[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99736.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c26A.bssp"
#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "3dnsB.bssp"
#ERROR : Can't open dsspfile "3dnsA.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "3ec4A.bssp"
#ERROR : Can't open dsspfile "3e0kA.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "3d8pA.bssp"
#ERROR : Can't open dsspfile "2c27A.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "2b4bB.bssp"
#ERROR : Can't open dsspfile "2b4dA.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "3d8pB.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "3dr8A.bssp"
#ERROR : Can't open dsspfile "1b6bB.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "2bueA.bssp"
#ERROR : Can't open dsspfile "2b4bA.bssp"
#ERROR : Can't open dsspfile "3dsbA.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "2b4dB.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "2atrA.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "3bj8B.bssp"
#ERROR : Can't open dsspfile "2beiB.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"

## Summary of PDB Search
:252
    1e-07  15%  3c26A  [x.x.x] PUTATIVE ACETYLTRANSFERASE TA0821
    2e-07   7%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-06  20%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    4e-06  13%  3dnsB  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    5e-06  13%  3dnsA  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    6e-06   6%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    7e-06  14%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    9e-06  14%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    9e-06  16%  3ec4A  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    9e-06  15%  3e0kA  [x.x.x] AMINO-ACID ACETYLTRANSFERASE
    2e-05  18%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    2e-05   9%  3d8pA  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    3e-05  18%  2c27A  [x.x.x] MYCOTHIOL SYNTHASE
    3e-05  15%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    5e-05  14%  2b4bB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-05  13%  2b4dA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-05  13%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    7e-05   8%  3d8pB  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    7e-05  12%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-05  22%  3dr8A  [x.x.x] YNCA
    9e-05  10%  1b6bB  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    1e-04  13%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    1e-04  11%  2bueA  [x.x.x] AAC(6')-IB
    1e-04  14%  2b4bA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-04  17%  3dsbA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-04  16%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-04  14%  2b4dB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-04  12%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    3e-04  12%  2atrA  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    3e-04  12%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    6e-04  14%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-04  11%  3bj8B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    8e-04  17%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    0.001   9%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c26A           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
2cnmA           ----------------------------------------------------------------------
3dnsB           ----------------------------------------------------------------------
3dnsA           ----------------------------------------------------------------------
2a6aB           ----------------------------------------------------------------------
1cm0B           ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
3ec4A           ----------------------------------------------------------------------
3e0kA           ----------------------------------------------------------------------
3d2pA           ----------------------------------------------------------------------
3d8pA           ----------------------------------------------------------------------
2c27A           ----------------------------------------------------------------------
2ae6A           ----------------------------------------------------------------------
2b4bB           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
3d8pB           ----------------------------------------------------------------------
3eg7B           ----------------------------------------------------------------------
3dr8A           ----------------------------------------------------------------------
1b6bB           ----------------------------------------------------------------------
