[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99739.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2aqvB.bssp"
#ERROR : Can't open dsspfile "2aqvA.bssp"
#ERROR : Can't open dsspfile "3be7C.bssp"
#ERROR : Can't open dsspfile "2aqoA.bssp"
#ERROR : Can't open dsspfile "3egjB.bssp"
#ERROR : Can't open dsspfile "2aqoB.bssp"
#ERROR : Can't open dsspfile "3be7B.bssp"
#ERROR : Can't open dsspfile "1a5kC.bssp"
#ERROR : Can't open dsspfile "3be7A.bssp"
#ERROR : Can't open dsspfile "3dugC.bssp"
#ERROR : Can't open dsspfile "1ejxC.bssp"
#ERROR : Can't open dsspfile "3dugA.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"
#ERROR : Can't open dsspfile "1ejwC.bssp"
#ERROR : Can't open dsspfile "1ejrC.bssp"
#ERROR : Can't open dsspfile "3egjA.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "1a5nC.bssp"
#ERROR : Can't open dsspfile "1ejsC.bssp"
#ERROR : Can't open dsspfile "3e0lA.bssp"
#ERROR : Can't open dsspfile "1ejtC.bssp"
#ERROR : Can't open dsspfile "1ejuC.bssp"
#ERROR : Can't open dsspfile "1a5mC.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "1a5lC.bssp"
#ERROR : Can't open dsspfile "1e9zB.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "3dc8B.bssp"
#ERROR : Can't open dsspfile "3dc8A.bssp"
#ERROR : Can't open dsspfile "2eg6B.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "3e3hA.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"
#ERROR : Can't open dsspfile "2anuF.bssp"
#ERROR : Can't open dsspfile "2dvtD.bssp"
#ERROR : Can't open dsspfile "2anuB.bssp"
#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "1cr5A.bssp"
#ERROR : Can't open dsspfile "2anuD.bssp"
#ERROR : Can't open dsspfile "3cdkA.bssp"
#ERROR : Can't open dsspfile "2amxB.bssp"
#ERROR : Can't open dsspfile "3c86A.bssp"
#ERROR : Can't open dsspfile "2d2gA.bssp"
#ERROR : Can't open dsspfile "3cjpA.bssp"
#ERROR : Can't open dsspfile "2dvtA.bssp"
#ERROR : Can't open dsspfile "1cr5B.bssp"
#ERROR : Can't open dsspfile "2dvtC.bssp"
#ERROR : Can't open dsspfile "2amxA.bssp"
#ERROR : Can't open dsspfile "3cdkC.bssp"

## Summary of PDB Search
:578
    2e-31  13%  2aqvB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-28  12%  2aqvA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-27  15%  3be7C  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-27  12%  2aqoA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-27  14%  3egjB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    8e-26  12%  2aqoB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-25  16%  3be7B  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-25  22%  1a5kC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    8e-25  15%  3be7A  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    1e-24  16%  3dugC  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    1e-24  22%  1ejxC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    5e-24  16%  3dugA  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-24  17%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    7e-24  20%  1ejwC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    9e-24  21%  1ejrC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    1e-23  15%  3egjA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-22  16%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE
    3e-22  21%  1a5nC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    6e-22  22%  1ejsC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    7e-22  11%  3e0lA  [x.x.x] GUANINE DEAMINASE
    1e-21  21%  1ejtC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    1e-21  19%  1ejuC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    4e-21  22%  1a5mC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    7e-21  22%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    8e-21  17%  3e74A  [x.x.x] ALLANTOINASE
    2e-20  22%  1a5lC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    6e-19  18%  1e9zB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    2e-18  14%  3e74C  [x.x.x] ALLANTOINASE
    2e-18  15%  3e74B  [x.x.x] ALLANTOINASE
    6e-17  17%  3d6nA  [x.x.x] DIHYDROOROTASE
    9e-17  23%  3dc8B  [x.x.x] DIHYDROPYRIMIDINASE
    2e-15  20%  3dc8A  [x.x.x] DIHYDROPYRIMIDINASE
    7e-14  12%  2eg6B  [x.x.x] DIHYDROOROTASE
    1e-13  12%  1a4mA  [c.1.9] ADENOSINE DEAMINASE
    3e-11  12%  3e3hA  [x.x.x] PARATHION HYDROLASE
    4e-11  15%  1bf6A  [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
    2e-09   9%  2anuF  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    3e-09   8%  2dvtD  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    8e-09   9%  2anuB  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    1e-08   8%  2a3lA  [x.x.x] AMP DEAMINASE
