[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99837.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2ce2X.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2c1lA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3bfkC.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"

## Summary of PDB Search
:586
    2e-52  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-39  29%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    9e-37  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-36  13%  3cmvC  [x.x.x] PROTEIN RECA
    1e-35  20%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-35   9%  3cmvG  [x.x.x] PROTEIN RECA
    6e-35   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-34  11%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-34  11%  3cmvH  [x.x.x] PROTEIN RECA
    8e-34  12%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-32  18%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-32   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-32  12%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    3e-32  12%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    6e-32  14%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    8e-32  10%  2akaB  [x.x.x] DYNAMIN-1
    9e-32  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-31  12%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    2e-31  11%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-31  15%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-30   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-30   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-30  10%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-29  10%  3cmvA  [x.x.x] PROTEIN RECA
    2e-29  10%  4dcgA  [x.x.x] VP39
    8e-29  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-28  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    2e-28   7%  2bifA  [c.37.1 - c.60.1] PROTEIN
    6e-28  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-28   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-27  16%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-27  10%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-27   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    4e-27  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    2e-26  14%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-26   9%  1e98A  [c.37.1] THYMIDYLATE KINASE
    4e-26  14%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-26  12%  1e0jA  [c.37.1] DNA HELICASE
    7e-26  23%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-25  12%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-25  11%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    1e-25  11%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-25   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    5e-25   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    8e-25  10%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    8e-25  14%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    9e-25  10%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-24  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-24  10%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-24   9%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    3e-24  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-24  12%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-24  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-24  13%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-24  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-24  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-24  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    6e-24  25%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-24  11%  2ctsA  [x.x.x] CITRATE SYNTHASE
    6e-24  11%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    7e-24  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    9e-24  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-23  24%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-23  11%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-23  12%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-23  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-23  13%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-23  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-23  15%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    4e-23   8%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-23  13%  2cckA  [x.x.x] THYMIDYLATE KINASE
    5e-23  18%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-23  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-23  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    1e-22  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-22  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-22   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-22  13%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-22  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-22  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-22  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-22  10%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    5e-22  11%  1aroP  [e.8.1] T7 RNA POLYMERASE
    6e-22  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-22   7%  2axzC  [x.x.x] PRGX
    8e-22  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-21   9%  3da4A  [x.x.x] COLICIN-M
    1e-21  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-21  11%  1e0jB  [c.37.1] DNA HELICASE
    2e-21  13%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-21  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-21  18%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-21  11%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    7e-21  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    7e-21   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    8e-21  11%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    9e-21  10%  2c4rL  [x.x.x] RIBONUCLEASE E
    1e-20  10%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-20  12%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    2e-20   8%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-20  24%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20  10%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-20  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-20  23%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-20  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-20  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-20  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    5e-20   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    5e-20  15%  3bm2B  [x.x.x] PROTEIN YDJA
    5e-20   8%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    7e-20   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    9e-20  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-19  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-19  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-19  16%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-19  11%  3cmvB  [x.x.x] PROTEIN RECA
    2e-19  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-19  10%  3ec1A  [x.x.x] YQEH GTPASE
    2e-19   9%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-19  12%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    2e-19  12%  3cmvE  [x.x.x] PROTEIN RECA
    3e-19   9%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-19   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    4e-19  11%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    4e-19   9%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-19  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-18   8%  2b8tC  [x.x.x] THYMIDINE KINASE
    1e-18  14%  3c8uA  [x.x.x] FRUCTOKINASE
    1e-18  18%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-18  12%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-18  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-18  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-18   7%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-18  13%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-18  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-18  15%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-18  12%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-18  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    4e-18  12%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-18  11%  3cmxA  [x.x.x] PROTEIN RECA
    4e-18  13%  1e6cA  [c.37.1] SHIKIMATE KINASE
    4e-18  10%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    5e-18  12%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    5e-18  15%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-17  27%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-17   9%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-17  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    2e-17   7%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-17  10%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-17  25%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-17  16%  2bdtA  [x.x.x] BH3686
    2e-17  15%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-17  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-17  22%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17  15%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-17  20%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-17   8%  2bx2L  [x.x.x] RIBONUCLEASE E
    3e-17  11%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-17  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-17  12%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-17  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    7e-17  15%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    8e-17   8%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-16  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16  15%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-16   5%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-16  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-16  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16   9%  2c0bL  [x.x.x] RIBONUCLEASE E
    2e-16   8%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    2e-16   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    3e-16  12%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-16  12%  3cmtD  [x.x.x] PROTEIN RECA
    6e-16  15%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    7e-16  13%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-15   9%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   9%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-15  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    2e-15  10%  3bczC  [x.x.x] PROTEIN MEMO1
    2e-15  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    2e-15  11%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-15  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15  16%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-15  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-15  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    3e-15  11%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    4e-15   6%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    4e-15   9%  2a1fF  [x.x.x] URIDYLATE KINASE
    4e-15  11%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-15  28%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    6e-15  13%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-15  12%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    7e-15  11%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    7e-15  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    9e-15   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    1e-14  12%  3adkA  [x.x.x] ADENYLATE KINASE
    1e-14  12%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14  11%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-14  22%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-14   6%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    2e-14  15%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-14  14%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-14  12%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-14   9%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-14  10%  3dlbB  [x.x.x] ARGONAUTE
    2e-14   9%  3a00A  [x.x.x] GUANYLATE KINASE
    2e-14  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-14  17%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-14  13%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    3e-14  11%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-14  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    3e-14  14%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-14  21%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-14  10%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    3e-14  13%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-14  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    4e-14  10%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    4e-14  10%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-14  10%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-14  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    6e-14  10%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-14  13%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-14  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-14  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-14  10%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-14  10%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-14  13%  2a1fD  [x.x.x] URIDYLATE KINASE
    9e-14  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    9e-14  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    1e-13  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13  12%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  12%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-13  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  12%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13   9%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-13  10%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13  11%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-13  12%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-13  10%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    5e-13  13%  2dftA  [x.x.x] SHIKIMATE KINASE
    5e-13  10%  3a00B  [x.x.x] GUANYLATE KINASE
    5e-13   7%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    5e-13  13%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    6e-13  12%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    7e-13  17%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    9e-13  21%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-12  10%  1eamA  [c.66.1] PROTEIN (VP39)
    1e-12  10%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-12   9%  1adoA  [c.1.10] ALDOLASE
    2e-12  12%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-12  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-12  22%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-12   7%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    2e-12   9%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    4e-12  17%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-12  13%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-12   9%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    5e-12  11%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-12   9%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-12  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    7e-12  10%  1e2iA  [c.37.1] THYMIDINE KINASE
    8e-12  17%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    8e-12  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-12  12%  2bhvA  [x.x.x] COMB10
    9e-12  13%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-11  13%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    1e-11   9%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-11   7%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-11  15%  3cmwC  [x.x.x] PROTEIN RECA
    2e-11  12%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-11  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-11   7%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    2e-11   8%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-11  10%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    2e-11   9%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-11  10%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-11  10%  1e2lA  [c.37.1] THYMIDINE KINASE
    3e-11  13%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    3e-11  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-11  12%  1e2jA  [c.37.1] THYMIDINE KINASE
    3e-11  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-11  11%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-11  10%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    7e-11   8%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    7e-11  20%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-11  16%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    9e-11  15%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-10  13%  2a1fE  [x.x.x] URIDYLATE KINASE
    1e-10  14%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-10  11%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-10  11%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    1e-10  11%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-10  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-10  10%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-10  10%  2ancF  [x.x.x] GUANYLATE KINASE
    2e-10  20%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-10  16%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-10  15%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-10  12%  2bhvD  [x.x.x] COMB10
    4e-10  20%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-10   9%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    4e-10  17%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    5e-10  10%  2anbA  [x.x.x] GUANYLATE KINASE
    5e-10   8%  3dfdA  [x.x.x] PROTEIN YQBN
