[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99824.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2basA.bssp"
#ERROR : Can't open dsspfile "2basB.bssp"
#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "3e02A.bssp"
#ERROR : Can't open dsspfile "1b5tB.bssp"
#ERROR : Can't open dsspfile "2bduA.bssp"
#ERROR : Can't open dsspfile "2ayaA.bssp"
#ERROR : Can't open dsspfile "2btvA.bssp"

## Summary of PDB Search
:248
    3e-18  17%  2basA  [x.x.x] YKUI PROTEIN
    4e-17  17%  2basB  [x.x.x] YKUI PROTEIN
    6e-14  10%  1b5tA  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    7e-12   8%  3e02A  [x.x.x] UNCHARACTERIZED PROTEIN DUF849
    7e-12  10%  1b5tB  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    8e-10  13%  2bduA  [x.x.x] CYTOSOLIC 5'-NUCLEOTIDASE III
    4e-09  10%  2ayaA  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    4e-08   7%  2btvA  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxSTLNIAPDNLTLAFQPIVRIVNEDTFEISDYEVLLRSKDKKSFPAAIFEKIVNNESCNQMFWEWFTLE
2basA           ------TNIDDVLPYYQAIFSA---EEQKVVGYEVLGRADSEIQSLGPFFLDAGIPEEYKLEVDNRI---
2basB           ------TNIDDVLPYYQAIFSA---EEQKVVGYEVLGRADSEIQSLGPFFLDAGIPEEYKLEVDNRI---
1b5tA           -----------TGLEAAPHL---TCIDATPDELRTIARDYW----NNGIRHIVALRGDLPPGSGKPEMYA
3e02A           ----------------------------------------------------------------------
1b5tB           ---------------ERDRTHSIIKGIKDRTGLEAAPHLTCIDAELRTIARDYWNNGIRHIVALRGDLAS
2bduA           --SVRIKNPTRVEEIICGLIKGGAAKLQIITDFDTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLKE
2ayaA           ----------------------------------------------------------------------
2btvA           ----------HLLFTAGGRFTNL---TQNMARQLDIALNDYLLYMYNTQVNPTGEPLDFQIGRNQYDCNV


                         .         .         *         .         .         .         .:140
query           IKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGY
2basA           IRQALDRSDLLIFNQDANLLLDHGESFLELLKEYEAKGRFVLEITEHNFEG---DIEQLYHLAYYRTYGI
2basB           IRQALDRSDLLIFNQDANLLLDHGESFLELLKEYEAKHRFVLEITEHNFEG---DIEQLYHLAYYRTYGI
1b5tA           SDLVTLKEVADFDISVAAYPEVHPEAKSAQADLLNLKAGANRAITQFFFDV----ESYLRFRDRCVSAGI
3e02A           -------------ASNGSLNFNISQAAAKFDTFKFDWERPYLAGTRDFI--LSNTFSQIERGTELGASGT
1b5tB           DLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGI
2bduA           QYYAIEVDPVLTVEEKFPYVEWYTKSHGLLIEQGIPKAKLKEIVADSDVL----KEGYENFFGKLQQHGI
2ayaA           ---------VCLHLRSSQRHLNNRGAQQKLAEALSMLKELTIVEDDNPAVR-TPLE-WRQAIYEEKLAQA
2btvA           FRADFATGTGYNGWATIDVEYRDPAPYVHAQRYIRYCRELINPTTYGIGMTYH---CYNEMLRMLVAAGK


                         +         .         .         .         .         *         .:210
query           RVALDDISSGQYSFKVVQENIKGIDRVKLSLLIFNDDSTDSKTKNFFIMSWINFAKTNNVELVIEGIEDD
2basA           KIAVDNIGKESSNLDRIALL--SPDLLKIDLQALKSPSYEH-----VLYSISLLARKIGAALLYEDIEAN
2basB           KIAVDNIGKESSNLDRIALL--SPDLLKIDLQALKSPSYEH-----VLYSISLLARKIGAALLYEDIEAN
1b5tA           DVEIIPGILPVSNFKQAK-KFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDY
3e02A           RFEFECYDVGHLYN--LAHFVDKLVEPPFQCVFGILGGIGADPENLLHRTIADRLFGQDYYLSVLAAGRH
1b5tB           DVEIIPGILPVSNFKQAK-KFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDY
2bduA           PVFIFSAGIGDVLEEVIRQ--AGVYHSNVKVVSNFDFDENGVLKGFKGELIHVFNKDNSNIILLGDSQGD
2ayaA           RESIIADNNIQ-----------------------------------------------------------
2btvA           DSEAAYFRSMLPFHMVRFARINQIINEDLHSVFSLPDDMFNALLPDLI----------------------


                         .         .         .         +         .         .         .:280
query           VAAKEMLCHNIKLQQGFFWQVPQDxxxxxxxxxxxxxx
2basA           FQLQYAWRNGGRYFQGYYL-------------------
2basB           FQLQYAWRNGGRYFQGYYLVSPSE--------------
1b5tA           TLNRAEMSYAI---CHTL--------------------
3e02A           QPFVTSAILGGNVRVGLEDSLY----------------
1b5tB           TLNRAEMSYAI---CHTL--------------------
2bduA           LRADGVANVEHILKIGYLNDRVD---------------
2ayaA           --------------------------------------
2btvA           --------------------------------------