    1e-08  10%  1cr5A  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    1e-08  10%  2anuD  [x.x.x] HYPOTHETICAL PROTEIN TM0559
    1e-07  11%  3cdkA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-07  11%  2amxB  [x.x.x] ADENOSINE DEAMINASE
    1e-07  10%  3c86A  [x.x.x] PHOSPHOTRIESTERASE
    4e-07  13%  2d2gA  [x.x.x] PHOSPHOTRIESTERASE
    3e-06  14%  3cjpA  [x.x.x] PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY
    9e-06   9%  2dvtA  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    2e-05  12%  1cr5B  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    3e-05  11%  2dvtC  [x.x.x] THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE
    5e-04   5%  2amxA  [x.x.x] ADENOSINE DEAMINASE
    6e-04  12%  3cdkC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
:578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKQKLIKLIDVAAGRKKADLVLKNAKIVDVFQAKILTGDIAISDGYIAGIGGSYQGVVECNYTGKYVAP
2aqvB           -----------MIDYTAAGFTLLQGAHLYA--PEDRGICDVLVANGKIIAVADIVPNCTVVDLSGQILCP
2aqvA           -----------MIDYTAAGFTLLQGAHLYA--PEDRGICDVLVANGKIIAVAVPNCTVVDLSG--QILCP
3be7C           -------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
2aqoA           -----------MIDYTAAGFTLLQGAHLYAP--EDRGICDVLVANGKIIAVADIVPNCTVVDLSGQILCP
3egjB           ------------------AMYALTNCKIYTGNDV-LVKHAVIINGDKIEAVCPIPSEMNVVDLNGANLSP
2aqoB           -----------MIDYTAAGFTLLQGAHLYA--PEDRGICDVLVANGKIIAVADIVPNCTVVDLSGQILCP
3be7B           -------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
1a5kC           ------------------VDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
3be7A           ------------------EDFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
3dugC           -------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
1ejxC           ------------------VDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGAATEVIAAEGKIVTA
3dugA           -------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGINTKDATVISIPDLILIP
1e9yB           ----------SNNPSKEELDLIITNALIVDY--TGIYKADIGIKDGKIAGIGSVGPATEALAGEGLIVTA
1ejwC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
1ejrC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
3egjA           ------------------AMYALTNCKIYTGNDV-LVKHAVIINGDKIEAVCPIPSEMNVVDLNGANLSP
2bb0A           ---------------KQIDTILINIGQLLTMESSGPRAGVVGIHEQKIVFAGAGYEADEIIDCSGRLVTP
1a5nC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
1ejsC           ------------MLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
3e0lA           ------------------LAHIFRGTFVHSTWTCPRDHLLGVSDSGKIVFLEEAKPCEIRELSHHEFFMP
1ejtC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
1ejuC           ------------------VDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
1a5mC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
1a5oC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGPIGAATEVIAAEGKIVTA
3e74A           ------------------FDLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQDLGDAKEVDASGLVVSP
1a5lC           -----------QMLAADCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGAATEVIAAEGKIVTA
1e9zB           -------------PSKEELDLIITNALIVDYT--GIYKADIGIKDGKIAGIGSVGPATEALAGEGLIVTA
3e74C           ------------------FDLIIKNGTVILE--NEARVVDIAVKGGKIAAIG-QDLGDAKEVDASGLVVS
3e74B           ------------------FDLIIKNGTVIL--ENEARVVDIAVKGGKIAAI-GQDLGDAKEVDASGLVVS
3d6nA           -------------------KLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDILVPEAEIIDAKGLIVCP
3dc8B           --------------------TVIKGGTIVT--ADLTYKADVKVEGGRIVEIGPNLSGAETLDATGCYVMP
3dc8A           --------------------TVIKGGTIVT--ADLTYKADVKVEGGRIVEIGPNLSGAETLDATGCYVMP
2eg6B           ---------------------------------------------------------------SQVLKIR
1a4mA           ---------------------PAFNKPKVELLDGAIKPETILYFGKKRGIALPAEELRNIIGMDKPLSLP
3e3hA           ----------------------------------------------------GTGDRINTVRGPITISEA
1bf6A           ---------------------------------------------------------------------Y
2anuF           ---------------------------------------------------------------------W
2dvtD           ---------------------------------------------------------------------Q
2anuB           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
1cr5A           ------------VSNCPNNSYALANVAAVSPNDF-PNNIYIIIDNLFVFTTR--------HSNDIPPGTI
2anuD           ----------------------------------------------------------------------
3cdkA           ----------------------------------------------------------------------
2amxB           --------------------------------------EIKFLKKEDVQNID-LNGMSKKERYEIWRRIP
3c86A           --------------------------------------------------------LINTVRGPIPVSEA