    5e-10  12%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-10  11%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-09  14%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    1e-09  14%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-09   7%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    2e-09   8%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    2e-09   8%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-09   9%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-09  12%  3be4A  [x.x.x] ADENYLATE KINASE
    3e-09  11%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    4e-09  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    7e-09   3%  2c9gA  [x.x.x] PENTON PROTEIN
    7e-09  14%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-09  10%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    8e-09  14%  3cmuA  [x.x.x] PROTEIN RECA
    1e-08  10%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-08  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-08  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-08  15%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  20%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-08  16%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    2e-08  10%  2an9A  [x.x.x] GUANYLATE KINASE
    3e-08  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-08  14%  1e2kB  [c.37.1] THYMIDINE KINASE
    5e-08  13%  1e2lB  [c.37.1] THYMIDINE KINASE
    7e-08  11%  2ancB  [x.x.x] GUANYLATE KINASE
    9e-08   4%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    2e-07  12%  2bhvC  [x.x.x] COMB10
    2e-07   9%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-07   9%  2c9oA  [x.x.x] RUVB-LIKE 1
    3e-07   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-07  19%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    5e-07  10%  1e2nB  [c.37.1] THYMIDINE KINASE
    5e-07   9%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-07  11%  1e2mA  [c.37.1] THYMIDINE KINASE
    6e-07  21%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-07  14%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    9e-07  18%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-06   9%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    1e-06  14%  1e2hA  [c.37.1] THYMIDINE KINASE
    3e-06  13%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-06  11%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-06  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    5e-06  13%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    6e-06  13%  3dkvA  [x.x.x] ADENYLATE KINASE
    8e-06  12%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-05   7%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-05  18%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-05  10%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-05  13%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-05  12%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    8e-05  10%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-04  14%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  21%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    3e-04  16%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    3e-04  11%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-04  34%  2ce2X  [x.x.x] GTPASE HRAS
    4e-04  26%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    4e-04  12%  2cdnA  [x.x.x] ADENYLATE KINASE
    4e-04  16%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    5e-04   9%  2c1lA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-04  13%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    6e-04  14%  3cmwA  [x.x.x] PROTEIN RECA
    6e-04  42%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    7e-04  12%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-04  17%  3bfkC  [x.x.x] SMALL GTPASE RAB11
    7e-04  20%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    8e-04  27%  2c9oB  [x.x.x] RUVB-LIKE 1
    0.001  22%  1a2kE  [c.37.1] RAN
:586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSEDINHIQNx
3b5jA           ----------------------------------------------------------------------
3b60A           --------------YISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVAS-
2c61B           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAFPIWSVIVNGARQEYEKKIKNELYLDL
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3dtbB           -----------------------------------------------------ARIESKTVIITQEQRDT
1e9fA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3dt2A           -----------------------------------------RKLKKYDNCWLALTDPRDVARIESKTVII
2c04A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dt4C           -------------------------------------------LKKYDNCWLALTDPRDVARIESKTVII
3clvA           ----------------------------------------------------------------------
3dt7A           ------------------------------------------------------RIESKTVIITQEQRDT
2awoC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bgwA           ---------------------------------------------------------------------I
3bpbA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TDNIVGITDWIFAQRGRDYVKLHEQNEEKLMDVQEKLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGS
3b5jA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2c61B           ----------------------------------------------LIFVEKTEPVGYNEIVNIKMGDGT
3cmvC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3eiuA           -----------------------------------------------LIFVEKTEPVGYNEIVNIKMGDG
3cmvH           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3eiuB           -----------------------------------------------------LIFVEKTEPVGYNEIGT
2c03B           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3b2qB           --------------------------------------------GPLIFVKTEPVGYNEIVNIKMGDGRR
2dr3A           ----------------------------------------------------------------------
2c61A           -----------------------------------------------LIFVEKTEPVG-YNEIVNIKMGD
2a5gA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3dtbB           VPIP--KSGQSQLGRWMSEEDFEKAFNA-RFPGCMKGRTMYVIPFSMGPLGSPLKIGIELTDSPYVVASM
1e9fA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3b2qA           ------------------------------------------IAGPLIFVEKTEPVYNEIVNIKMGDGTV
3dt2A           TQEQRDTVPIPKSGQSWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSLAKIGIELTDSPYVVASM
2c04A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
1accA           -------------------------------------------------KAKENQLSQILAPNNYY----
3a1wA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
3dt4A           ---------WMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRM
2bkhA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------TLTVHAPSPSTNLPSYGNGAFSLS
3d7wA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3dt4C           TQEQRDTVPIPKSGQSQLGRWMSEEDFEKAF--NARFPGCMKGRTMYVIGSPLAKIGIELTDSPYVVASM
3clvA           ----------------------------------------------------------------------
3dt7A           VPIPKSGQS--QLGRWMSEEDFEKAFNARFPGCMKGRTMGPLGSPLAKIGIELTDSPYVVASMRIMTRMG
2awoC           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cmvB           -----------------------------------------------------------INFYGELLGVK
2b92B           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bgwA           LTEPELIKE-CPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYSVASTTTFK
3bpbA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3ed8A           --------------------------------------------------------------GDATIGKL
2b8tB           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2ck3C           -----------------------------------------SIGDGIARVHGLNVQAEEMVEFSSGLKGM
2bhjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e1qB           -----------------------------------------SIGDGIARVHGLRNVQAEEMVEFSSLEPD
1b0uA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------MVEFSSGLKGMSLNLEPD
3bk7A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGVYTGLANWIAAFVLCLFPVVDAFAVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKL
3b5jA           -------------------------------------------------------------------ITF
3b60A           --------------------------------------MAACQTLFAILDSEQEKDEGKRVIDRAGDLEF
2c61B           VRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
3cmvC           ----------------------------------------------------------------LGEDRS
2d3wB           -------------------------------------------------------------------LSI
3cmvG           ---------------------------------------------------------------------V
2dwoA           -------------------------------------------------------------------SRV
3eiuA           TVRRGQVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
3cmvH           -----------------------------------------------------EKQFGKGSIMRLGEDRS
3dmdC           ------------------------------------------------------------------EAVK
1e69A           -------------------------------------------------------------------MRL
2dwpA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ---------------------------------------------------------------------M
2b8tA           ----------------------------------------------------------------------
3c95A           -------------------------------------------------SGMFGAWRGNTSWVAPLAWHP
3eiuB           VRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
2c03B           ----------------------------------------NLEVTRDFVERVREEGKQVLESLTPAEVIL
1bifA           ----------------------------------------------------------------------
3dm5A           ----------------------------------QRALIQADVNVRLVLQ-LTREIQRRALEEKPPAEHI
2b8wA           -------------------------------------------------------------------CLI
3cmvA           -----------------------------------------------------FGKGSIMRLGEDRSMDV
4dcgA           ----------------------------------------------------FEEIDNEL----DYEESA
3dmdB           -------------------------------------------ALREKIKQKLVGKKVRIGTDKGEEAVK
1d1cA           -----------------------------------------------------------------FKGRR
2bifA           ----------------------------------------------------------------------
2bbsA           -----------------------------------------------------------------WEEGF
2czvA           ----------------------------------------------------------------------
2c03A           ----------------------------------------NLEVTRDFVERVREEGKQVLESLTPAEVIL
2ahvA           ---------------------------------------------------------------------V
1e9cA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2bc9A           -------------------------------------------------------------------CLI
1e0jA           -----------------------------------------------------------------REHLS
2d62A           -------------------------------------------------------------------VKL
3b2qB           GQVLDSSADIVVVQVFEGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
2dr3A           ----------------------------------------------------------------------
2c61A           GTVRRGQVLDSSADIVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
2a5gA           ----------------------------------------------------------------------
2ahwD           ---------------------------------------------------------------------V
1dkiA           ----------MYVYNGFVI-VSGDKRSPEILGYSTSGSFDVNGKENIASFMESYVEQIKENKKLPSLLDS
3b85A           ----------------------------------------------------------------------
3dtbB           RIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIGKKCFALRIASR
1e9fA           ----------------------------------------------------------------------
2cgtH           -----------------------------------------------------------------VLDKS
1e2dA           ----------------------------------------------------------------------
3bb1E           ------------------------------------------------------------------WSGI
1e9sG           -------------------------------------------------------------------GKL
1e9rA           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVS--GGKL
3bb1A           ------------------------------------------------------------------WSGI
3cddC           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2awnB           -------------------------------------------------------------------VQL
2ctsA           ----------------------------------------------------------------------
3b2qA           RRGQVLDSSADIVVVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYAR
3dt2A           RIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNTLIAHLPDRREIISFGSGYGGNSLLGKFALRI
2c04A           ----------------------------------------NLEVARDFVERVREEALGKLESLTPAEVIL
2awnC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------STTKTQRIASHSHVKGLGLDESGLA-KQAA
1accA           PSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQL----RLDTDQVYGNIATYNFENGRVRVDTGSNW
3a1wA           ----------------------------------------------------------------------
2akaA           -----------------------------------------------------------------FKGRR
3bjdB           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
2awnD           -------------------------------------------------------------------VQL
3bb1B           ------------------------------------------------------------------WSGI
1cr4A           -------------------------------------------------------------------SSE
3bb1C           ------------------------------------------------------------------WSGI
3dt4A           GTSVLEALGDGEHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLG-KKCFALRI
2bkhA           -------------------------------------------ILIAVNPYFDIPKIYSSETIKSYQGKS
2eg5G           -------------------------------------------------------------------YNQ
1dg3A           -------------------------------------------------------------------CLI
1e3mA           ----------------------------------SRGQSHLAPINYRRQTLKNAERYIIPELKE-YEDKV
1e9sF           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSG--GKL
2axpA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2d4hB           -------------------------------------------------------------------CLI
2axzC           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3da4A           APHVPG---AGPLLVQVVYSFFQSPNMCLQALTQLEDYIKKHGASNPLTLQIISTNIGYFCNADRNLVLH
3d7wA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------VVSALSLRERIREHLSSE
3bb1F           ------------------------------------------------------------------WSGI
3cr7C           ----------------------------------------------------------------------
2d3wC           -------------------------------------------------------------------LSI
2a2zD           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3cddF           ------------YQGWTKIGITRSLEASGAFDLETYKFNDAQYKAFIEPIKQGQACTVDIGGERVITGYV
2c4rL           KGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPNKDVLREGQEVIVQIDKEERGNKGAALTTFISL
3dt4C           RIMTRMGTSVLEALGDGPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLG-KKCFALRI
3clvA           ----------------------------------------------------------------------
3dt7A           TSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIGSGYGGNSLLGKKCFALRI
2awoC           ----------------------------------------------------------------------
3bh0A           ------------------------------------------------------GSIDEALVTVYEEIES
421pA           ----------------------------------------------------------------------
3dhwC           -------------------------------------------------------------------IKL
3bb1G           ------------------------------------------------------------------WSGI
1e9sD           ----------------------------------------------EFGGAPFKRFLRGTRIVS--GGKL
2bkiA           ---------------LNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKS---YQGKS
1e3aB           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bo6B           -------------------------------------------------------------------HSL
2bbsB           ---------------------------------------------------------------------T
3czpA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cmvB           EKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLKQKALAAALGQIEKQFGGEDRS
2b92B           -------------------------------------------------------------------CLI
3ec1A           ----------------------------------------------------------------------
3bgwA           QHCQTVSEYFQKRKAISIAQQIIENVN----VKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIES
3bpbA           ------------------------------------------------------------------HIIA
3cmvE           ------------------------------------------------------------SIMRLGEDRS
1dhjA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2d4hA           -------------------------------------------------------------------CLI
1dhiA           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2d3wD           -------------------------------------------------------------------LSI
1e2hB           ----------------------------------------------------------------------
1e9sJ           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSG--GKL
1cr1A           -------------------------------------------------------------------SSE
3cbnA           ----------------------------------------------------------------------
3bb1H           ------------------------------------------------------------------WSGI
3cnlA           ----------LLRLVNTVVEVRDARAPFATSAYGVDFSRKETIILLNKVDI---ADEKTTKKWVEFFKKQ
3cr7A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e3mB           -----------------------------------------------------------------YEDKV
2d0kA           ----------------------------------------------------------------------
3cmxA           ------------------------------------------------------EKQFGKGSIMRLGEDR
1e6cA           ----------------------------------------------------------------------
2dflA           -------------------------------------------------------------------KKE
2a30A           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
3d31A           -------------------------------------------------------------------IEI
1ai4B           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2awoA           -------------------------------------------------------------------VQL
2ausC           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bbtB           -------------------------------------------------------------------ELF
3cr7D           ----------------------------------------------------------------------
2d3wA           -------------------------------------------------------------------LSI
2bx2L           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2b8wB           -------------------------------------------------------------------CLI
3ch4B           ----------------------------------------------------------------------
