKPMDDAVAETVLRFYDATRHKRA-----------------------------------
3b9xC           FSDPVHDATCIGYLINPDGIKTQEMYVEVDVNSGPCYG--------------------------------
3bl5A           M---------------------------------------------------------------------
1bgbB           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
2dt6A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HLYANSLDASKLSFVDDISDCGDEFHCTAKFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVF
2detA           RLMSVGLIAQQLHWVDR-EPFTGTMRCTVKTRYRQTDIPCTVKALDD-DRIEVIFDEPVAAVTPGQSAVF
2derB           RLMSVGLIAQQLHWVDREPF-TGTMRCTVKTRYRQTDIPCTVKALDD-DRIEVIFDEPVAAVTPGQSAVF
2deuA           RLMSVGLIAQQLHWVDREPF-TGTMRCTVKTRYRQTDIPCTVKALDDD-RIEVIFDEPVAAVTPGQSAVF
2derA           RLMSVGLIAQQLHWVDRE-PFTGTMRCTVKTRYRQTDIPCTVKALDD-DRIEVIFDEPVAAVTPGQSAVF
1ebfA           HPFASLKGS-------------------------------------------------------------
3dlaD           ----------------------------------------------------------------------
3dlaC           QFKRSALPNGPKHGGALSPR--GDWRAPSDMSARIWL---------------------------------
2e21A           ELVRSLLEKGGEVNL--------GKGKVLKRKERW-----------------------------------
2c5sA           ----------------------------------------------------------------------
2dplB           VGR-------------------------------------------------------------------
2dplA           YDITNKPPAT------------------------------------------------------------
2e89D           ELVRSLLEK-------------------------------------------------------------
2e21B           ELVRSLLEKG------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
3a4iA           YDITNKPPAT------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
3dlaB           PSYSLAEIRH------WLQIFVQRFYSFSQFKRSALPNGPKV-SHGGALSPRGDWRAPS-----------
3bl5E           ----------------------------------------------------------------------
3dpiA           ----------------------------------------------------------------------
3b9xC           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
1bgbB           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
2dt6A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDGEECLGSGTIDHAYKESxxxxxx
2detA           YNGEVCLGGGIIEQRLPLP------
2derB           YNGEVCLGGGIIEQRLPLP------
2deuA           YNGEVCLGGGIIEQRLPLP------
2derA           YNGEVCLGGGIIEQRLPLP------
1ebfA           -------------------------
3dlaD           -------------------------
3dlaC           -------------------------
2e21A           -------------------------
2c5sA           -------------------------
2dplB           -------------------------
2dplA           -------------------------
2e89D           -------------------------
2e21B           -------------------------
1bsuB           -------------------------
3a4iA           -------------------------
2e18A           -------------------------
3dlaB           -------------------------
3bl5E           -------------------------
3dpiA           -------------------------
3b9xC           -------------------------
3bl5A           -------------------------
1bgbB           -------------------------
2d13C           -------------------------
3b9xA           -------------------------
3dpiB           -------------------------
1b97A           -------------------------
2d13B           -------------------------
2d13A           -------------------------
3b9xD           -------------------------
2dt6A           -------------------------
2d13D           -------------------------