2d2gA           ---------------------------------------------------------TVRG--PIPVSEA
3cjpA           ----------------------------------------------------------------------
2dvtA           ---------------------------------------------------------------------Q
1cr5B           TRTRHLK-----VSNCPNNSYALANVAAVS--PNDFPNNIIIIDNLFVFTTR-----------HSNDIPP
2dvtC           ---------------------------------------------------------------------Q
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GFIEAHIHIESSYVSPEEFSRVFIPRGTTTILADPHEIVNVAGLKGLDYMVNAAKNAKMDIRYMMPPCVP
2aqvB           GFIDQHVHLGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHV
2aqvA           GFIDQHVHLIGGGGTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHV
3be7C           GLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVING
2aqoA           GFIDQHVHLGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHV
3egjB           GFIDLQLNGCGGVMFNDEIHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSLGEGPDDTM
2aqoB           GFIDQHVHLIGGGGQAGPTTRTPTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAYHV
3be7B           GLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMVSVRDAIERGHCDHNLLPPEFNYSSEGVVD
1a5kC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
3be7A           GLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVING
3dugC           GLMDSHVHIVGNDSKGEESSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVINGPTML
1ejxC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
3dugA           GLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVRDAIERGVING
1e9yB           GGIDTHIHFISPQQIPTAFGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNAS
1ejwC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNAG
1ejrC           GGIDTHIHWICPQQAEEALVS-----GVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
3egjA           GFIDLQLNGCGGVMFNDEITAANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKIHSVDFIRPSDDTM
2bb0A           GLVDPHTHLVFGGSREKEMLQRMLSYGTTTAEKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHA
1a5nC           GGIDTHIHWICPQQAEEALVS-----GVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
1ejsC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
3e0lA           GLVDTHIHASQYSFAGSSIDLLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSL
1ejtC           GGIDTHIHWICPQQAEEALVS-----GVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
1ejuC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
1a5mC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
1a5oC           GGIDTHIHWICPQQAEEALVS-----GVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS
3e74A           GVDAHTHIGYETGTRA-------AAKGGITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVS
1a5lC           GGIDTHIHWICPQQAEEALV-----SGVTTMVAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGNVSQP
1e9zB           GGIDTHIHFISPQQTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNAS
3e74C           PGVDAHTHIYETG-------TRAAAKGGITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVS
3e74B           PGVDAHTHISHWETVDRASIELKFDAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFCFVRDVNDWQ
3d6nA           GFIDIHVHLRDPGQTYKEGSRCAVAGGFTTIVCMPNTNPPIDNTTVVNYILQKSKSVGLCRVLPTGTITK
3dc8B           GGIDPHTHLEMPFMGTYSSDDFESLAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMAITWW
3dc8A           GGIDPHTHLEMPFMGTYSSDD--FESGTRAALAGGTTMVVDFALPSGQSL-LEALTMWDNKSTRANCDYS
2eg6B           RPDDWHLHLRDGDMLKTVVP--YTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAGHDFTPLMTC
1a4mA           GFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQE
3e3hA           GFTLTHEHICGSSAGFLRAWPEFFGSRKALAVRTIVDVSTFDIGRDVSLLAEVSRAAHIVAATGLWFDPP
1bf6A           TLAHEHLHIDLSGFKNCQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFP
2anuF           LLCDFHVHTNSDHLPLGEVVDLFGKHGVDVVSITDH-----IVDRRTLEQRKRNGEPLGAITEDKFQDYL
2dvtD           GKVALEEHFAIPETLQDSVPGDYWKELQHRLLDIQDTRLKLMDAHGIETMILRRANDVLAEECAKRPDRA
2anuB           -LCDFHVHTNSDHLPLGEVVDLFGKHGVDVVSITDH-----IVDRRTLEQRKRNGEPLGAITEDKFQDYL
2a3lA           ----------------------------------------------------------------------
1cr5A           GFNGNQRTWGGWSLNQDVQFDLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYESQI--------
2anuD           -LCDFHVHTNSDHLPLGEVVDLFGKHGVDVVSITDH-----IVDRRTLEQRKRNGEPLGAITEDKFQDYL
3cdkA           ----------------------------------------------------------------------
2amxB           K-VELHCHLDLTFSAEFRKYNLQPNMSDDEILDHYLFTKEGKSLAEFDLAKWAVIEKYKEFRYSPTFVSS
3c86A           GFTLTHEHIKALAEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAADVHI-VAATGLWFDPPL
2d2gA           GFTLTHEHIKALAEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAADVHAATGLWFDPPLSMR
3cjpA           -IIDGHTHVIL---PVEKHIKIMDEAGVDKTILFSTSIHPETAVNLRDVKKEMKKLNDVNGKTNSMIDVR