1bobA           ----------------------------------------------------------------------
2bueA           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
3dsbA           ----------------------------------------------------------------------
2b3uA           ----------------------------------------------------------------------
2b4dB           ----------------------------------------------------------------------
3eg7E           ----------------------------------------------------------------------
2atrA           ----------------------------------------------------------------------
3eg7A           ----------------------------------------------------------------------
3eg7F           ----------------------------------------------------------------------
3bj8B           ----------------------------------------------------------------------
2beiB           ----------------------------------------------------------------------
1cjwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIPRLQLNIEKLPPEFQIHSIDANLYDQCL
3c26A           ----------------------------------------------------------------------
3efaA           ----------------------------------------------------------------------
2cnmA           --------------------------------------------------------------WQIEQRAH
3dnsB           ----------------------------------------------------------------------
3dnsA           ----------------------------------------------------------------------
2a6aB           ----------------------------------------------------------------------
1cm0B           ----------------------------------------------------------------------
1cm0A           ----------------------------------------LNQKPNKKILMWLVGLQ------NVFSHQL
3ec4A           --------------------------------------------------------------VALGETDV
3e0kA           --------------------------------------------------------------LELIHPLE
3d2pA           ----------------------------------------------------------------------
3d8pA           ----------------------------------------------------------------------
2c27A           ----------------------------------------------------------------------
2ae6A           ----------------------------------------------------------------------
2b4bB           ----------------------------------------------------------------------
2b4dA           ----------------------------------------------------------------------
2b3vA           ----------------------------------------------------------------------
3d8pB           ----------------------------------------------------------------------
3eg7B           ----------------------------------------------------------------------
3dr8A           ----------------------------------------------------------------------
1b6bB           ----------------------------------------------------------------------
1bobA           ----------------------------------------------------------------------
2bueA           ----------------------------------------------------------------------
2b4bA           ----------------------------------------------------------------------
3dsbA           ----------------------------------------------IEIREARDDLTIAKFNYNLAKETE
2b3uA           ----------------------------------------------------------------------
2b4dB           ----------------------------------------------------------------------
3eg7E           ----------------------------------------------------------------------
2atrA           ----------------------------------------------------------------------
3eg7A           ----------------------------------------------------------------------
3eg7F           ----------------------------------------------------------------------
3bj8B           ----------------------------------------------------------------------
2beiB           --------------------------------------------------------------LRLIRELA
1cjwA           ----------------------------------------DAAGVEIEREAFISVSGNCPLNLDEVQHFL


                         +         .         .         .         .         *         .:210
query           QKEWSTDLVGNYSNYNEFKKLGLGYVIVNDQSIVAGASSFSSYQNGIEIEVATHPDFQRRGLATIACSQL
3c26A           ---------------------DGSVYVLRVSGRPVATIHEKLPDGSVLGGLRVHPEYRGSRLGSIQETIQ
3efaA           ------------------------AVLYLQPDLPITTLRLEPQADHVRFGVCTRKAYRGHGWGRQLLTAA
2cnmA           AFPWSEKTFFGNQGERYL-----NLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHL
3dnsB           -------LKGKYTKIEKVNGVEREYLITDKYGITIGRIFIVDLNKDNFCFRKIYKQGKSINTYIKEILSV
3dnsA           -------LKGKYTKIEKVNGVEREYLITDKYGITIGRIFIVDLNKDNFCFRKIYKQGKSINTYIKEILSV
2a6aB           --------------YDIPVAPLNSFETAKSCPADVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEE
1cm0B           ------------------------LALIKDGRVIICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHL
1cm0A           PRMPKEYITRLVFDPKHK------TLALIKDGRVIGGICFRMFPSQGFTECAVTSNEQVKGYGTHLMNHL
3ec4A           PETALALATEPGPWASGTWRYGQFYGVRIDGRLAAAGERRPAPNLAEVSGVCTWPEYRGRGLAARLIRKV
3e0kA           EQGILRRSREQLEQEIGK-----FTIIEKDGLIIGCAALYPYSEERKAEAVAIHPDYRDGNRGLLLLNYK
3d2pA           ------------------------SILEHDGNLYGCAAKTFAEADCGEIALAVSPQAQDGGYGERLL-AH
3d8pA           ---------------------GQFWLAINNHQNIVGTIGLIRLDNNSALKKFVDKGYRNLKIGKKLLDKV
2c27A           ----------------------------------HWTKVHPDHPGLGEVYLGVDPAAQRRGLGQMLTSIG
2ae6A           ------------------------FVAISGQQLAGFIESLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYI
2b4bB           --DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYDPWIYLEDFFVSDYRGFGIGSEILKNL
2b4dA           --DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYDPWIYLEDFFVSDYRGFGIGSEILKNL
2b3vA           --DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYDPWIYLEDFFVSDYRGFGIGSEILKNL
3d8pB           ---------------------GQFWLAINNHQNIVGTIGLIRLDNNSALKKFVDKGYRNLKIGKKLLDKV
3eg7B           ------------------------VVEDAQKNLIVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRA
3dr8A           ------------------------LVSEENGVVTGYASFGDWRSFDVEHSVYVHPAHQGKGLGRKLLSRL
1b6bB           ----------------------IGSLWDEERLTQESLALHRPRGHSAHLHLAVHRSFRQQGKGSVLLWRY
1bobA           --------------------------------TTYKYWHYIDKKFRAKISFLIFPPYQNKGHGSCLYEAI
2bueA           -----------------------------ALGSGDGWWEEETDPGVRGIDLLANASQLGKGLGTKLVRAL
2b4bA           --DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYDPWIYLEDFFVSDYRGFGIGSEILKNL
3dsbA           GKELDDVLTKGVKALLLDERKGKYHVYTVFDKVVAQIYSDWRNGNFLWIQVYVDKEYRRKGIFNYLFNYI
2b3uA           ------------------------HWTPEGHSIVGFAYYDPWIGKLLYLEDFFVSDYRGFGIGSEILKNL
2b4dB           --DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTYDPWIGLEDFFVSDYRGFGIGSEILKNL
3eg7E           ------------------------VVEDAQKNLIGLVEIEINYIHRSAEFIIIAPEHQGKGFARTLINRA
2atrA           ------------------------YLALDGDAVVGLIRLVGDGFSSVFVQLIVLPSYQRQGIGS-SLKEA
3eg7A           ------------------------VVEDAQKNLIGLVEIEINYIHRSAEFIIIAPEHQGKGFARTLINRA
3eg7F           ------------------------FVVEDAQKNLIGLVELIEINYIHRSAEIIAPEHQGKGFARTLINRA
3bj8B           --DLQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDLYLEDFFVMSDYRGFGIGSEILKNL
2beiB           EFEKLSDQVKISEEALRFGDNPFYHCLVAEICVVGYGIYYFIYSTTIYLEDIYVPEYRGQGIGSKIIKKV
1cjwA           TLCPELSLGWFVEG--RLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHLAVHRSFRQQGKGSVLLWRY


                         .         .         .         +         .         .         .:280
query           IITCLDQSLYPSWDAHTEISLHLAQKLGYQFAYKYLAYEIEx
3c26A           FLRGKTERLRSAVYSWNEPSLRLVHRLGFHQVEEYPIY----
3efaA           EEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGPYDEDGA-
2cnmA           IDELETRTLWLEVRASNAAAIALYESLGFN------------
3dnsB           FEFLFKSNDINKVNIIVEVSTQPFVELGFAF-----------
3dnsA           FEFLFKSNDINKVNIIVEVSTQPFVELGFAF-----------
2a6aB           LEEITKEKIVLKDDLLISPAVLVEESERLFEKKTIHYYEIE-
1cm0B           KEYHIKHDILNFLTYADEYAIGYFKKQGFS------------
1cm0A           KEYHIKHDILNFLTYADEYAIGYFKKQGFS------------
3ec4A           IAGAARGVPYLHSYASNASAIRLYESLGFRARRATATL----
3e0kA           H--RSKSENINQIFVLTTHSLHWFREQGFY------------
3d2pA           IIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPE---
3d8pA           ITCKEQNGIYLGTIDKFISAQYFYSNNGFR------------
2c27A           IVSLARPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL--
2ae6A           KDAEISGHKLSLRVATNQEAIRFYEKHGFVQEAHFKEE----
2b4bB           SQVARCRSSHFLVAEWNEPSINFYKRRGAS------------
2b4dA           SQVARCRCSHFLVAEWNEPSINFYKRRGAS------------
2b3vA           SQVARCRCSHFLVAEWNEPSINFYKRRGAS------------
3d8pB           ITCKEQNGIYLGTIDKFISAQYFYSNNGFREIKRGDLP----
3eg7B           LDYSFTILNLHKIYLHVPKAVHLYEECGFVEEGHLVEE----
3dr8A           IDEACGKHVVAGIESQNAASIRLHHSLGFT------------
1b6bB           LHHVGAQAVRRAVLMCEDALVPFYQRFGFH------------
1bobA           IQSWLEDITEITVEDPNEAFDDLRDRNDIQ------------
2bueA           VELLFNDPEVTKIQTDPLRAIRCYEKAGFE------------
2b4bA           SQVARCRSSHFLVAEWNEPSINFYKRRGASDLSGWRLFKID-
3dsbA           KNICDKDVGRLYVEKENINAKATYESLNYECDYNYEYEVI--
2b3uA           SQVARCRSSHFLVAEWNEPSINFYKRRGAS------------
2b4dB           SQVARCRSSHFLVAEWNEPSINFYKRRGAS------------
3eg7E           LDYSFTIKIYLHVAVENPKAVHLYEECGFVEEGHLVEE----
2atrA           LGNFKEAYQVQLATEETE-KNVGFYRSGFE------------
3eg7A           LDYSFTILNLHKIYLHVPKAVHLYEECGFVEEGHLVEE----
3eg7F           LDYSFTILNLHKIYLHVPKAVHLYEECGFV------------
3bj8B           SQVAMKCSMHFLVAEWNEPSINFYKRRGASLGWRLFKIDKE-
2beiB           AEVALDKQFRLAVLDWNQ-RADLYKALGAQ------------
1cjwA           LHHVGAQPVRRAVLMCEDALVPFYQRFGFHPAGPCAIVV---