3ed8A           KFICTT-GKLPVPWPTLVTTLLQCFARYPDHMKQHDFFKSAMPRTISFKDDGKYKTRAVVKFEGDNRIEL
2b8tB           ----------------------------------------------------------------------
1e9rE           -------------------------------------------------------------------GKL
3bb1D           ------------------------------------------------------------------WSGI
1afrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2awnA           -------------------------------------------------------------------VQL
2c0bL           --IYKGKITRIEAAFVDYGAERHGFLPLKEIAREYFPRPNIKDVLREGQEVIVQIDKEERGNKGAALTTF
1d8jA           ----------------------------------------------------------------------
1bg0A           -----------------------------------------------------SDCKSLLKKHLTKDVFD
3dfqA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------EFGGAPFKRFLRGTRIVSG--GKL
3cmtD           --------------------------------------------------SAIDENKQKA---LAAALGQ
1av6A           ---------------------------------------------------YFEEIDNELD----YEPES
3dm9B           --------------------------------------------REKIKQKLVGKKVRIGTDKGKIEAVK
1e9sH           ----------------------------------------------EFGGAPFKRFLRGTRIVSG--GKL
2aunA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------EFGGAPFKRFLRGTRIVS--GGKL
3cm0A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2ck3C           SLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGARRRVGLKAPGIIPR
2bhjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e1qB           NVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPR
1b0uA           -------------------------------------------------------------------LHV
3d3qB           ----------------------------------------------------------------------
1ckvA           ---------------------------------------------------------------VNSNAYD
2cvfA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           -------------------------------------------------------------------LEI
1cjaA           ---------------------------------------------------------------EEGTNML
3cnnA           ----------LLRLVNTVVEVRDARAPFATSAYGVDFSRKETIILLNKVDIADEKTT---KKWVEFFKKQ
1cfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
1cr2A           -------------------------------------------------------------------SSE
2d2eA           -------------------------------------------------------------------LEI
1aldA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           -------------------------------------------------------------------GKL
2bkeA           -------------------------------------SPQDLSVAAGIPLSTAQKIIKEARDALDEVKKE
3dfoD           ----------------------------------------------------------------------
1e9sI           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSG--GKL
1draA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------NSVGQGEFGGAPFKRFLRGTRIVSG--GKL
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2bbtA           -----------------------------------------------------------------WEEGF
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------EFGGAPFKRFLRGTRIVSG--GKL
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1e9sE           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSG--GKL
2a2zB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           -------------------------------------------------------------------SSE
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------FEEIDNELDY-------E
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           -------------------------------------------------------------------LQT
1bmfC           NVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPR
3bk7A           ----------------------------------------------------------------------
3brwA           -------------------------------------------------------------------LEC
2aumB           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           ------------------------------------------------------LETGALITPPFNPLQR
1akeA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------NVRLVLQLTREIQRRALEEKPPAGISKEHI
2b8tD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------LSSKYSRNTELRREDNDIYRLAK----ILDENSCWRKLMSIIPKGMDVQACSGAGNFPAE
3d3qA           ----------------------------------------------------------------------
1d6aA           ---------------------------------------------------------------KAGVKSR
3do6A           --------------------------------------------------------------LKDDILYP
3dyoA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ------------------------------------------------------LETGALITPPFNPLQR
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           -------------------KDSEAFTDNQYSRAHTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAAL
3bv4A           ----------------------------------------------------------------------
2bv7A           ------------------------------------------------------------------QIET
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           -------------------------------------------------------------------VQL
2d7vB           -------------------------------------------------------------------AAL
2bhvD           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3cqcA           -----------------------------------------------------DWLVFDPAQRAEALKQG
2cbzA           -------------------------------------------------------------------ITV
2anbA           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------DLSFFPGQTIDA
1e9sM           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSG--GKL
3dfoC           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------VNRIEL
3cioD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3b9qA           -----------LLLFWNLAETDRVLDELEEALLVSDF---GPKITVRIVERLREDIMSGKLKSGSEIKDA
2c9gA           ----------------------------------------------LHTNMPNVNEFMFTNKFKARVMVS
3cddA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------EFGGAPFKRFLRGTRIVSG--GKL
3cphA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2bboA           -------------------------------------------------------------------VVM
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2c9oA           -------------------------------------------KTQRIASHSHVKGLGLDESGLA-KQAA
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9sA           ----------------------------------------NSVGQGEFGGAPFKRFLRGTRIVSG--GKL
1e2mA           ----------------------------------------------------------------------
3dmdA           ------------------------------------------------------------------EAVK
3cddE           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3e70C           ---------------------------------------DALREKIKQKLVGKKVRIGGKIIEEAVKEAV
1e9sK           ------------------------------------------VGQGEFGGAPFKRFLRGTRIVSGGKLK-
2a78A           ----------------------------------------------------------------------
2axnA           -------------------------------------------------------------------SRV
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI
3b5jA           RNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADNWL
3b60A           RNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLAS
2c61B           LPPKDFI--QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNA
3cmvC           MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2d3wB           KDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLADRA
3cmvG           ETISTGS--LSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2dwoA           QKIWVPVDH---RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
3eiuA           LPPKDFI--QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNE
3cmvH           MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
3dmdC           EAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGIEQ
1e69A           KKLYLK----GFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGAYV
2dwpA           -----------QSRVQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
2ccgB           ------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEER
2ccjB           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2ccgA           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2akaB           EDLIPLVNRL-QDAFSAIGQNADDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNS
2b8tA           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRN
3c95A           ENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKIV
3eiuB           LPPKDFI--QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMTNEEA
2c03B           ATVYEAL--KEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAREQ
1bifA           ------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQY------
3dm5A           IKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGYHQ
2b8wA           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
3cmvA           ETISTGSLSL---DIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
4dcgA           NEVAKKLPYGQLKLLLGQRH---GILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPIL
3dmdB           EAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIE
1d1cA           RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQANP
2bifA           ---------------------------IVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVK
2bbsA           GELFEKA--KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSW
2czvA           -----------GGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSKF
2c03A           ATVYEAL--KEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAARQ
2ahvA           KPPRINGRVP-VLSAQEAVNYIPDEATLCVLGAILEATTLITALADSIISPTGLGDRADRGISPLAQGLV
1e9cA           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2c9yA           ------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
2cjwB           ------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILDMW
1e98A           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE------R
2bc9A           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
1e0jA           SSVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
2d62A           INIWKRF--GDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKGVF
3b2qB           LPPKDFIQTG--ISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNE
2dr3A           -----RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQ
2c61A           LPPKDFI--QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNE
2a5gA           ------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVK
2ahwD           KPPRINGRVP-VLSAQEAVNYIPDEATLCVLGAILEATTLITALADSIISPTGLGDRADRGISPLAQGLV
1dkiA           KGIHYNQGNP-YNLLTPVIEKVKPGEQVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNNPYF-
3b85A           ---------PKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKL
3dtbB           LAKEEGWLAE-HMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
1e9fA           ------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2cgtH           FGAPTITKDG-VSVAREIELEDKFENMGAQMKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNP
1e2dA           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
3bb1E           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1e9sG           KRMTREK--AKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSFGR
1e9rA           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3bb1A           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
3cddC           ---------------------------LKAGGKIYQGWTKIGITRSLEAYKFQYKAFIEPIKCTVDIGGE
3czpB           ---QLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQP
2dr3E           ----RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQRQN
2awnB           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2ctsA           ------SSTNLKDILADLIEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFR
3b2qA           LPPKDFI--QTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNE
3dt2A           ASRLAKEEGAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKDAQGNL
2c04A           ATVYEAL--KEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAARE
2awnC           ----VQL--QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG---------------------
3cddD           ---EIVLKAGGKIYQGWTKIGITRS-----LEASGAFDLETY----KFNDAQYKAFIEPIKQGQACTVDI
2c9oC           SGLVGQENAACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVSTEIKKT
1accA           SEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKGFNEPNGNLQYQGKD--------
3a1wA           --------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYK
2akaA           RNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQ
3bjdB           ---------------------------------------SLPQLQN----LPIEEARIVALAVHATSRQI
1e9dA           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2cckA           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2awnD           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPAER
3bb1B           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRSRA
1cr4A           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
3bb1C           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
3dt4A           ASRLAKEEGAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
2bkhA           LGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL
2eg5G           LVLAKVKEQCVRELLRANLPNINKCIKVADLGCAS-GPNTLLTVRDIVQSIERPTIQIFLNDLFPNDFNS
1dg3A           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHILV
1e3mA           LTSKGKALALEKQLYEELFDLLLPH--LEALQQSLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQ
1e9sF           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2axpA           ---------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLF
1aroP           ----------------------------------------------------------------------
2d4hB           ENTNGRLMANPEAILSAITQP---MVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLGIFA
2axzC           ----------------------------------------------------------------------
1e4yA           --------------------------RIILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGELG
3da4A           PGISVYDAYH-----FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKISPM
3d7wA           DYVSSGSFSNNIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSDAPA-
1e0jB           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
3bb1F           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
3cr7C           ------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2d3wC           KDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSP
2a2zD           ------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNK
3d3kA           -VPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGRPTVALLCGPHVKGAQGISCGRHLA
3bgwD           ---NITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
3cddF           DDWVPSYESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFETPH
2c4rL           AGSYVLMPNNPRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAE
3dt4C           ASRLAKEEGAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
3clvA           -------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVVNLN
3dt7A           ASRLAKEEGAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
2awoC           ----VQL--QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
3bh0A           ADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
421pA           --------------------------KLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDL
3dhwC           SNITKVFHQGTRTALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESE
3bb1G           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRAG
1e9sD           KRMTREK--AKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2bkiA           LGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVE--ANP
1e3aB           --AKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNP
3bm2B           ----------------------------------------------------------------------
2bofX           ---------------------------------------------------NMSSAEWVRNNPNDPRTPV
3bo6B           HNQMRQM--PMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFHIS
2bbsB           EVVMENV--TAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI-----SFC
3czpA           ---QLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQP
2aumA           ----------------------------------------------------------------------
1d6jB           ---HA----SALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHALDGDNIRFGLNKD
3cmvB           MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2b92B           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKWCVPHPK
3ec1A           -------------------------------------------------------ITTSYFPGTTLDIEI
3bgwA           ADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
3bpbA           RTPARSLVDGLSSHLGKPDYAKALEQHNAYIRALQVDITLLPPFPDSVFVEDPVLCTSRCAIITRPGAES
3cmvE           MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
1dhjA           ----------------------------------------------------------------------
2a2zA           ------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNVL
2a5jA           --------------------------KYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDKQIKL
2d4hA           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCVPHP
1dhiA           ----------------------------------------------------------------------
2b8tC           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTS
3c8uA           ------LAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVV-PDGFHLDNRL
2d3wD           KDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSAEDYEVTGGTVEFKGKDLLALSPEDRAG
1e2hB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
1e9sJ           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1cr1A           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
3cbnA           ---------------------------------------------------LRYTLRARGHPNVT---AG
3bb1H           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
3cnlA           GKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDTPGI
3cr7A           ------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2a30D           ------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNVL
1e3mB           LTSKGKALALEKQLYEELFDLLLP--HLEALQQSASALAELVNLAERAYTLNYTCPTFIDKPGIRITEGR
2d0kA           ----------------------------------------------------------------------
3cmxA           SMDVETISTGSLSLDIALAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
1e6cA           --------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVAD
2dflA           RMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGT
2a30A           ------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNVL
2cckB           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEV
3d31A           ESLSRKWKN---FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK
1ai4B           ---------------QALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWNWNNSPQKDY
2dr3C           ----RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV----
3dffA           ----------------------------------------------------------------------
1e2fA           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2awoA           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2ausC           ----------------------------------------------------------------------
2bdtA           ---------------------------YIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPP
2dr3B           ----RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQ
1d6jA           ---------SALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2bbtB           EKAKQNN--NNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPS------EGKIKHSGRISF
3cr7D           ------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2d3wA           KDLHVSV--EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGLLALSPEDRAGEGIF
2bx2L           ----------------------------------------------------------------------
2a30B           ------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMMY
2d4uA           -----------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVATLN
2b8wB           ENTNGRLMAN-PEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
3ch4B           -----------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYQEH
3ed8A           KGTDFKED---GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT--PI
2b8tB           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPK-----ILP
1e9rE           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3bb1D           NTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1afrA           -----------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQV
1eilA           ----------------------------------------------------------------------
2awnA           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2c0bL           ISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAE
1d8jA           ----------------------------------------------------------------------
1bg0A           SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGFKLTDKHPPKQWGDIN
3dfqA           ----------------------------------------------------------------------
1e9sB           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3cmtD           IEKQFGKGSRLGEDRSMDVETISTGSLVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
1av6A           ANEVAKKLPGQLKLLLGSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPIL
3dm9B           EAVSEILE-TSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG---
1e9sH           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2aunA           ----------------------------------------------------------------------
3di4A           -SARKTGEVL-VPPREGRCFEVKAGQFFRISSVEG-----PQVGDLNLHNLHDLTERFFSGKTRALHGTH
3bczC           -------------------SHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAH
1e2iB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM------TYW
3cr7B           ------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
1e9rD           KRMTREK--AKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3cm0A           ------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPL
1e59A           --------------VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYT
2boeX           ----------------------------------------------------------------------
2ck3C           ISVREPM--QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIG
2bhjA           ---------------------------------------------------GSGEILHDTLHHKATSKSL
2a1fF           ----------------------------------------------------------------------
1e1qB           ISVREPMQTGIK--AVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYIGQK
1b0uA           IDLHKRY--GGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKD
3d3qB           ------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDGTAKVT
1ckvA           AGIMGLKKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTIKANGKIEVDDEI
2cvfA           ---------GTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQM
2dr3F           -----RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALE-----EHP
1e2gA           ------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
3adkA           -----------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSAR
3dfnC           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2d2fA           RDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSP
1cjaA           ECLAAIDKSFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDRNE
3cnnA           GKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVK---ILDTP
1cfrA           ---------------------------MDIISKSGEGNKYTINSAIA-FVAYASHIDINTTEFSKVLSGL
3b55A           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3dlbB           -------------------VWVEGLAVYRREHARGPGWRV----------------LGGAVLDLWVSDSG
3a00A           ---------------------------IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN
1ak2A           ------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGELG
1culC           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAETI
3cueF           --------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTVK
3dfnA           ----------------------------------------------------------------------
2dr3D           ----RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH------
1cr2A           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
2d2eA           RDLWASI--DGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSP
1aldA           ----------------------------------------------------------------------
1e2kA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS-ETI
2c7cH           -GAPTITKDGVS-VAREIELEDKFENMGAMVKEVASKANDAAGDGTTTATVLAQAILKRGIDKAVTAKAL
6aldA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9rF           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2bkeA           RNVKKIS--TGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCH---------------------QLSVNV
3dfoD           ----------------------------------------------------------------------
1e9sI           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1draA           ----------------------------------------------------------------------
1e9sL           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3dfqD           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2dftC           --------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIAD
3dauA           ----------------------------------------------------------------------
2bbtA           GELFEKA--KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSW
3dfnD           ----------------------------------------------------------------------
1dvrA           ----------------------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQL
1e9rG           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFR
3dfpC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dekA           ---------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGV
1e9sE           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2a2zB           ------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQTNVL
2dftA           --------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIAD
3a00B           --------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN
2czvB           -----KFIEMDIRDKEAYELAKEWFDEVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTQKF
1cr0A           ESVGLLF--SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
2d4uB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1eamA           PAKKLPYQGQLKLLLGELKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPIL
3czjA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
2bjbA           LGLRVDGV-GSELTVSGRIEPGPGAR--VDCGLAG----TVLRFVPPLAALGSVPVTFDGDQARGRPLDA
1bmfC           ISVREPM--QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIK
3bk7A           ---PRLVKDYGSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYK-----
3brwA           NPTARIYRKLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTK---------------------
2aumB           ----------------------------------------------------------------------
1cs4C           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAETI
1ek0A           --------------------------KLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVINE
3dymA           ----------------------------------------------------------------------
1e4vA           --------------------------RIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
5dfrA           ----------------------------------------------------------------------
2ccjA           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTR-------EPGG
1e2iA           ---------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIRLDQGEISA
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2dpyA           TPIEHVLDTGVR--AINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFI
1akeA           --------------------------RIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
3dm5B           IKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYH
2b8tD           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVKPKSIRNIQSRT
3cmwC           ---------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD-PIY
3ecpA           ----------------------------------------------------------------------
1cjtC           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIAA
1d2zD           IKKGFKYTAQDVFQIDEAANRLQMMIDEWKTSGKLNERPTVGVLLQLLVQASAADFVALDFLNES-----
3d3qA           ------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKV
1d6aA           SQVQLGIQILDSNIISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQV-KTNFNRAFNPNPKVL--NL
3do6A           YGHYIAK--IDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLREPSPTLGLKG
3dyoA           ----------------------------------------------------------------------
1e2lA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIATQH
2bwjA           ----------------GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESER
1drbA           ----------------------------------------------------------------------
1e2jA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDVYVPEPMTYWRVLGASETIANI
1dyhA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3c85A           ---------------------------------------------------GHAQVLILGGRIGTGAYDY
3bwdD           ------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNR
3c15C           ---------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAET
2dpyB           TPIEHVLDTGVR--AINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFI
2e85A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2d7vA           SSCHLVF--LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH--HL
3bv4A           ----------------------------------------------------------------------
2bv7A           GPFLEAVSHLPPFFLGSPVFTPIKADISGNYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATL----ALM
2ancD           ------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
1dekB           ---------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKD--------
2b0lC           ----------------------------------------------------------------------
2ancF           ----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLAIDWQGAQ
3c14C           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK-EAI
2awoD           QNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNGVGMVE
2d7vB           SSCHLVF--LSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH--HL
2bhvD           ----------------------------------------------------------------------
1cjuC           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
3cqcA           NAIMRKFLSKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAI-----------------------REHLCIR
2cbzA           RNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAW
2anbA           ----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
3dfdA           EEVEVPISKR-FVDKEGNVVPFITTDRIDELEKENTTKEL-------DSQRFYARIAVETTVYPTFKKEL
1e9sM           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3dfoC           ----------------------------------------------------------------------
4atjA           -------------------------------------RDTIVNELRSDPRIAASILRLHFEDCF---VNG
2a1fC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3cd9A           KGIDFKEDGNILGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGDGPVL
3cioD           -----------RTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYHNL
1e2mB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVAVPEPMTYWRVLGASETIANIYTT
3be4A           ---------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIKS
3crmA           ---------------------------IFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDGTAK
3b9qA           LKESVLE--MLAKSKTELQLGFRKPAVIMIVGVNGGGK----------TTSLGKLAHRLKNEGTKVLMAA
2c9gA           RSLTKDK--QVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYL-------------------------
3cddA           ----------------------------LETYKFLGNDAQYKAFIEPIKQGQAGERVITGYVDSYDESTI
1dp0A           ----------------------------------------------------------------------
3cmuA           ---------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
1e9rB           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3cphA           --------------------------KILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTGKKV
1c9kC           ---------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGRPAH
2bboA           ENVTAFWEEGLTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSW
3e8aC           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
1azsC           ---------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
2an9A           ----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
3b85B           -----------TLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKL
1e2kB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVA-LGSRDDIVYVPEPMTYWRVLGA
1e2lB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG-A
2ancB           ----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
3bjqB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2nA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLETI
2c9oA           SGLVGQENEACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKK
1dw9A           ---------------AILLSKAKKDLSFAEIDGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSI
3c7kA           --------------------------KLLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLA
1e2nB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGNI
1e9sA           KRMTREK--AKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1e2mA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLRDIVYVPEPMTYWRVLGASETIANI
3dmdA           EAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK--------------------------------
3cddE           -------------IVLKAG-GKIYQGWTKIGITRSLEASGAFDLEFLGNDAQYKAFIEPIKQGQACTVDI
1ckeA           ---------------------------ITIDGPSGAGKGTLCKAMAQWHLLDSGAIYRHHVDVASEDAPL
3dvlD           -----KMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDGVFVTFEETPQDIIKN
1e2hA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRLGASETIANI
1chdA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3cbqA           --------------------------KVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVD
2a5vA           -----------------YAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVV----ERV
3dkvA           --------------------------NIVLMGLPGAGKGTQAERIVEKYGIPHISTGDMFRAAMKEETPL
2c5mD           ----------------------------------------------------------------------
3cddB           -------EEIVLKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDA--QYKAFIEPIKQGQACTVDI
1cjvC           -----------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLK---EAI
3e70C           SEILETSR---RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIE
1e9sK           ---RMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML-SKF
2a78A           --------------------------KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDG
2axnA           QKIWVPVDH---RPSLPRSCGPNSPTVIVMVGLPARGKTYI-----------------------------
2a5vB           -----------------YAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVV----ERV
2dykA           --------------------------KVVIVGRPNVGKSSLFNRLLKKRSDLKEGVVETDRGRFLLVDTG
2ax4A           ------------------------GCTVWLTGLSGAGKTTISFALEEYVSHAIPCYSLDGRNLGFSPGDR
2b0lB           ----------------------------------------------------------------------
2ce2X           --------------------------KLVVVGAGGVGKSALTIQLIQNHFVDECDPTI------------
2atxA           --------------------------KCVVVGDGAVGKTCLLMSYANDAFPEE-----------------
2cdnA           ---------------------------VLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
2ax4B           ---------------------------VWLTGLSGAGKTTISFALEEYVSHAIPCYSLDGDNVRHSPGDR
2c1lA           ---------GGVRFYETFTEHINQGGRVIAILGGSTSQRLSSRQVVEELLNRGVEVRILHAKLYGNLGES
3ci2A           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
2cxxA           --------------------------TIIFAGRSNVGKSTLIYRLTGKKV--------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           --------------------------KIVLIGDSGVGKSNLLSRFTRDEFNLESKGVEFATKSIQLKNNK
2cxxB           --------------------------TIIFAGRSNVGKSTLIYRLTGKKVRRKIIEIEWKNHKIIDPGFG
2c9oB           -----------GVIVELIKSKKMAGRAVLLAGPPGTGKTALALA--------------------------
1a2kE           --------------------------KLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLV----


                         .         .         +         .         .         .         .:490
query           SNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER
3b5jA           RRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQR
3b60A           LRNQVVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQR
2c61B           QYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGYMYTDLATLYERAGIVKGAKG
3cmvC           RKLGVDIDNLLCSQPDTGEQALEICDALARSGAV-----DVIVVDSVAA-LTPKAEIEGLAARMMSQAMR
2d3wB           GEGIFMAFQYPVEIQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEK
3cmvG           RKLGVDIDNLLCSQPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEEIGDSHMGLAARMMSQA
2dwoA           QYSSYNFFRPDNEEAMKVRKQCALAALRD-------------------VKSYLAKEGGQIAVFDATNTTR