2dvtA           GKVALEEHFDSAGFVPGDYWKELQHRGIETMILSLAVQAIPDRRKAIEIARRANDVLAEECAKRPDRFLA
1cr5B           GTIGFNGNQTWGGWSLNKAFDLFKYSGKQSYLGDISFRADQDELAKQFVRCYESQIFSPTQYLIMEFQGH
2dvtC           GKVALEEHFAIPETLQDSVPGDYWKELQHRLLDIQDTRLKLMDAHGIETMILSLNAPAVQKAIEIARRAN
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATNFETSGADLYADDMEDALKTGEVDGLAELMNFPGVINADDKMIDEILMAKKYGARIDGHAPQVVGKDL
2aqvB           PSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHYDLLENCDV
2aqvA           PSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMLLENCDVP
3be7C           PTMLVSGPHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIKFVDEAHNHGMKVAAHAHGLIGIKA
2aqoA           PSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDLENCDV
3egjB           IDTICANSDVIAKVTLAPENNKPEHIEKLVKAGIVVSIGHTNATYSEARKSFESGITFATHLVGAIYDTP
2aqoB           PSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKQPI
3be7B           SPWEARKMVRKNRKYGADLIKFCATGGVMSRNTDVNAKQFTLEEMKAIVEAHNHGMKVAAHAHGLIGIKA
1a5kC           QPDALREQVAAGVIGLEIHEDWGCALTVADEMDIQVALHSDTGFVEDTLAAIGGRTIHGGHAPDIITACA
3be7A           PTMLVSGPALGITGGHCDHNLLPPEFNYSSEGVVDSPQFTLEEMKAIVDEAHNHGMKVAAHAHGLIGIKA
3dugC           VSGPALGITGGHCDHNLLPPEFNYSSEVVDSPWEARKMVRKNRKYGADLIAHNHGMKVAAHAHGLIGIKA
1ejxC           QPDALREQVAAGVIGLIHEDWGATPAAIDCALTVLHSDTLNESGFVEDTLAAIGGRTIHTFAPDIITACA
3dugA           PTALGITGGHCDHNLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIFAHNHGMKVAAHAHGLIGIKA
1e9yB           NDASLADQIEAGAIGFIHEDWGTTPSAINHALDVADKYTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGH
1ejwC           VIGLIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHGHAPDIITACA
1ejrC           QPDALREQVAAGVIGLIHEAWGATPAAIDCALTVADEMDESGFVEDTLAAGGRTIHTFHGHAPDIITACA
3egjA           IDTICANSDVIAKVTLAPENNKPEHIEKLVKAGIVVSIGHTNATYSEARKSFESGITFATHPGVVGAIYD
2bb0A           IPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTGVFTVSQSRRYLQKAAEAGFGLKIHADPLGGAEL
1a5nC           QPDALREQVAAGVIGLAIHEDWGATPAVADEMDIQVALHSDTLNEVEDTLAAIGGRTI--HTFHTEGAGI
1ejsC           QPDALREQVAAGVIGLINEDWGATPAAIDCALTHSDTLNESGFVEDTLARTIHTFHTEGGHAPDIITACA
3e0lA           LLADITDKFGQYKETTEESIKETE-RFVSEMLQKNYSRVVSETLMGELGIAKTRDLHIQSHINRDEVEAV
1ejtC           QPDALREQVAAGVIGLIQEDWGATPAAIDCALTVADEMDVEDTLAAIGGRTIHTFHTEGGHAPDIITACA
1ejuC           QPDALREQVAAGVIGLIHEDWGATPAAIDCALLHSDTLNESGFVEDTLAIGGRTIHTFHTEGAGGGHAPI
1a5mC           QREQVAAGVIGLAIHEDWGATPAAIDCALTVADEMDSGFVEDTLAAIGGRTIHTFHTEGGHAPDIITACA
1a5oC           QPDALREQVAAGVIGLCIHEDWGCALTVADEMDIQVALHSDTGFVEDTLAAIGTFHTEGGHAPDIITACA
3e74A           YNIDRLHEGFCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKAHDYVASRPVFTEVEAI
1a5lC           DALREQVAAGVIGDWGATPAAIDCALTVADEMDIQVALHSDTLNEVEDTLAAIGGRTIHTFHTE----GA
1e9zB           NDASLADQIEAGAIGFIHEDWGTTPSAINHALDVADKYDLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGH
3e74C           YNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEVASRPVFTEVEAI
3e74B           FFKGAQKLGELGQPVLVHCENALICDELGEEAKREGRVTAVEAIRRVLYLAKVAGCRLHVCHVSTRARQE
3d6nA           GRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGVPGILAQRTGGHVHIQHVSEFFKEK
3dc8B           GEQVF--------NEMETIVKDKGINTFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHAE-------
3dc8A           FHMAITWWGEQVFNEMETIVKDKGINTFHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHAENGDVVAQ
2eg6B           YLTDSLDPNELERHGVTSVDAIMPVLERMEKIGMPLLVHGEVTHADEPLRQRLTALKVVFEHITTKDRDG
1a4mA           GEQAFGIKVRSILCCMRHQPSWSLVVAMDLAGDETIEGSSLFPGHVEAYGAVKNGIHRTVHAGEVGSEAV
3e3hA           LSMRLRSVEELTQREIQYGIEDTGIRAGIIVATTGKATPFQELVLKAAAASLATGVPVTTHTAASQRDGE
1bf6A           EHVATRSVQELAQEMVDEIEQGLKAGIIAEIGSEGKITPLEEKVFIAAALHNQTGRPISTHTSFSTMGLE
2anuF           KRLWREQKGILIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEEIVEKLKEQNALVIAAHPDRKHLSWYL-
2dvtD           FAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQEGDGQTPLYYDLWGEVEKLDVPFYLHPRNQDSRIY
2anuB           KRLWREQKRAWEEYGI--LIPGVEITNNTDLYHIVAVDVKEYVDPSLPVEKEQNALVIAAHPDRKWYLWA
2a3lA           -------------------------------------------VLNKLREKGMTTITLRPHSGEAGDIDH
1cr5A           ----------------------------------------------------------------------
2anuD           KRLWREQKRAWEYGILIPGVEITNNTDLYHIVDVKEYVDPSLPVEEIVEKLKEQNAVIAAHPDRKWYLWA
3cdkA           ----------------------------------------------------------------------
2amxB           SYLLNNKIHVALICISDKHSGDFAIKHKHDFVGFDHGGREIDLKDHKDVYVRDHGLHLTVHAGEDATLPN
3c86A           SMRMRSELTQFFLREIQHGIEDTGIRAGIIVATTGKATPFQELVLKAAAASLATGVPVTTHSQRDGEQQA
2d2gA           MRSVEELTQFFLREIQHGIEDTGIRAGIIKVATTGKATPFQELVLKAAARSLATGVPVTTHTSAIFESEG
3cjpA           RNSIKGLSENDTNSYIEENIVNNKLVGIGELTPASG---QIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQ
2dvtA           FAALPLQDPDAATEELQRCVNDLGFVGFSQEGDGQTPLYYDLPQYRPFWEVEKLDVPFYLHPLPQDSRIY
1cr5B           FFDLKIRNVQA-----------------------------------------------------------
2dvtC           DVLAEECAKDAATEELQRCVNDLGFVGALVNGFSQEGDGQTPLYYDLWGEVEKLDVPFYLHPPQDSRIYD
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NAYIAAGPANDHECSTLEEAEERLARGMYLLLREGSVTQDLRKLLPIVNTANSRRCLLSGDDVQAKTAIN
2aqvB           PISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAIARAVQAGIPLARVTLSSDGNGSVAGF
2aqvA           ISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAG
3be7C           AIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGIREESLNKERLVGKKQTFGTDAGIFD
2aqoA           PISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAQAGIPLARVTLSSDGNGSVAG
3egjB           EVYAGIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDENGTLGGS
2aqoB           YDLLENCPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSS
3be7B           AIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILKAGIREESLNKERLVGKKQTFGTDAGIFD
1a5kC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDV--AFAESRIRRETIAAEDSSDSQAMGRVG
3be7A           AIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILKAGIREESLNKERLVGKKQTFGTDAGIFD
3dugC           AIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILKAGIREESLNKERLVGKKQRENFMNGIFD
1ejxC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCVAFAESAEDVLHDLGAFSSQAMGRVGEVILRTWQVAHRMK
3dugA           AIKAGVDSVEHASFIDDETIDMAIKNNTVLYILGEGAKAGIREESLNKQRENFMNAHRRGAIITFGTDAG
1e9yB           APDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHKDKSIKESQAMGRVGEVITRTWQTADKNK
1ejwC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVDVLHDLTSSDSQAMGRVGEVILRTWQVAH
1ejrC           HPNILPSSTNPTLPYTLNTIDEHLDMLMAFAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMK
3egjA           TPEVYAGIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDENGTLG
2bb0A           AGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSATDFNPGSSPT
1a5nC           TACAHPNILPSSTNPTLPYTLNTIDEHLDMAFAESRIRRETIAAEDVLHDLGAFSLTSSDRTWQVAHRMK
1ejsC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVDVLHDSDSQAMGRVGEVILRTWQVAHRMK
3e0lA           KNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGSMLDAIRRAV
1ejtC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVDVLHDSDSQAMGRVGEVILRTWQVAHRMK
1ejuC           TACAHPNILPSSTNPTLPYTLNTIDRRETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMK
1a5mC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAHDLGAFSLTSSDSQAMGRVGEVRTWQVAHRMK
1a5oC           HPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVDVLHDSDSQAMGRVGEVILRTWQVAHRMK
3e74A           RAKVAGCRLHVCHVSSPEGVEEVTRARPHYFVLDTDQFEEIGKCSPPIRDLENQKGWEPEKAGNIKAWGG
1a5lC           GGGHAPDIITACAHPNILPSSTNPTLPYTLNTREEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHR
1e9zB           APDIIKVHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKADSRIRPQTIAAEDTLHDSSDSQAMGRVG
3e74C           RRVLYLAKSSPEGVEEVTRARQEGQDITHYFVLDTDQFEEIGTLAKCSPPIRDLENLFNGEIDNIKAWGG
3e74B           GQDITCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGWEKLFIDCLVSDHSPCPPEKAGNIKAWGG
3d6nA           GVKITCEVNPNHLLFTEREVLNSGANAVNPPLRKKEDRLALIEGVATDHAPHQTFEKELVEFAMPGIIGL
3dc8B           ----------------------------------------------------------------------
3dc8A           LQAKLNSGPEAHAYSRPAEVEGEAANRAIMI---------------------------------------
2eg6B           NERLAATITPQHLMFNRNHMLVGGVRPHLYCLPI-LKRNIHQQALRELVASGFNRVFLGTDSAPCAGCFN
1a4mA           DILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAV-VRFKNDKANYSLNTLIF
3e3hA           QQAAIFESEGLSPSDDLSYLTALAARGYLIGLDRIPDNASASALLGIRSWQTRALLILVSNDWLFGFSSY
1bf6A           QLALLQAHGVDDLKDNLDNILKMIDLGAYVKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKA
2anuF           WANERFKDTFDAWEIANRDDLFNSVGVKKYRYVANSDFHELWHVYSWKTLVKSEKNIE-----AIKEAIR
2dvtD           DGHPWLLGPTWAFAQETAVHALRLMAS-------------------------------------------
2anuB           NERFKDTFDAWEIANRDDLFNSVGVKKYRY----------------------------------------
2a3lA           TFLTCHSIAHGINLRKSPVLQYLYYLQIGLAMSPLSNNSLFLDYHPFPVFFLRGLNVSLSTDDPLQIHLT
1cr5A           ----------------------------------------------------------------------
2anuD           NERFKDTFDAWEIANRDDLFNSVGVKKYRY-----VANSDFHELWHVYSWKTLVKSEKNIEAI--KEAIR
3cdkA           -------------LSSSKEAAKLIHDGDTLIAGGFGLCGIPEQLILSIRDQGVKDLTVGVDDWGLGLLLA
2amxB           TLYTAINILNVERIGSESDELIELVKKKDILLEVCPISNLLLNNVKSMDTHPIRKLYDAGVKVSVNSGMF
3c86A           AIFESEGLSPSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGLEGNASALALFGTRSWQTRALLIKALIDR
2d2gA           LSPSRVCIGHSDDTDDLSYLTGLAARGYLVTRSWQTRALLIKALIYKDRILGFSSYVTNIMDVMDRINPD
