[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99766.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bboT.bssp"

## Summary of PDB Search
:102
    1e-29  34%  3bboT  [x.x.x] RIBOSOMAL PROTEIN L21
:102

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYAIIKTGGKQLKVEAGQTIYVEKLDAKEGDKVTFDKVVFVGGDKTVIGTPFVEGATVEATVEKQGRAXX
3bboT           IFAVVVIGSRQYIVIPGRWIYTQRLKATVNDKIVLNKVLLVGKASTYIGTPIVTNAAVHAVVEEQLLDDK


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXHQHTKQGHRQPYTKVVIDAINA
3bboT           VIVFKYKKKKNYRRNIGHRQPITRIKITGITG