3eiuA           EAQMSDFEKTGALERAVVFLNAYEHGMHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKGAKG
3cmvH           RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQA
3dmdC           LEEHAKRIGVKVIKHSYGADPAA----------VAYDAIQHAKARGIDVVL-----------IDTAGRSE
1e69A           ELVFEENGEEITVARELKRTGEVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEK
2dwpA           QYSSYNFFRPDNE-------------------EAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTR
2ccgB           KIVLEGNDMDIRTEAMLFAASRREHLVLKVIP-ALKEGKVVLCDRYIDSSLAYQ-----------GYARG
2ccjB           RKIVLEGNDMDIRTEAMLFAA----SRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVR
2ccgA           RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQG-----------YARG
2akaB           TTEYAEFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEF
2b8tA           QSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEFVVIISGLDKNFKGEPFGPIA
3c95A           REKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLARNFPGTLDYAEQ
3eiuB           QYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMAALRQMGAAGYPGYMYTDLATLYERAGIVKGAKG
2c03B           LRLLGEKVGVPVLEVMDGESPESIRRR---------------------VEEKARLEARDLILVDTAGRLQ
1bifA           -------------RRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTR
3dm5A           LRQLLDRYHIEVFGNPQEKDAIKLAKEGV--------------DYFKSKGVDIIIVDTAGRHKEDKALIE
2b8wA           PHPHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGQLYYVTELTHRIRSKSVSFFPDFVW
3cmvA           RKLGVDIDNLLCSQPDTGEQALEICDRSGAVDVI--VVDSVA----------ALTPKAEIGLAARMMSQA
4dcgA           NGLRDDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILWRCPFPAQWIKDFYIPHGNK
3dmdB           QLEEHAKRIGVKVIKHSYGADPAAVAYDAIQH--------------------AKARGIDVVLIDTAGRSE
1d1cA           ILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFY-QLLAGAT
2bifA           TYKSFEFFLPDNEEGLKIRKQCAL--------AALNDVRKFLSEEGGHVAVFDA-----------TNTTR
2bbsA           IMPGTIKENIIGVSYDEYRYRSVI-------KACQLEEDISKFAEKDNIVLITL-----------SGGQR
2czvA           KSYLIYVESNDLRVIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRF
2c03A           LRLLGEKVGVPVLEVMDGESPESI---------------------RRRVEEKARLEARDLILVDTAGRLQ
2ahvA           KWALCGHWGQSPRISDLAEQN-KIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEV
1e9cA           LSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTL-------VVDRYAFSGVAYTGAKENFSLD
2c9yA           GKKLKATMDAGKLVDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIP
2cjwB           ENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTE----DIPIILVGNKSDLVRREVSVSEGRA
1e98A           STEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLD
2bc9A           PHPKKPGHILVLLDTE------GLGDVEKGDNQNDSWIFALAVLLSSTFVY-----------NSIGTINQ
1e0jA           EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDS--------FAEAETDRLLAKLAYM
2d62A           VPPKERDVAVFQSYALYPHT---VYDNIAFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSGGQR
3b2qB           EYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALALRQMGRGYPGYMYTDLATLYERAGIVKGAKG
2dr3A           NMAQFGWDVK------------------------PYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREF
2c61A           QYFMSDFEKTGALERAVVFLN----LADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDI-TNYAEA
2a5gA           FNVWDVGGLDKIRPLWRHYYTLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKP
2ahwD           KWALCGHWGQSPRISDLAEQN-KIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEV
1dkiA           -------NHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRV
3b85A           GFLPGDPYLRPHDALRDVEPEVIPKLEAGIVEVAP-LAYRGRTLNDAFVILDEAQNTTPAQKFLTRLGFG
3dtbB           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDE-PLAPGVTITSWKNKEW
1e9fA           LLSSYLQKK-SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLV-----VDRYAFSGVAFTGAKENFSLD
2cgtH           MDLAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTLQDEL-----DVVEGMQFDRGYLSPYFI
1e2dA           LLSSYLQKKSDVEDHSVHLLFS------ANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLD
3bb1E           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNKLVAKAITDSFGKGIWNK
1e9sG           DKDIILNPYDQRTKGWSFFNEIRND--YDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTP
1e9rA           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWAS------YGRLLLRETAKKLAL
3bb1A           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLY-VDRLDAYRVDNLDAKAITDSFGKGIWNK
3cddC           RVITGYVDDWVPSYDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGE-----PFQRIQIEQGET
3czpB           YLWRFWPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQ
2dr3E           MAQFGWDVKPYEEKGMFA-------------------------MVDAFTAGIGKEYEKYIVHDLTDIREF
2awnB           RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVI-----NQRVNQVAEVLQLAHLLDRKPKALSGGQR
2ctsA           GYECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQ
3b2qA           EAQMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTA----AEYLAYEHGMHVLVILTDITNYAEAL
3dt2A           RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITS--WKNKEW
2c04A           QLRLLGEKVVPVLEVMDGESPESIRRR---------------------VEEKARLEARDLILVDTAGRLQ
2awnC           --VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVL-----QLAHLLDRKPKALSGGQR
3cddD           GGERVITGYVDDWVPSYDESTIGQFNNQTLTQIADIVCKPFGIKVIVN-----TDVGEPFQRIQIEQGET
2c9oC           EVLMENFRRAIGLRIKETKKK-EIIQDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIE
1accA           ------ITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD--------KRFHYDRNN
3a1wA           GYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAI
2akaA           ILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATA
3bjdB           DSAASKLAQAYAAYQQ-LLYVLSLSDDVAT-AQTRRWLARAIYRVEERFPAADLSRALSEED--FQKRLE
1e9dA           LLSSYLQKKSDVEDHSVHLLFSA------NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLD
2cckA           RKIVLEDMDIRTEAMLFAASRREHLV-----------------LKVIPALKEGKVVLCDRYIDSSLAYQG
2awnD           GVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH---DQVEAMTLADKIVVLDAGRV
3bb1B           GFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDLDKLVAKAITDSFGKGIWNK
1cr4A           EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDEL---------------FGNDTFHLYDSFAEAETDRL
3bb1C           AGFTLNIIPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNK
3dt4A           LRAINPENGFFVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE--GIDEPLAPGVTITSWKNKEW
2bkhA           EAFG--NAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASE
2eg5G           VLLPSFYRKLEKENGRKIGSCLIGAMPGSFPEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSKA
1dg3A           LLDTELGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELHRIRSKSDSADFVSFFP
1e3mA           VLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAY----IGSYVPAQKVEIGPIDRIFTRVGFV
1e9sF           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-------------------------SVVPRGKTDEAE
2axpA           EHFEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIRVRGDEYIEGKDI
1aroP           ----------------NDFSDIELAAIPADHYGERLAREQLALE------HESYEMGEAR----FRKMFE
2d4hB           LAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQPL
2axzC           --SLQYFSIYLGYISIAHHYNIEVPTF-NKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSII
1e4yA           KQAKDIMDAGKLVTDELVIA-------------------------LVKERIAQEDCRNGFLLDGFPRTIP
3da4A           KGVVGTFPVSTKFTHATGDYNVITGANGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKEY
3d7wA           -------GAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIPL----------GIDQLIQSVTALRFPGG
1e0jB           EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELF--------GNDTFHLYDSFAEAETDRLLAKLAYM
3bb1F           GFTLNIIDTPGLIEGGYINDMANIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNK
3cr7C           KDLGFSEADRNENIRRIAEVAKFISPYRKDRDTARQLHEVTGLPFVVPVEVAEQRDPKGLYKKAREGVIK
2d3wC           EDRAGEGQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRDLMEEKIALLKMPEDLLTRSVNVGFSGGEK
2a2zD           PERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRY----IFASNLYESECMNETEWTIYQDWHD
3d3kA           NHDVQVIL---FLPNFVKMLESITNELSLFSKTQGQQVSS-LKDLPTSPVDLVINCLDCPENVFLRDQPW
3bgwD           RLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGE--------ISNSNINIFDKAGQSVNYIWSKTRQTK
3cddF           ELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDN----VKAARGRFSWRQRFSKFTIKAAGIK
2c4rL           SRPAPFLIHQSNVIVRAFRDYLRQDIGEILIDN-PKVLELARQHIAALGRP-DFSSKIKLYTGEIPLFSH
3dt4C           LRAINPENGFFVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN--KEW
3clvA           DNYIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLD---RAKTWVNQLKISSNYIIILVANKIDKN
3dt7A           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE-GIDEPLAPGVTITSWKNKEW
2awoC           RGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQR---------VNQVAEVLQLAHLLDRKPKALSGGQR
3bh0A           RLIVTAGSI--------NAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTK
421pA           LDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAA
3dhwC           LTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQK
3bb1G           FTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNK
1e9sD           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV------------------------PRGKTDEAE
2bkiA           LLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASE
1e3aB           KVYNPQSLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDP
3bm2B           --------LELLINRRSASRL---AEPAPTGEQLQNILRAGRAPDWFVIEGEGRERFSAEQGAIAAGSDD
2bofX           -----IRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPI----LVVSNAPGRDCGAPSHSAYR
3bo6B           VQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKP-DQENSQYSASSLHNTR
2bbsB           SQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKF-----------AEKDNIVLGGITLSGGQR
3czpA           YLWRFWRHIPARRIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQ
2aumA           -------SDQTWQPIDGRVALIAPASATEVLEATLRQLEVHGV-------DYHLGRHVEARYRYLAGTVE
1d6jB           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISQLHEVATPGEETGLPF--VEVYVDVP---------
3cmvB           RKLGVDIDNLLCSQPDTGEQALEIC-DALARSGAVDVI-------VVDSVAALTPKAEIGLAARMMSQAM
2b92B           KPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTSSFVSFFP
3ec1A           PLESGATLYDTPGIINHQMAHFVDAR----DLKIITPKREIHPRVYQLNEGQTLFFGGLARLDYIKGGRR
3bgwA           RLIVTAGSINAQKIKAARRD--------------FASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWS
3bpbA           RRGETEIIEETV---------QRFYPGKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAIL
3cmvE           RKLGVDIDNLLCSQPDTGEQALEICDALARSGAV-----DVIVVDSVAAL-TPKAEIEGLAARMMSQAMR
1dhjA           -------------------------------------------NAMPWNLPALAWFKRNTLDKPVIMGRH
2a2zA           QMMYEKPERWSFTFQTYACLSRI----RAQLASLNGKEKPVLFFERSVYSDRYIFASNLY---ESECMNE
2a5jA           QIWDTAGQESFRSITRSYYRGAAGALLVYDITR-RETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR
2d4hA           KKILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDESA
1dhiA           ------------ISIAALAVDRVIGMENAMPW----NLPASLAWFKRNTLDKPV-----------IMGRH
2b8tC           LPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEGPIA
3c8uA           LEPRGLLPRKGAPETFDFEGFQRLCHALKHQERV-------------------IYPLFDRARDIAIAGAA
2d3wD           EGIFMAFQYPVEIPGVSNQFFLQTALNYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEK
1e2hB           ETIQGEISAGDA-AVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARY
1e9sJ           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV------------------------PRGKTDEAE
1cr1A           EDLIGLHNRVRLRQ------SDSLKREIIENGKFDQWFDELFGND---------TFHLYDSFAEAETDRL
3cbnA           HRTTFEVTVDPEI---GETADCIIGVSSSDSIDEKRAIARESLVRVILRTENGYDEIRGYGHPELTLDHP
3bb1H           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAISFGKGIWNK
3cnlA           LYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFE--IFARSIGIESSFSEFFEDFARKRGLLKKGGVP
3cr7A           -KDLGFSEADRNENIRRIAEVAKLFADSNSIAITSQLHEVTGLPFVVPVEVAEQRDPKGLYKKAREGVIK
2a30D           QMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYECMNETEWTIYQDWHD
1e3mB           HPVVEQVLNEPFIANPSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTFV
2d0kA           ----------------ALAVDRVIGNENALPW----NLPADLAWFKRNTLNKPV-----------IYGRH
3cmxA           RK-LGVDIDNLLCSPDTGEQALEICDADVIVVDSVAALTPKAEARMMSQAMLKQSNTLLIFINQIRNPET
1e6cA           VVAAERRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRSLQAHQRPTLTGR
2dflA           FRWERIENMAKALG-----LDIDNVMNNIYYIRAINTD--------------HQIAIVDDLQELVSKDPS
2a30A           QMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESEIYQDWHD
2cckB           LEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAING
3d31A           HDIAFVYQNYSLFPHMNVKKN--------LEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSGGEQ
1ai4B           PASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQ---TSRQDLNLRLFLPTLQAATSGLTQSDP
2dr3C           -QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEY--------------------EKYIVHDLTDIREF
3dffA           ---VLVYTVFAGAAQPAAQRHTIWGLAPDDDAV-LYRRKED---IAALDHLRVAHRHGRFLDSIYRKLPD
1e2fA           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLS------QGVTLVVDRYAFSGVAFTGAKENFSLD
2awoA           RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVI-----NQRVNQVAEVLQLAHLLDRKPKALSGGQR
2ausC           ------------IKREVIVKDDKAETNPKWGFPPRPIELHIQYGVINLDKPPGP----------TSHEVV
2bdtA           WESDELTVNFLLAQNDVVLDYIAFPDEAEALAQTVQA-----KVDDVEIRFIILWTNREELLRRDALRKK
2dr3B           NMAQFGWDVKPYEEKG---------------------------MFAMVDAFTAGIGEKYIVHDLTDIREF
1d6jA           KDLGFSEADRNENIRRIAEVAK------------LFADSNSIAITSFISPYRKDRDTARQLHEVATPGEE
2bbtB           CSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEK-----------DNIVLGITLSGGQR
3cr7D           KDLGFSEADRNENIRRIAEVAKPYRKDRDTARQLHEVAEETGLPFVVPVEVAEQRDPKGLYKKAREGVIK
2d3wA           MAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEK
2bx2L           --PAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPD-FSSKIKLYTGEIPLFSH
2a30B           EKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHD
2d4uA           RAGIRYMMDQNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQST--AAAAEIKRNYDIYHNALA
2b8wB           PHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYN-----SIGTINQQAMDQLYYVTEL
3ch4B           GLNFQYKEAFRKDMIRWGEEKRWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDD
3ed8A           GDGPVLLPDNHYLSYQTVLSKDP--NEKRDHMVLLEFVT-------------------------------
2b8tB           SVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIA
1e9rE           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV------------------------VPRGKTDEAE
3bb1D           AGFTLNIIDTPGLIEGGYINDLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALDEFFSKRSEALLQVVR
1afrA           RELRESPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYT
1eilA           -------------------------------YLGFAVKDVPAWDHFLTKSVGLM-----------AAGSA
2awnA           RGVGMVFQSYALEVI-----------------------------------------------NQRVNQVA
2c0bL           SRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPD-FSSKIKLYTGEIPLFSH
1d8jA           -------------LSGSSGYKF------GVLAKIVNYMKTRHQRGD--THPLTLDEI-LDETQHLDIGLK
1bg0A           TLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPLTGMSKATQ
3dfqA           ----------------------------------------------------------------TPEQKK
1e9sB           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALITPSMR
3cmtD           RKLGVDIDNLLCSQPDTGEQALEICDALAVVDSVAALTPKAEMGLAARMMNLKQSNTLLIFINQIRMKNP
1av6A           NGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLS----NYALQNVMISILNPVASSLK
3dm9B           --AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDV-----------------VLIDTAGR
1e9sH           RDKDIILPYDQRTKGWSFFNEINDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMR
2aunA           --------DQTWQPIDGRVALIAPAIATEVLEATLRQLEVHGV-------DYHLGRHVEARYRYLAGTVE
3di4A           VTTGERLWSNPYLRPATIIEDTLGWYGIDQYGGSHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADH
3bczC           AKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSIE
1e2iB           RVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPH-----------IGGEA
3cr7B           KDLGFSEADRNERIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLVEVYVDPVEVAEQRDPK
1e9rD           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVV------------------------PRGKTDEAE
3cm0A           GERVRPIMERGDLVPDDLILELGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEE------------EL
1e59A           SVLVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKY----GDEQVKQWRRGFAVTPPELTKDDER
2boeX           ------FYVNPNM---SSAEWVRNNPNDPRTDRIASVPQGTWFAH--------------HNPGQITGQVD
2ck3C           QKRSTQLVKRLTDADAMKYTIVVSATASDAAPLQY-----------------------------LAPYSG
2bhjA           TRGPRDKPTPLEEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTY-----------QLTLDELIFATK
2a1fF           -----------------------------------------------------------------SQPIY
1e1qB           RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYALIIYDDLSKQAVAYRQMSLLLRRPPGREAY
1b0uA           GQLKVLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQ
3d3qB           TEEEGIPHYIDILPPDASFSAYFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVKLKL
1ckvA           SELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSE-LMGLDRK--------------------------
2cvfA           AETRGLNPEEALSRFILFTPSDFKEQRNFALVVVDSITAHYRAEENRSGLIAELSRQLQ--VLLWIARKH
2dr3F           VQVRQNMAQFGWDVK-----------------PYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIREF
1e2gA           LLSSYLQKKSDVEDHSVHLLF------SANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLD
3adkA           GKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDG--YPREVKQGEEFERKIGQPTLLLYVDAG
3dfnC           ----------------------------------------------------------------TPEQKK
2drcA           ----------------ALAVDRVIGMENAMPF----NLPADLAWFKRNTLDKPV-----------IMGRH
2d2fA           DERARKGLYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGEK
1cjaA           GNLDNIMLSERGATVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDIITLYTG------
3cnnA           GILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGGVP
1cfrA           RDFIGGKISDGSFNKCGDWYEWLIGIREFFLESETNFIMSIYKSCLSEFIYDLRSKLSLNNVNLITSNPD
3b55A           -------------------------------------------YNTNQIAKWLEAHAKPLKTTNPTASLN
1bglA           -------------------------------------------------------------DIGVSEATR
3dlbB           AFLLEVDPAYRILCEMSLEAWLAQGHPLPKRRRTWELLRLGEEDPKELPLPGG--LSLLDYHASKGRLQG