3cjpA           DIKEIAELCKAFPGSNWMTAVELAKEIQNLYL--DTSAYFSTFVLKIVINELPLKCIFGTDM-------P
2dvtA           DGHPWLLGPTWAFAQETAVHALRLMASDEHPRLNIILGHMGEGLPYMMWRIDHRNAWVKLPPRYPAKRRF
1cr5B           ----------------------------------------------------------------------
2dvtC           GHPWLLGPTWAFAQETAVHALRLMASGL------------------------------------------
2amxA           ----------------------------------------------------------------------
3cdkC           -------------LSSSKEAAKLIHDGDTLIAGGFGLCGIPEQLILSIRDQGVKDNNCGVDDWGLGLLLA


                         .         *         .         .         .         .         +:350
query           KGHLDNSIRICIDEGLNPITAIQMATLNPAEYCGLNDRGAIAPGRRADMVVFESLEDFAVEETYILGEKL
2aqvB           ETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT--PELRIEQVYARGKLM
2aqvA           FETLLETVQVLVKDYFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT--PELRIEQVYARGKLM
3be7C           HGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIGQIKEGFDADIVGVIPLANIRVAFVMKEGK--
2aqoA           FETLLETVQVLVKDYDFSIDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT--PELRIEQVYARGKLM
3egjB           ALTMIEAVQNTVEHVGIALEALRMATLYPAKAIGVDEKGRIKKGMIANLTVFD--RDFNVKATVVNGQ--
2aqoB           DGNGSVAQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMT--PELRIEQVYARGKLM
3be7B           HGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIGQIKEGFDADIVGVIPLANIRVAFVMKEGK--
1a5kC           EQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVWS--PAFFGVKPATVIKGG
3be7A           HGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIGQIKEGFDADIVGLANIRTLEVAFVMKEGK--
3dugC           HGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIGQIKEGFDADIVGVIPLANIRVAFVMKEGK--
1ejxC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHVGSIEVGKLADLVVW------------------
3dugA           IFDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIENIGQIKEGFDADIVGVIPLANIRVAFVMKEGK--
1e9yB           KEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYGSVEVGKVADLVLWPAFFGVKPNMIIKGGFIA
1ejwC           RQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVW------------------
1ejrC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVW------------------
3egjA           LTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKGRIKKGMIANLTVFD--RDFNVKATVVNGQ--
2bb0A           ENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEGQLKAGRSADLVIWYHYGVNHVHQVMKNGTIV
1a5nC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVW------------------
1ejsC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVW------------------
3e0lA           MVSNILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEGNFEVGKEFDAILIN--PKASDSPIDLFYGDF
1ejtC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVW------------------
1ejuC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVWSAFFGVKPATVIKGGMIA
1a5mC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHVGSIEVGKLADLVVW------------------
1a5oC           VQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEGSIEVGKLADLVVWSPAFFGVKPA--------
3e74A           IAGLQSCDVFDEAVQKRGSLPFGKLATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVLTNDDLEY---
1a5lC           MKRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHVGSIEVGKLADLVVWSPAFFGVKPATVIKG---
1e9zB           EVFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEVGSVEVGKVADLVLW------------------
3e74C           IAGLQSCDVFDEAVQKRGSLPFGKLATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVLTNDDLEY---
3e74B           IAGLQSCDVFDEAVQKRGSLPFGKLATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVLTNDDLEY---
3d6nA           QTALPSALELYRKGIISLKKLIEMFTINPARIIG-VDLGTLKLGSPADITIFDPNKEWILNEETNLS---
3dc8B           ----------VATGRITMNEFVAVTSTNIAKILNIYPKGAILVGADADLVVWD-----------------
3dc8A           --------YGVATGRITMNEFVAVTSTNIAKILNIYPKGAILVGADADLVVWD-----------------
2eg6B           APTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLVNDTFIELVREEQQVAESIA---------------
1a4mA           KSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFL-----------------------------------
3e3hA           VTNIMDVIPFLREKGVPQETLAGITVTNPARFLSPTLRAS------------------------------
1bf6A           NGLLTTFIPQLRQSGFSQADVDVMLRENPSQ---------------------------------------
2anuF           KNTDVAIYL-------------------------------------------------------------
2dvtD           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2a3lA           KEPLVEEYSIAASVWKLSACDLCEIARNSVYQSGFHALKSHWIGKDYYKRGPDG--NDIHKTNVPHIRVE
1cr5A           ----------------------------------------------------------------------
2anuD           KNT-------------------------------------------------------------------
3cdkA           NKQIKKMIASYVGENKIFERQFLSGELEVELVPQGTLAERIRAGGAGIPGFYTATGVGT-----------
2amxB           LSNINDNYEKLYIHLNFTLEEFMIMNNWAFEKSFVSDDKSELKAL-------------------------
3c86A           GYKPLRVIPFLREKGVPPETLAGVTVANPARFLSP-----------------------------------
2d2gA           GMAPLRVIPFLREKGVPPETLAGVTVANPARFLSP-----------------------------------
3cjpA           FGDLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI-----------------------------------
2dvtA           MDYFNENFHITTSGNFRTQTLIDAILEIGADRILFSDWPFENIDHASDWFNAIAEADRV-----------
1cr5B           ----------------------------------------------------------------------
2dvtC           ----------------------------------------------------------------------
2amxA           --NINDNYEKLYIHLNFTLEEFMIMNNWAFEKSFVSDDKSELKAL-------------------------
3cdkC           NKQIKKMIASYVGENKIFERQFLSGELEVELVPQGTLAERIRAGGAGIPGFY------------------


                         .         .         .         .         *         .         .:420
query           SQGNEYLGEVNYYPIDSVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2aqvB           VKDGKACVK-------------------------------------------------------------
2aqvA           VKDGKACVK-------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
2aqoA           VKDGKACVK-------------------------------------------------------------
3egjB           ----------------------------------------------------------------------
2aqoB           VKDGKACVK-------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
1a5kC           MIAIAPMGDINASIPTPQ----------------------------------------------------
3be7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
1ejxC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
1e9yB           LSQ-------------------------------------------------------------------
1ejwC           ----------------------------------------------------------------------
1ejrC           ----------------------------------------------------------------------
3egjA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1a5nC           ----------------------------------------------------------------------
1ejsC           ----------------------------------------------------------------------
3e0lA           ----------------------------------------------------------------------
1ejtC           ----------------------------------------------------------------------
1ejuC           I---------------------------------------------------------------------
1a5mC           ----------------------------------------------------------------------
1a5oC           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
1a5lC           ----------------------------------------------------------------------
1e9zB           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
2eg6B           ----------------------------------------------------------------------
1a4mA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2dvtD           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2a3lA           FRDTIWKEEMQQ----------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3cdkA           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2dvtA           ----------------------------------------------------------------------
1cr5B           ----------------------------------------------------------------------
2dvtC           ----------------------------------------------------------------------
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2aqvB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
3egjB           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
1a5kC           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
1ejxC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------
1ejwC           ----------------------------------------------------------------------
1ejrC           ----------------------------------------------------------------------
3egjA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1a5nC           ----------------------------------------------------------------------
1ejsC           ----------------------------------------------------------------------
3e0lA           ----------------------------------------------------------------------
1ejtC           ----------------------------------------------------------------------
1ejuC           ----------------------------------------------------------------------
1a5mC           ----------------------------------------------------------------------
1a5oC           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
1a5lC           ----------------------------------------------------------------------
1e9zB           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
2eg6B           ----------------------------------------------------------------------