3a00A           GKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGS---------------TVASVKQVSKSGKTCILDIDM
1ak2A           KKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIP
1culC           VAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF----------------------------------
3cueF           LQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDK
3dfnA           ----------------------------------------------------------------TPEQKK
2dr3D           -----------PVQVRQNMAQFGWDVKPYEEKGMFAMVD-----AFTAGIGKSKEYEKYIVHDLTDIREF
1cr2A           EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYD----------------SFEAETDRL
2d2eA           DERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGEK
1aldA           ----------------------------------------------------------------TPEQKK
1e2kA           ANIYTTQHRLDQGE-----ISAGDAAVVMTSAQITMGMPYAVTDAVLAP--------------HIGGEAG
2c7cH           SVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLDELDVVEGMQFDRGYLSPYFI
6aldA           ----------------------------------------------------------------TPEQKK
3dfpD           ----------------------------------------------------------------TPEQKK
1e9rF           RDKDIILNPDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLAL--IGTP
2bkeA           QLPPEKGGLSGKAVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSKDPS
3dfoD           ----------------------------------------------------------------TPEQKK
1e9sI           RDKDIILNPYQRTKGWSFFNEIRNDYDWQRY-------------------------ALSVVPRGKTDEAE
1draA           ----------------ALAVDRVIGMENAMPW----NLPAELAWFKRNTLDKPV-----------IMGRH
1e9sL           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRETAKKLALIGTPSMRELF
3dfqD           ----------------------------------------------------------------TPEQKK
3dftC           ----------------------------------------------------------------TPEQKK
2a1fD           ----------------------------------------------------------------------
2dftC           IFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAAHTVVYLEISAAEGVRRTGGDRAEKYR
3dauA           ------------ISIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPV---------------IMGRH
2bbtA           IMPGTIKENIIGVSYDEY----------------RYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQR
3dfnD           ----------------------------------------------------------------TPEQKK
1dvrA           GLEAKKIMDQGGLVSIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVD
1e9rG           DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRAEEWASYGRLLLRETAKKLALIGTPSMRELFH
3dfpC           ---------------------------------------------------------------LTPEQKK
2aunB           ----------TWQPIDGRVALIAPASATEVLEATLRQLEVHGVDYHL-------GRHVEARYRYLAGTVE
3dftD           ----------------------------------------------------------------TPEQKK
1dekA           FAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGFVFDDEGKESVNFVAFNKITDVINN
1e9sE           RDDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV-----------------------------------
2a2zB           QMMYEKPERWSFTFQTYACLSRIR-----AQLASLNGEKPVLFFERSVYSDRYIFASNLYESTIYQDWHD
2dftA           QEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGG---NDRAEKYR
3a00B           GKDYNFVSVDEFKSMIKNNEFIEWAQFS---------------GNYYGSTVASVKQVSKSGKTCILDIDM
2czvB           KSYLIYVESNDLRVIRYIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLY----SNPYERANLLRF
1cr0A           EDLIGLHNRVRLRQS---------------DSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL
2d4uB           ---IRYMMDQNNIGGSTVAELMESASIADYEALPRDPRQSTAAAAEIKRNYDIY-----------HNALA
3d1mA           ----------------------------------------------------NVAEKTLGASGRYEGKIT
2e85B           ----------------------------------------------------------------IDGGSA
1eamA           NGLRDVTLVTRFVD-----EEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSL
3czjA           -------------------------------GDKKQLLTPLRDQFT---------RAPLDNDIGVSEATR
1adoA           ----------------------------------------------------------------TPEQKK
2bjbA           LRELGVAVDGTGLPFRVR---------------GNGSLAGGTVAIDASASSQFVSGLLLSAAS--FTDGL
1bmfC           RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQY-----------------------------LAPYSG
3bk7A           ------PQYIKAEYEGTVYELLSKIDSSKLNSNFYK---------TELLKPLGIIDLYDRNVEDLSGGEL
3brwA           -CRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLG
2aumB           --------DQTWQPIDGRVALIAPASATEVLEATLRQLEVHGVDY-------HLGRHVEARYRYLAGTVE
1cs4C           VAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF----------------------------------
1ek0A           HTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIVKELHEQASKDIIIALVGNKIDLQEGGE
3dymA           ----------------------------------------------------RDQFTRAPLDNDIGVSEA
1e4vA           GKQAKDIMDAGKLVTDEL----VIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDV
5dfrA           -------------------------------VIGPWNLPADLAWFKRNTLDKPV-----------IMGRH
2ccjA           VPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPA----LKEGKVVLCDRYIDSSLAYQGYARG
1e2iA           GDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVL
3d1mB           -------------------------------------------------IPNVAEKTLGASG-RYEGKIT
4dfrA           ----------------ALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPV---------------IMGRH
2bhvA           ---TPISSQIAGKVIAQVESDIFAHM------------------GKAVLIPKGSKVIGYYSNNNKMGEYR
2dpyA           NILGPDGRARSVVIAAPA--DVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIAL---
1akeA           GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMK---EAGINVDYVLEFDVP
3dm5B           QLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDI---------------------IIVDTAGRH
2b8tD           GTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANIFVVIISGLDKNFKGEPFGPIA
3cmwC           ARKLGVDIDNLLCQPDTGEQALEICDALARSGAV-----DVIVVDSVAALTPKAEIE----GEIGDSHMG
3ecpA           ---AKSVFSSAALGDPRRTARLVNVAAQLAKYSGKSITISSESKAAQEGAYRFIRNPNVSAEAIRKAGAM
1cjtC           MSNLVPPVELANPENQFRVDYILSVMNV------------------------------------------
1d2zD           ---TPARPVDGPGALISL----------------------------------------------------
3d3qA           TTEEEGIPHYIAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKKQVKLKLKELEE
1d6aA           QETWGKISTAIHDAKNGVLPKPLELGAKWIVLRVDEIKPDVALLNYVGGSCQ------------------
3do6A           GATGGGRSRVLPSDEINLHFTGDHAVASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTDNDRAL-----
3dyoA           -------------------------------------------KQLLTPLRDQFTRAPLDNDIGVSEATR
1e2lA           RLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAPPALTLIFDRHPIAALLCYPAARYLMGS
2bwjA           SKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDG--YPREVKQGEEFGRRIGDPQLVICMDCS
1drbA           ----------------ALAVDRVIGMENAMPW----NLPACLAWFKRNTLDKPV-----------IMGRH
1e2jA           YTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYP
1dyhA           ----------------ALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPV---------------IMGRH
3dfqC           ----------------------------------------------------------------TPEQKK
3c85A           GKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKG
3bwdD           LRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAP----GVPIVLVGTKLDLRDDKQFFIDHAVP
3c15C           IVAAMSNLVPPVELANPENQF-------------------------------------------------
2dpyB           ENILDGRARSVVIAAPSPLLRMQGAAYATRIRGQHVLLIMDSLTRYAMAQRE------------------
2e85A           ----------------SAVTDVLLC------------VGNSMMGDAGPLLAEKCAAAPKGNWVVIDGGSA
2a1fE           ----------------------------------------------------------------------
2d7vA           AHENCFIANS------------------------------------------------------------
3bv4A           ----------------------------------------------------------------TPEQKK
2bv7A           WLKRGLRFIQVFL------QSICDGERDENHPNLIRVNAT----------------KAYEMALKKYHGWI
2ancD           HGEHYFFVNHDEFKEM------ISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQ
1dekB           --ALAYAWGVFAANDYPLTRKEFEGIDY--DRETNLNLTKLEVITIMEQAFCYL-----------NGKSP
2b0lC           ----------------------------------------------------------------------
2ancF           QIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDL
3c14C           ETIVAAMSNLVPPVELANPENQFRVDYILSVMNVP-----------------------------------
2awoD           PSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHY
2d7vB           AHENCFIANS------------------------------------------------------------
2bhvD           -NKLLRTITADKMIPLITPISSQIAGKVI-----AQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGYR
1cjuC           TIVAAM-SNLVPPVELAN----------------------------------------------------
3cqcA           AYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVL
2cbzA           IQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNA
2anbA           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV------DVFLDIDWQGAQQIRQ
3dfdA           REAYKTEDPVEVAKRVSVGGE---------YANWLNKAIEINGFD-------------------------
1e9sM           RDDIILNPYDQRTKGWSFFNEIR------NDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLAL
3dfoC           ----------------------------------------------------------------TPEQKK
4atjA           CDASILLDNTTSFREKDAFGNANSARGFPVIDRMKAAVESACPRTVSCA---DLLTIAAQQSVTLAGGPS
2a1fC           -----------------------------------------------------------------SQPIY
2aexA           ----------------------------------------------------------------------
3cd9A           PDNHYLSTC--SALSKDPNEK-------------------------------------------------
3cioD           FTVSNEHGLSEYLAGKDELNKVIQHFKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAHYDLVIVDTPPM
1e2mB           QHRLDQGEISADAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAAL-LCYPAARY
3be4A           IIESGNFVGDEIVLGLVKEKFDLGVCVNGFVRTIPQAEGLAKILSEIGDSLTSVIYFIDDSEIRIS-GRC
3crmA           PSRELLARYPHRLIDIDPAESYSAAEFRAD-----------ALAAMAKATARGRIPLLVGGTMKALLEGL
3b9qA           GDTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIA
2c9gA           ----------------------------------------------------------------------
3cddA           TISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGI-KVIVNTDVGEPFQR----IQIEQGET
1dp0A           ---------------------------------------------LLTPLRDQFTRAPLDNDIGVSEATR
3cmuA           RKLGVDIDNLLCSQPDTGEQALEIC----------DALARSGAVDVIVVDSVAALTPKAEEGEIGDSHMG
1e9rB           RDKDIILNPDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALI--GTP
3cphA           KLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMET
1c9kC           WRTA--RHLDTLITADLAPDDAILLECITTMVTNLL---FALGDPEQWDYAAMERAIDDEIQILIAACQR
2bboA           IMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDA
3e8aC           TI-VAAMSNLVPPVELAN----------------------------------------------------
1azsC           TIVAAM-SNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNE-----
2an9A           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV------DVFLDIDWQGAQQIRQ
3b85B           GFLPDPYLRPLHDA-------------LRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTT
1e2kB           SETIANIYTTQHRLDQGEI-SAGDAAVVMTSAQITMGMPYAVTDAVLAPH---------------IGGEA
1e2lB           SETIANIFTTQHRLDQGEI-SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGS-----PPALTLIF
2ancB           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSR------EAIEQVLATGVDVFLDIDWQGAQQIRQ
3bjqB           ----------------------------------------------------------------------
2bhvC           ---TPISSQIAGKVIAQVESDIFAHMGKA-------------------VLIPKGSKVIGYYSNNNKMEYR
1e2nA           ANIYTTQHRLDQGEVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFD-----------RHPIA
2c9oA           TEVLMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLK---TAKGTKQLKLDPSIFESLQKERVEAGD
1dw9A           LLLQIPLRGCI-DDRIPTDPTYRFYELQVYGTTLKALVHEKFGDG-------------------------
3c7kA           MDTLGVEYGDKERK--------------------------------------------------------
1e2nB           YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPLIFDRHPIAALLCYPAARY
1e9sA           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPREEWASYGRLLLRETAKKLALIGTPSMRELFH
1e2mA           YTTQHRLDQGEISAGDAAVVMTS--------AQITMGMPYAVTDAVLAPHIGGEAGS----------PPA
3dmdA           ----------------------------------------------------------------------
3cddE           GGITGYVDDVPSYDESTI--TISVSGVDCSIDYPSGQFNNQTLTQIADIVPFGIKVIVNTDVIQIEQGET
1ckeA           ASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDM
3dvlD           ARSFGWDLAKLVDEGKLFILDASP------DPEGQEVVGGFDLSALIERINYAIQ---------------
1e2hA           YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDPAARYLMGSMT
1chdA           ----------------------------------------------------------------------
1bccF           ---NAAGFNKYGLMDDTIYENDDVKEAIRRLPENLYD-DRMFRIKRALDLN-------MRQQILPKEQWT
3cbqA           KYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARS
2a5vA           APSVLLGRRDGLSREFEQRHILMARSSAISERIAGGSLAIVGV---TYQLDDGR---AVLRDHIGNIG--
3dkvA           GLEAKSYIDKGLVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRPIDYVINIQVD
2c5mD           ---------------------------------------------------------------------K
3cddB           GGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYVCKPFGIKVIVNTDVGEPFQRIQIEQGE
1cjvC           ETIVAAMSNLVPPVELAN----------------------------------------------------
3e70C           QLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNL
1e9sK           GRDKDIILNPYDQR--------------------------------------------------------
2a78A           EEVQIDILDTAGQEDYAAIRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDK
2axnA           ----------------------------------------------------------------------
2a5vB           APSVLLGRRDGLSREFEQRHILMARSSAISERIAGGSLAIVGV---TYQLDDGRAVLRDHIGNIG-----
2dykA           GLWSGDKWEKKI----------------------------------------------------------
2ax4A           EENIRRIAEVAKLFADAGLVCIFISPFAKDRENARKIHESAGLPFFE----IFVDAPLNICESRDVKGLY
2b0lB           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           GVEAKRYLDAGDLVSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDA-VLEFRV
2ax4B           EENIRRIAEVAKLFAAGLVCITSFISPFAKDRNARKIHESAGLPFFEIFVDAPLNICEDVKGLYKRARAG
2c1lA           LVVSSGNFTGPGMSQNIEASLLLDNNTTQSMGFSWNDMISEMLNQNWHIHNMTNATDERTTNLTLDETER
3ci2A           ----------------------------------------------------------------------
3cmwA           -----------------------------------QVIAAAQREGK-TCAFIDAEHALDPIYARKLGDID
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3bfkC           IIKAQIWDTAGITS--------------------------------------------------------
2cxxB           FGLPKEV---------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTI
3b5jA           QRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKI
3b60A           QRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGII
2c61B           SVTQIPILSMPGDDITHPIPDLSGYITEGQI---VVARELHRKGIYPPINVLPSLSRLMNSGIGAGKTRE
3cmvC           KLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGEETRVKVVKNKIAAPFKAEFQILYGEGI
2d3wB           KRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKDYVHVLYQGRI
3cmvG           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGVKEGENVVGSETRVKVVKNKIAAPFKQAEFQ
2dwoA           ERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPL
3eiuA           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA----RELHRKGIYPPINVLPSLSRLNSGIGAGKTRE
3cmvH           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKGENVVGSETRVKVVKNQAEFQILYGEGI
3dmdC           TNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEKIDGIILTKLDADARGGALSISYVIDAP
1e69A           ALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVVNGV-
2dwpA           ERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPL
2ccgB           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDEKVIEGYQEIIHNEQRFKSVNADQP
2ccjB           ALNEFAINGLYPDLTIYLNVSAEVGRERIIKNN------RLDQEDLKFHEKVIEGYQEIQRFKSVNADQP
2ccgA           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKN--SRDQNRLDQEDLKFHEKVQEIIHNESQRF
2akaB           QIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGDARDVLENKLL
2b8tA           KLFTYADKITKLTAICNECGAEAT------HSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRP
3c95A           QRWLEHRRQVFTPE--FLQGYADELQMLVQQYADDKEKVAL-----------------------------
3eiuB           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH---RKGIYPPINVLPSLSRLMNSGIGAGKTRE
2c03B           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVLTKLDGDARGGALSARHVTGKP
1bifA           ERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDVNRDSDEATEDFMRRICYENSYESLDE
3dm5A           EMKQISNVIHPHEVILVIDGTIGQQAYNQALAF-----KEATPIGSIIVTKLDGSAKGGALSAVAATGAP
2b8wA           TLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRIRKFFPKKKCFVFDRPHRRKLAQLEKL
3cmvA           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAKEGENVVGSETRVKVVKNKIAAPFKQAEFQ
4dcgA           MLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNDYPNQEYDYFHMYFM
3dmdB           TNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEKIDGIILTKLDADARGGALSISYVIDAP
1d1cA           AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKF
2bifA           ERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLSPDYVNRDSDEATEDFMRRICYENSYESLDE
2bbsA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHKKADKILILHEGSS
2czvA           MMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVV--IGMEIPQAKASIS--MYPEIIL-------
2c03A           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAEKVGVTGLVLTKLDGDAGAALSARHVTGKPI
2ahvA           TKEDLIKLVEFDNKEYLYYKAIIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMV
1e9cA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKDTLNWKMVDASKS
2c9yA           DSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYY
2cjwB           AVVFDCKFIETSAAVQHNVKEL------------------FEGIVRQVRLRRDSKEKNERRLAYQKRK--
1e98A           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKDTLNWKMVDASKR
2bc9A           QAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLK----------
1e0jA           RSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSVVLVVICHLKNPDKGKDTIIALERNQQ
2d62A           QRVALGRAIIRR-PKVFLDEPLSNLDAKLRVKRAELKKLRQLGVTTIYVTHD--QVEATGDRIAVNKGEL
3b2qB           SVTQIPILSMPGDDITHPIPDLSGYITEGQIVV----ARELHRKGIYPPINVLPSLSRLNSGIGAGKTRE
2dr3A           IEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSGFGPGVDGIIRLDLDEI
2c61A           LRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSQIPILSMPGDDITHPIPDLSGYITEGQIV
2a5gA           HEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEG-------------------------------------
2ahwD           TKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMALVIAQAVHNNGGIVMMQVQKMV