1a4mA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2dvtD           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3cdkA           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2dvtA           ----------------------------------------------------------------------
1cr5B           ----------------------------------------------------------------------
2dvtC           ----------------------------------------------------------------------
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2aqvB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
3egjB           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
1a5kC           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
1ejxC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------
1ejwC           ----------------------------------------------------------------------
1ejrC           ----------------------------------------------------------------------
3egjA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1a5nC           ----------------------------------------------------------------------
1ejsC           ----------------------------------------------------------------------
3e0lA           ----------------------------------------------------------------------
1ejtC           ----------------------------------------------------------------------
1ejuC           ----------------------------------------------------------------------
1a5mC           ----------------------------------------------------------------------
1a5oC           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
1a5lC           ----------------------------------------------------------------------
1e9zB           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
2eg6B           ----------------------------------------------------------------------
1a4mA           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
2anuF           ----------------------------------------------------------------------
2dvtD           ----------------------------------------------------------------------
2anuB           ----------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2anuD           ----------------------------------------------------------------------
3cdkA           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
3cjpA           ----------------------------------------------------------------------
2dvtA           ----------------------------------------------------------------------
1cr5B           ----------------------------------------------------------------------
2dvtC           ----------------------------------------------------------------------
2amxA           ----------------------------------------------------------------------
3cdkC           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxx
2aqvB           ------------------
2aqvA           ------------------
3be7C           ------------------
2aqoA           ------------------
3egjB           ------------------
2aqoB           ------------------
3be7B           ------------------
1a5kC           ------------------
3be7A           ------------------
3dugC           ------------------
1ejxC           ------------------
3dugA           ------------------
1e9yB           ------------------
1ejwC           ------------------
1ejrC           ------------------
3egjA           ------------------
2bb0A           ------------------
1a5nC           ------------------
1ejsC           ------------------
3e0lA           ------------------
1ejtC           ------------------
1ejuC           ------------------
1a5mC           ------------------
1a5oC           ------------------
3e74A           ------------------
1a5lC           ------------------
1e9zB           ------------------
3e74C           ------------------
3e74B           ------------------
3d6nA           ------------------
3dc8B           ------------------
3dc8A           ------------------
2eg6B           ------------------
1a4mA           ------------------
3e3hA           ------------------
1bf6A           ------------------
2anuF           ------------------
2dvtD           ------------------
2anuB           ------------------
2a3lA           ------------------
1cr5A           ------------------
2anuD           ------------------
3cdkA           ------------------
2amxB           ------------------
3c86A           ------------------
2d2gA           ------------------
3cjpA           ------------------
2dvtA           ------------------
1cr5B           ------------------
2dvtC           ------------------
2amxA           ------------------
3cdkC           ------------------