1dkiA           QRALKENFGYNQSVHQINRGDFSK-----QDWEAQIDKELSQNQPVYYQGVGKVGGH-----AFVIDGAD
3b85A           SKVVTGD-GLRLVRHILRGVDDVHFSELTSSDVVRQLVGHIVDA--------------------------
3dtbB           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMRSEAKVI
1e9fA           WCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQELMKDTTLNKMVDASKSIEAVHEDIRVLSEDAIAT
2cgtH           NKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLAEDVEGEALATLVVNTRGIVKVAAVKA
1e2dA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE---RYENGAFQERALRCFHQLMKDTLNWKMVDASKS
3bb1E           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASKKASDIPVVLIENSGRCNKNDSDEKVLPNGIA
1e9sG           SMRELFHWTTIATFDDLRGFLEGTLAESLASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNL
1e9rA           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASLTSARFVLSDKLPEHVTMPDGDFSIRSWL
3bb1A           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKV-LPNGIA
3cddC           PHELLARL-AKQRGVLLTSDTFGNLVITRASKTKAGV-SLILGDNVKAARGRFSWRQRFSKFTIKADSAG
3czpB           ERF-KEREKTPYKRYKITEEDWRNRDKWD--QYVDAVGDVDRTSTEI-APWTL--VEANDKVKVLRT---
2dr3E           IEVLRQAIRDINAKRVVVDSVTTLYINKPAMQLKRVLAGTGCTSIFVSQVSVGPGVEHGDGIIRLDLDEI
2awnB           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHDQVEAMTLDKIVVLDAGRV
2ctsA           LSAAITALNSESNFARAYA-EGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDW
3b2qA           RQMGAAR---NEVPGRRGYPGYMYTDLATLYERAGIVKGKGSVTQIPILSMPGDDITHPIPDLSGYITEG
3dt2A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMAEHKGKV
2c04A           IDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVLTKLDGDARGGLSARHVTGKPI
2awnC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHLGRTMIYVTHDQVEAMTLDKIVVLDAGRV
3cddD           PHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLI-LGDNVKAARGRFSWRQRFSKFTIKDSAGL
2c9oC           CFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQ
1accA           IAVGADESVVKEAHREVINSSTEGLLLNIDKDI----RKILSGYIVEIEDTEGLKEVINDRYDMLNISSL
3a1wA           DEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ----------------------------
2akaA           EEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQ--AMDIVGFSQEEQMSIFKIAGILHLGNIKF
3bjdB           QEIAAQSRERHPSQYFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAALARYLYGELGEE
1e9dA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKDTLNWKMVDASKS
2cckA           YARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERRLDQEDLKFHEKVIEGYQEIRFKSVNADQPL
2awnD           AQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMRQQVWLPVESRDVQVGNMSLGIRPEHL
3bb1B           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDELPNGIAWIPHLV
1cr4A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKS-TGVVLVVICHLKDLRGGADTIIALERNQL
3bb1C           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKVLPNGIAW
3dt4A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMAEHKGKV
2bkhA           DIRERLHLSSPDNFYLNRGCTRYFANKETDKQILKSPEYLKAGSLKDPLLDDHGDFIRMCTAKKIGLDDE
2eg5G           SRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCI--CKGVELDARNAIDLLEMAINDLVVEGHLE
1dg3A           DFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPEFV
1e3mA           ETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLIKALTLFATHYFELTQLPKEGVANVHLDA
1e9sF           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGSNEKALTSARFVLSDKLP
2axpA           DSILELYREVSNAGLHTYSWDTGQWSSDEIAKDI------------------------------------
1aroP           RQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKEAVAYITIKTTLACLTSANTTVQAVASAI
2d4hB           TPDEYLTYSLKLKKCFVFDRPVHRRKLAQLEKLQDEELDPEVQQVADFCSYIFSNSKTKGGIQVNGPRLE
2axzC           KPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFNISINGYYDLEINYLKQIYQFLTDNAV
1e4yA           QADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQE
3da4A           QILLPGEIHIKES---------------------------------------------------------
3d7wA           QTKTQARSILIL--IQMISEAARFNPI--LWRARQYINSG---ASFLPDVYMLELETSWTQVQHSTDGVF
1e0jB           RSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSVVLVVICHLKNPDKGKDTIIALERNQQ
3bb1F           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKV-LPNGIA
3cr7C           EFTGISA-PYEAPANPEVHVKNYELPVQDAKQII----DYLDTKGYL-----------------------
2d3wC           KRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRI
2a2zD           WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLESWLLHRTLKTNFDYLQVPILTLDVNED
3d3kA           YKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEGINYHSPFG--
3bgwD           RKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQDLKKMARELDVVVIALSQLSRQVEQQDKRPMLSDLRQ
3cddF           ADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNIPVIDEIGL
2c4rL           YQIESQIESAFQSGGSIVIDSTEALTAIDINSARGDIEEFNTNLEAADEIARQLRLRDLGGLIVIDFIDM
3dt4C           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFV-----------
3clvA           FQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNII------------------------
3dt7A           RPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIAGVPLVYEALSWQHGVFVGAAMAEHKGKV
2awoC           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHDQVEAMTLDKIVVLDAGRV
3bh0A           RKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMLDVVVIALSQLSRQVEQRDKRPMLSDLRE
421pA           RTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR----------------------------
3dhwC           QRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDRRLGLTILLITHEMDVKRICDCVAVISNGEL
3bb1G           AIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--SDIPVVLIENSGRCNKNDSDEKVLPNGIA
1e9sD           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIDLRGFLEGTLAESLFAGSNEASKALSARFVLSDKLP
2bkiA           DIRERLHLSSPDNFRYLNRGCTRYFANKETD----KQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTA
1e3aB           RRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLT-SMLKRVAAVPMPFDKWYSASGETTQDGPTGSL
3bm2B           KAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVVREAFGCREQDK
2bofX           SWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQAFDAGHSAWHSPAWL
3bo6B           QFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRN-ELRSGRD---GGEMQSQALREEPFY-------
2bbsB           ARISLARAVYKDADLYLLDSPFGYLDVLTKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
3czpA           ERF-KEREKTPYKRYKITEEDWRNRDKWDQGDVDRTSTEIKRFARVKVLRTINDAIEAAY----------
2aumA           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFAD----ISVLLSAFHRHGLP
1d6jB           VEVAEQRAPYEAPANPEVHVKNYELPV---QDAVKQIIDYLDTKGYL-----------------------
3cmvB           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQ
2b92B           DFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETLCIRKFFPKKKCFVFDRVHRRKLAQLEK
3ec1A           SFVCYMANELTV-HRTKLEKADSLYANQLGELLSPPS-KRYAAEFPPLVPRSLSVKERKTDIVFSGLGWV
3bgwA           KTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQRELDVVVIALSQLSRQVEQRDKRPMLSDLRE
3bpbA           EKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKEFQDFNIIEIPEEES---YAANCIWVNERVI
3cmvE           KLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVGENVVGSETRVKVVKNKIAAFKQAEFQILYG
1dhjA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAADVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
2a2zA           TEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRLRGRNEEQGIPLELEKLHYKHESWLLHRTLK
2a5jA           RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRK--------------------------
2d4hA           DFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEK
1dhiA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVIMVIGGGRVYEQFLPKQKLYLTHIDAE
2b8tC           KLFTYADKITKLTAICNECGAEATHSLRKIDGKHADY------NDDIVKIGCQEFYSAVRHHHKVPNRPY
3c8uA           EVGPECRVAIIEGNYLLFDAPGWRDLTAIIRLEVPADLEARLVQRWLDHGLNHDAAVARQGNDLANARAI
2d3wD           KRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIDYVHVLYQGRI
1e2hB           LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAIRRVYGLLANTVRYLQCGGS
1e9sJ           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASARFVLSDKLP
1cr1A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKS-TGVVLVVICHLKTDRQLSDTIIALERNQL
3cbnA           TDIVCRKSDYICSRTLIRADKAAFDLDENLVRD-------LRKGRELKVEIIV-----------------
3bb1H           AIVALTHAQFSPPDGLPYDEFF--------------SKRSEALLQVVRSGASLKKDSDIPVVLIENSGRC
3cnlA           DIERALMLFFTEVGRVSFERPE------------------------------------------------
3cr7A           EFTGISAPYEAPANEVHVKNYELPVQDAVKQII-----DYLDTKGYL-----------------------
2a30D           WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLESWLLHRTLKTNFDYLQVPILTLDVNEY
1e3mB           ETETANILHNATEYSLVLDEIGRGTSTYDGLSLCAENLANKIKALTLFATHYFELTQLPKEGVANVHLDA
2d0kA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIFVIGGGRVYEQFLPKQKLYLTHIDAE
3cmxA           TTGGNALKFYAS-VRLDIRRIGAVKEGENVVGSE----TRVKVVKNKIAAPFKQAEFQIYGEGINFYGEL
1e6cA           PIAEEMEAVLREREALYQDVAHYVVDAQPPAAIVCELMQTMR----------------------------
2dflA           IKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVIAVIITNQVMHTLYHVGIRIQLKKSRG
2a30A           WMNNQFGQSLELDGIIYLQATPETCLHRIEQGIPLEYLEKLHYSWLLHRTLKTNFDYLQVPILTLDVNEY
2cckB           LYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEQEIIRFKSVNADQPLENVVEDYQTI-------
3d31A           QRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKLTVLHITHDQTEARIMDRIAVVMDGKL
1ai4B           RRQLVETLTRWDGINLLNDDGKTWQQPGSAILVWLTSMLKRTVVAAVPMPFDKWYSASGETTQDGPTGSL
2dr3C           IEVLRQAIRDINAKRVVVDSVTTLYINKPSIILQLKRVLAGTGCTSIFVSQVSGVEHGVDGIIRLDLDEI
3dffA           GRWLTAHVEGRQKLAVNDHSPDSDHDL--VGEVADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAALF
1e2fA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ-ERALRCFHQLMKDTTLNWKMVDASKSI
2awoA           QRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHDQVEAMTLDKIVVLDAGRV
2ausC           AWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLAGKEYVALMHLHGDVPEDKIRAVMKEFEG
2bdtA           GERCLELVE--EFESKGIDERYFYNTSHLQPTNLNDIVKNLKNPRFI-----------------------
2dr3B           IEVLRQAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGCTSIFVSQVSVGERGFPGVEHGVDGII
1d6jA           TGLPFVEVYVDVPVEAPYEAPAVKNYELPVQDAVKQIIDYLDTKGYL-----------------------
2bbtB           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCLMANKTRILVTSKMEHLKKADKILILHEGSS
3cr7D           EFTGISAP-YEAPANPEVHVKNYELPVQDAKQII----DYLDTKGYL-----------------------
2d3wA           KRNDILQMAVLEPELCILDESDSGLDIDALKVVAGVNSLRDGKRSFIIVTHYQRILDYIDYVHVLYQGRI
2bx2L           YQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDIN-SARGDIEETAFNTNLEAADEIRQLRLRDLGGL
2a30B           WMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKLHYKSWLLHRTLKTNFDYLQVPILTLDVNEY
2d4uA           ELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYM-EQNDRDIAVSDNN-------------------
2b8wB           THRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTLKLKKGTSQKDETFNLPRCIRKFFPKKKC
3ch4B           AESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRLK----------------------------
3ed8A           ----------------------------------------------------------------------
2b8tB           KLFTYADKITKLTAICNECGAEATHSLRKIDGKHADY------NDDIVKIGCQEFYSAVCRHHHKVPNRP
1e9rE           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEESLFAGSNEASKALSARFVLSDKLP
3bb1D           SGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLI--------
1afrA           SFQERATFISHGNTARQAKEHGDIKLAQICG-----TIAADEKRHETAYTKIVEKLFEIPDGTVLAFADM
1eilA           GDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADQAGVAFTRGD--EALMQRKVMGLLCLQ
2awnA           EVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHDQVEAMTLDKIVVLDAGRV
2c0bL           YQIESQIESAFQREVRLPSGGSIVIDSTEEETAFNTNLEAADEIARQLRLRDLGGLIVIDMTPVRHQRAV
1d8jA           QKQWLMTEAVNNPKIEVIDGKYAFKPKYNVR---------------------------------------
1bg0A           QQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNWVNEEDHLIISMQKGGDLKTVYKRVTAVDNIESKL
3dfqA           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYK
1e9sB           ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG
3cmtD           ETTTGGNALKFYASVRLDIRRIGAVKEGENVV---GSETRVKVVKNKIAAPFKQAEFQIYGEGINFYGEL
1av6A           WRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKS------------------
3dm9B           SETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQFNEAV-KIDGIILTKLDADARGGALSISYVIDAP
1e9sH           ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVDGDFSIRSWLEDPNGGNL
2aunA           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSHRHGLPAIHGPV
3di4A           TGLPLHEAELRDTGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA---SCHPLLVEIFAPAEG
3bczC           HLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSFRYSYYDESQGEIYRSIEHLDKGSI
1e2iB           HAPPPALTLIFDRHPIALCYPAARYLMGSMLAFVALIPPTLPGTNIVLGALPED--RHIDRLAKRERLDL
3cr7B           GLYKKAREGVIKEFTGISAPYEAPANPEVH--------VKNYELPVQDAVKQIIDYLDTKGYLPAK----
1e9rD           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLAESLFAGSNEASKALSARFVLSDKLP
3cm0A           VRRILRRAELEGRS-DDNEETVRRRLEVYREKTEPLVGEARGVLKRVDGLGTPDEVYARRAAL-------
1e59A           YPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPMKSGERVIIAAHGNSLRALVKYLDNMSEEEI
2boeX           ALMSAAQAAGKIPILVVSNAPGRDCGGGAYRSWIDEFAAGLKNAYIIVEPDLISLMSSCQHVQQEVLETM
2ck3C           CSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAKMNDAFGGGSL
2bhjA           MAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRLYATNNGNIRSAITVFPQRSDKHDFRLWNSQL
2a1fF           KRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKEVEMGVEVSVVLGGGNLFRGALAKAGMNRVVG
1e1qB           PGDVFYLHSRLLERAAKMNDAFGGGS-LTALPVIETQAGDVSAYIPTNVISITDGQIFLETELF------
1b0uA           QRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQAEEGKTMVVVTHEMGFARHVSHVIFLHQGKI
3d3qB           KELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKLLIGIESRETLYLRIKRVDILGHGLF
1ckvA           ----------------------------------------------------------------------
2cvfA           NIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDLRLDKLPKPGLRVAVLERHRFRPEGMAYFRITERG--
2dr3F           IEVLRQAIRDINAKRVVVDSVTTLYINKPAMSIILQLKRVLAGCTSIFVSQVSGFGPGVDGIIRLDLDEI
1e2gA           WCKQPDVGLPKPDLVLFLQLQLADAAK-------RGERYENGAFQERALRCFHQLMKDTLNWKMVDASKS
3adkA           PETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVAFYEKRGIVRKV-------------------
3dfnC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNCIGGVILFHETLYQ
2drcA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAADVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
2d2fA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYDKVHVMMDGRV
1cjaA           YDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESLSPQAIPFILRML-----------------
3cnnA           DIERALMLFFTEVGRVSFERPE------------------------------------------------
1cfrA           FSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDELEHIKSFLSVKTTFRPDRRLQLAHEGS
3b55A           DLKPLKNVG--SASIVGLGEATHGAHEVFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNP
1bglA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAWQHQGKTLFISRKTYRIDGSQMAITVDVEVA
3dlbB           REGGRVAWV---ADPKDPRKPIPHLTGLLVPVGSLALSLPWEERRTREIASWIGRRLGLTPEAVRAQAYR
3a00A           QGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFAE-------------------
1ak2A           DSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITLIRRSDDNKKALKIRLEAYHTQTPLVEYYSKIH
1culC           ----------------------------------------------------------------------
3cueF           RVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESM-------------------------
3dfnA           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTNTEENRRFYRQLLLTADDRVNPCIGVILFHETLYK
2dr3D           IEVLRQAIRDINAKRVVVDSVLYINKPAMARSIILQLKRVLAGCTSIFVSQVSVGERGFGPGVHGVDGII
1cr2A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKS-TGVVLVVICHLKSGALRQDTIIALERNNL
2d2eA           KRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHYILNYIQPDKVHVMMDGRV
1aldA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
1e2kA           PPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAFVALIPPTLPGTNIVLGALPEDRHIDRL--AKRQRP
2c7cH           NKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGLLIIAEDVEGEALATLVNTMRGIVKVAAVKA
6aldA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
3dfpD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
1e9rF           SMRELFHWTTIATFDDLRGFLEGTLAESL-FAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLE
2bkeA           IKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVIAVIITNQVVP--GIRIQLKKSRGNRR
3dfoD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
1e9sI           EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIADDLRGFLEGTLAESLFAGSNEASKSARFVLSDKLP
1draA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
1e9sL           HWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNL
3dfqD           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
3dftC           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
2a1fD           -QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEGVEVSVVLGGGNLFRGALAKAGMNRVVG
2dftC           ALMAKRAPLYRRVATMRVDTNRRNPGAVVRH---------------------------------------
3dauA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVAIAACGDVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
2bbtA           ARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKDKILILHEGSS
3dfnD           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYQ
1dvrA           DELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPTGIWA
1e9rG           WTTIATFDDLRGFLEGTLAESLFAGSN-EASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNL
3dfpC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYQ
2aunB           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDVLLSAFHRHGLPAIHGPV
3dftD           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNIGGVILFHETLYQK
1dekA           IEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMRAMGATVIHVVR
1e9sE           ----------------------------------------------------------------------
2a2zB           WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLESWLLHRTLKTNFDYLQVPILTLDVNED
2dftA           ALMAKRAPLYRRVATMRVDTNRRNPGAVVRH---------------------------------------
3a00B           QGVKSVKAIPELNARFLFIAPPSGAHD--KVIVNDDLDKAYKELKDFIFAE-------------------
2czvB           MMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG-VVIIPQAKASISMYPE----------------
1cr0A           LAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTG-VVLVVICHLKDLRALRDTIIALERNQL
2d4uB           ELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMNDRLHD---------------------------
3d1mA           RNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAPGVKLRVTEGWDEDGHHSEESLH-YEGRA
2e85B           PENDIVAIRERPTRLLIVDATDMGLNPGE----IRIIDPDDIAEMFMMTTHNMPLNYLIDQLKVIFLGIQ
1eamA           KWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYYLNKIVR
3czjA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQGKTLFISRKTYRIDGSGQMAITDVEVA
1adoA           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYQ
2bjbA           TVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVRRWDIEPDLTNAVAFLSAAVVSGGTV
1bmfC           CSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAKMNDAFGGGSL
3bk7A           QRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHEKNEKTALVVEHDVLMIDYVSDRLIVFEGEP
3brwA           ATSEEELFSTNE-ESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTESVYCNFRNKEIMFHDAQQLQRKRHI
2aumB           QRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSHRHGLPAIHGPV
1cs4C           ----------------------------------------------------------------------
1ek0A           RKVARGEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIPLK--------------------------
3dymA           TRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQGKTLFISRKTYRIDGSGQMAITVDVEV
1e4vA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTMTAPLIGYYSKEAEAGTKYAKVDGTKP
5dfrA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDIAACGDVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
2ccjA           IGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRQEDLKFHEKVIEGYQEIHRFKSVNADQP
1e2iA           AFVALIPPTLPGTNIVLGALPEDRHIDRPGERLDLAMLAAIRRGLLANTVRYLCGGSWREDWGQLSTGPR
3d1mB           RNSERFKTPNYNPDIIFKDEENTGADRLMTQRCKDKLNANQWPGVKLRVTEGWDEDGHHSEESLHYEGRA
4dfrA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAADVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
2bhvA           LDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTLLIGITSAFGDYLLMQLMRQSGM
2dpyA           --------AIGEPPATKGYPPSVFAKLPALVERAG-NGIHGGGSITAFYTVLTEG-DDQQDPIADSARAI
1akeA           DELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTMTAPLIGYYSKEAEAGTKYAKVDGTKP
3dm5B           KEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSVTKLDGSAKGGALSAVAATGAP
2b8tD           KLFTYADKITKLTAICNECGAEATHSLRKID-----GKHADYNDDIVKIGCQEFYSAVCRHHHKVPNRPY
3cmwC           LAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE
3ecpA           QTVKLAQEFPE----LLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQEW
1cjtC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3d3qA           YLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQDTLLIGIESRETLYRINKRVDILGHGLF
1d6aA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3dyoA           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAHQGKTLFISRKTYRIDGSGMAITVDVEVA
1e2lA           MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAMLAAIRRVNTVRYLQCGGSWREDWG
2bwjA           ADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPIAYYETKTQLHKINAEGTPEDQLCTAIDSIFL
1drbA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
1e2jA           AARYLMGSMTPQAVLAFVALIPGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLNTVRYLQCGGS
1dyhA           TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAADVPEIMVIGGGRVYEQFLPKQKLYLTHIDAE
3dfqC           ELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGENTEENRRFYRQLLLTADDRVNPCIGVILFHETLYK
3c85A           QIAAIAE-YPDQLEGLLESGVDAAFNIYSEGFARHVCKQLEPQFTSI-----------------------
3bwdD           ITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAI-RVVL----------------------------
3c15C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2e85A           PENDIVAIELRPTRLLIVDATDMGLNP----GEIRIIDPDDIAEMFMMTTHNMPLNYLIDIGEVIFLGIQ
2a1fE           -QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEGVEVSVVLGGGNLFRGALAKAGMNRVVG
2d7vA           ----------------------------------------------------------------------
3bv4A           ELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYQ
2bv7A           VQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVYTATIDVIYEMYTRMNAE----------
2ancD           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEYDYLIVNDDFDTALTDKTIIRAERLRM
1dekB           IKGVFVFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVALDYLDKFNSG
2b0lC           --------HMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIAVIVNALRKLESAGVIESRSL
2ancF           KTIIRAERLRMSRQKQRHDALISKLL--------------------------------------------
3c14C           ----------------------------------------------------------------------
2awoD           PADRFVAGFIGSPKMNFLPVKVTATAIDQVQV-----ELPMPNRQQVWLPVESRDVQVGNMSLGIRPEHL
2d7vB           ----------------------------------------------------------------------
2bhvD           LDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPLDYLLMQLMRQSGMGINQVAPIVVIREGSR
1cjuC           ----------------------------------------------------------------------
3cqcA           LFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFL---LHTILHSTGQYQECLQLADMVSSERHKL
2cbzA           DIYLFDDPLSAVDAHVGKHIFE----------NVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKI
2anbA           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKREMSHYAEYDYLIVNDDFDTALTDKTIIRAERLRM
3dfdA           ----------------------------------------------------------------------
1e9sM           IGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEKALTSARFVLSDKLPEHVTMPDGDFSIRSWL
3dfoC           ELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRFYRQLLLTADDRVNPCIGVILFHETLYQ
4atjA           WRVPLGRRDSLQLANANLPAPFFTLPQLKDSFRNVGLNSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTG
2a1fC           -----KRILLKLSGEALQGEDGLGIDPAILDRMAVEIKEVEMGVEVSVVLGGGNLFRGAKLAKAGNRVVG
2aexA           ----------EEDELAHRCSSFMAPPVTDLGELRRRPGLETQAQALAQVDGGANFSVDRWERKEGQDGCV
3cd9A           ----------------------------------------------------------------------
3cioD           LAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRL-EQAGVNIKGAILN-------------------
1e2mB           LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKDLAMLAAIRR-VYGLLANTVRYLQCG--
3be4A           THPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVRLDVFHKQTAPLVKFYEDLILKRVNAKLPP
3crmA           PYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEALHARSDLHAGLPSIRAVGRQVWDYLDGKLSYAE
3b9qA           CKKAVGKI-----VSGAPNEILLVLDGNTGLNMLPQAREEVVGITGLILTKLDGSARGGVVSVVEELGIP
2c9gA           ----------------------------------------------------------------------
3cddA           PHELLAR-LAKQRGVLLTSDTFGNLAGVSLILGDNVKAARGRFSWRQRFSKFAAKADVTDSEIGRYRPLI
1dp0A           IDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQGKTLFISRKTYRIDGSQMAITVDVEVA
3cmuA           LAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE
1e9rB           SMRELFHWTT------------------------------------------------------------
3cphA           RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEIDSNKLVGVG-----------------
1c9kC           CPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRL-AAAAD-EVWLVVSGI--GVKI-----------
2bboA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR------------ILVTSKMEHLKKADKILILHEGSS
3e8aC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2an9A           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKREMSHYAEYDYLIVNDDFDTALTDKTIIRAERLRM
3b85B           PAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSVRHQLVGHIVDAYE-------------
1e2kB           HAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR
1e2lB           DRHPIAALLCYPAARYLMG----SMTPQAVLAFVALIPPTLPGTNIVLGALPED----------RHIDRL
2ancB           KMPHARSIFILPPSKIELDRRLRGRGQDSEEVQAVAEMSHYAEYDYLIVNDDFDTALTDKTIIRAERLRM
3bjqB           ------------VDPILSTHARGYRQSTLIGKKLFPVAPVAQYGKILTFGKEAFRLYNTKRIDFGYEGDP
2bhvC           LDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY---------------------------------
1e2nA           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
2c9oA           VIYIEANS-GAVKRQGRCDTYATEFDLEAEEYVPLPKGHKKKEIIQDVTLHDLDVANGEINKVVNKYIDQ
1dw9A           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
1e2nB           LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVRYLQCG--
1e9sA           WTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP-NGGNL
1e2mA           LTLIFDRHPIAALLCYPAARYLMGMTPQAVLAFVALIPPTLPGTNIVLGALPED--RHIDRLAKR--QRP
3dmdA           ----------------------------------------------------------------------
3cddE           PHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAA-RGRFSWRQRFSKFTIKDVT--
1ckeA           GTV-----------VFPDAPVKIFLDASSEERAHRRMLQKGFSVNFERLLAEIKLVPAADLVLDSTTLSI
3dvlD           -KYRARRVSIDSVTSVFQQYDA---SSVVRRELFRLVARKQIGATTVMTTERIEEYGPIARYGVEEDNVV
1e2hA           PQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLANTVRYLQCGGS
1chdA           --------LLSSEKLIAIGASTGGTEAI--RHVLQPLPLS--SPAVIITQHMPPGFTRSERLNKLCQISV
1bccF           KYEEDVPYLEPYLKEVI-----------------------------------------------------
3cbqA           REVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIR----------------------------
2a5vA           ----------------------------------------------------------------------
3dkvA           KEELMERLTG------------------------------------------------------------
2c5mD           SCGLHVTSIKID-PYINIDAGLTKDNNLTTGKIYQERKGDYLGKTVQVVPHITDAIQEWMRQALEPQVCV
3cddB           TPHELLARLAKQRGVLLTSDTFGNLVITRASK-TKAGVSLILGDNVKAARGRFSWRQRFSKFTIKGGIKA
1cjvC           ----------------------------------------------------------------------
3e70C           VIF--------------------VGDALAGNAIVEQARQEAVKIDGIILTKLDADARGGALSISYVIDAP
1e9sK           ----------------------------------------------------------------------
2a78A           RQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRAR--------------------------
2axnA           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
2ax4A           KRAEIKGFTGIDSDYEKPETPERVLKTSTVSDCVHQVVELLQEQNIV-----------------------
2b0lB           HHH------MSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVNALRKLESAGVIESRSL
2ce2X           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
2cdnA           SEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPL--LEYYRDQLKTVDAVGTMDEVFARAL-------
2ax4B           EIKGFTGI---DSDYEKPETPERVLKTSTVSDCVHQVVELLQEQNIV-----------------------
2c1lA           VTLIVTLGHADTARIQAAPGTTAGQGTQYFWLSKDSYDFFPPLTIRNRRGT-------------------
3ci2A           ------------------------LVGKSVEEAKKVILQDKPEQIIVLPVGTIVTMEYRDRVRLFVDKLD
3cmwA           NLLCSQPDTGEQALEICALARSGAVDVIVVDSVAALSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQI
2cxxA           ----------------------------------------------------------------------
1dwmA           ----------------------------SGNMAAATVERENRNHAIVLKEGSAMTKDFRDRVWVIVNDHG
3bfkC           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EMQGSPDYLRKTNERYQKLKAIDEGR
3b5jA           VEQGKH--------------------
3b60A           VERGTHSELLAQHGVYAQL-------
2c61B           DHKAVSDQMYAGYAEGRDLRGL----
3cmvC           NFYGELVDLGVKEKLIEKAGAW----
2d3wB           VKSGDFTVKQLEEQGYGWL-------
3cmvG           ILYGEGINFYGELVDLGVK-------
2dwoA           DPDKCDRDLSLIKVIDVGR-------
3eiuA           DHKAVSDQMYAGYAEGRDL-------
3cmvH           NFYGELVDLGVKEKLIEK--------
3dmdC           ILFVGVG-------------------
1e69A           --------------------------
2dwpA           DPDKCDRDLSLIKVIDV---------
2ccgB           LENVVEDTYQTIIKYLEK--------
2ccjB           LENVVEDTYQTIIKYLEK--------
2ccgA           KSVNADQPLENVVEDTYQT-------
2akaB           PLRRGYIGVVNRSQKDIDGKK-----
2b8tA           YLNSNSEEFIK---------------
3c95A           --------------------------
3eiuB           DHKAVSDQMYAGYAEGRDLRGL----
2c03B           IYFAGVS-------------------
1bifA           QDRDLSYIKIMDVGQS----------
3dm5A           IKFIGTG-------------------
2b8wA           QDEELDPEFVQQVADFCSY-------
3cmvA           ILYGEGINFYGELVDLGVK-------
4dcgA           LRTVYCNKTPTTKAKVLFLQ------
3dmdB           ILFVGVGYDDLRPFEKEWF-------
1d1cA           EKGAGEGAVLKDKTAL----------
2bifA           EQ------------------------
2bbsA           YFYGTFSELQNLRPDFSSK-------
2czvA           --------------------------
2c03A           YFAGVSEKPEGLEPFYPER-------
2ahvA           KKATLHPKS-----------------
1e9cA           IEAVHEDIRVLSEDAIATAT------
2c9yA           RKRGIHSAIDASQTPFASILAA----
2cjwB           --------------------------
1e98A           IEAVHEEIRVLSEDAIRTAT------
2bc9A           --------------------------
1e0jA           GDMPNLVLVRILKCRFTG--------
2d62A           QQVGTPDEVYY---------------
3b2qB           DHKAVSDQMYAGYAEGRDLRGL----
2dr3A           DGELKRSLIVWKMSMRRHPFDITDKG
2c61A           VARELHRKG-----------------
2a5gA           --------------------------
2ahwD           KKATLHPKSVRIPGYL----------
1dkiA           GRNFYHVNWGW---------------
3b85A           --------------------------
3dtbB           MHDPFAMFFGYNFGKYLAH-------
1e9fA           ATEKPLGELWK---------------
2cgtH           PGFGDRRKAMLQDIATLTG-------
1e2dA           IEAVHEDIRVLSEDAIATAT------
3bb1E           WIPHLVQTITEVALNKSESIFVDKN-
1e9sG           FITWREDMG-----------------
1e9rA           ED------------------------
3bb1A           WIPHLVQTITEVALNKSESIFVDK--
3cddC           LPTVGGIKADVTDS------------
3czpB           --------------------------
2dr3E           DGELKRSLI-----------------
2awnB           AQVGKPLELYHYPADR----------
2ctsA           SHNF----------------------
3b2qA           QIVVARE-------------------
3dt2A           IMHDPFAMRPFFGYNFGKY-------
2c04A           YFAGVSEKPEGLEPFYPER-------
2awnC           AQVGKPLELYHYPADR----------
3cddD           PTVG----------------------
2c9oC           TEG-----------------------
1accA           RQDGKTFIDFKKYNDKLPLYISNPNY
3a1wA           --------------------------
2akaA           EKGAGEGAVLKDKTALN---------
3bjdB           DEKGSHPRLLAKLLEAIGL-------
1e9dA           IEAVHEDIRVLSEDAIATAT------
2cckA           E-------------------------
2awnD           LPSDIADQLGNETQIHIQIPSIRQ--
3bb1B           QTITEVALNKSESIFVDK--------
1cr4A           VLVRILKCRFT---------------
3bb1C           I-PHLVQTITEVALNKSESIFVDK--
3dt4A           IMHDPFAMRPFFGYNFGKYLA-----
2bkhA           EKLDLFRVV-----------------
2eg5G           EEKLDSFNLPVYIPSAEEVK------
1dg3A           QQVADFCSYIFSNSKTKTL-------
1e3mA           LEHGDTIAFHS---------------
1e9sF           EHVTMPDG------------------
2axpA           --------------------------
1aroP           GRAIEDEAR-----------------
2d4hB           SLVLTYV-------------------
2axzC           NIINIFKIIGK-EDIHRSL-------
1e4yA           ETVRKRLVE-----------------
3da4A           --------------------------
3d7wA           NNPIAL--------------------
1e0jB           GDMPNLVLVRILKCRFTG--------
3bb1F           WIPHLVQTITEVALNKSESIFVDK--
3cr7C           --------------------------
2d3wC           VKSGDFLVKQLEEQGYGWL-------
2a2zD           FKDKYESLVEKVKEFLSTL-------
3d3kA           --------------------------
3bgwD           LEQDADIIEFLYRDDYYDKESESKNI
3cddF           DEELIASILFSEAGRLAVI-------
2c4rL           TPVRHQRAVENRLREAV---------
3dt4C           --------------------------
3clvA           --------------------------
3dt7A           IMHDPFAMRPFFGYNFGKY-------
2awoC           AQVGKPLELYHYPADR----------
3bh0A           SGQDADIIEFLYRDDYYDK-------
421pA           --------------------------
3dhwC           IEQDTVSEVFSHPKTP----------
3bb1G           WIPHLVQTIEVALNKSESINLID---
1e9sD           EHVT----------------------
2bkiA           MKKIGLDDE-EKLDLFRVVAGV----
1e3aB           NISVGAKIL-----------------
3bm2B           IVGGTPQLVPDPTPFVTYF-------
2bofX           QQADISNSAH----------------
3bo6B           --------------------------
2bbsB           YFYGTFSELQNLRDSFDQF-------
3czpA           --------------------------
2aumA           AIHGPVATGLGLQERLASLASV----
1d6jB           --------------------------
3cmvB           ILYGEGINFYGELVDLGVK-------
2b92B           LQDEELDFVQQVADFCSYI-------
3ec1A           TCNDPGAQLVVHAPKGVDV-------
3bgwA           SGQDADIIEFLYRDDYYDK-------
3bpbA           MPAGYPRTREKIARLGYRVIEVD---
3cmvE           EGINFYGELVDLGVKEK---------
1dhjA           VEGDTHFPD-YEPDDWESVSSEFHDA
2a2zA           T-----NFDYLQEVPILTLDV-----
2a5jA           --------------------------
2d4hA           LQDEELDPEFVQQVAD----------
1dhiA           VEGDTHFPDY-EPDDWESVFSE----
2b8tC           -LNSNSEEFIKFFK------------
3c8uA           EAARLPADLT----------------
2d3wD           VKSGDFLVKQLEEQGYGWL-------
1e2hB           WREDWGQLSG----------------
1e9sJ           EHVTMPDGD-----------------
1cr1A           VLVRIL--------------------
3cbnA           --------------------------
3bb1H           NKNDSDEKVLPNGIAWIPH-------
3cnlA           --------------------------
3cr7A           --------------------------
2a30D           E-------------------------
1e3mB           LEHGDTIAFHS---------------
2d0kA           VEGDTHFPDY-EPDDWESVFSE----
3cmxA           VDLGVKEKL-----------------
1e6cA           --------------------------
2dflA           NRRIARVVDAPHLPEGEVVALTEEG-
2a30A           E-------------------------
2cckB           --------------------------
3d31A           IQVGKPE-------------------
1ai4B           NISVGAK-------------------
2dr3C           DGELKRSLIVW---------------
3dffA           ATHEKNVPVRLWEDLP----------
1e2fA           E-AVHEDIRVLSEDAIATAT------
2awoA           AQVGKPLELYHYPADR----------
2ausC           EIIQRTRKVYYIEILEI---------
2bdtA           --------------------------
2dr3B           RLDLDEDGELKRSLIVWK--------
1d6jA           --------------------------
2bbtB           YFYGTFSELQNLRPDFSSK-------
3cr7D           --------------------------
2d3wA           VKSGDFLVKQLEEQGYGWL-------
2bx2L           IVIDFIDMTP----------------
2a30B           E-------------------------
2d4uA           --------------------------
2b8wB           FVFDRPVHRRKLAQLEKLQ-------
3ch4B           --------------------------
3ed8A           --------------------------
2b8tB           YLNSNSEEFIK---------------
1e9rE           EHVTMPDG------------------
3bb1D           --------------------------
1afrA           MRKKISM-------------------
1eilA           DPFGLPLEI-----------------
2awnA           AQVGKPELYHYPADRFVA--------
2c0bL           ENRLREAVRQ----------------
1d8jA           --------------------------
1bg0A           PFSHDDRFG-----------------
3dfqA           ADDGRP--------------------
1e9sB           GNL-----------------------
3cmtD           VDLGVKKLIEKAGAWY----------
1av6A           --------------------------
3dm9B           ILFVG------VGQGYDDLRPFEKEW
1e9sH           FITWREDMGPALRPLISAW-------
2aunA           ATGLGLQ-------------------
3di4A           LGDWPSPSVNGYDRSH----------
3bczC           IEQLDPVSFSNYLKKYHNT-------
1e2iB           AMLAAIRVYGLLANTVRYLQCGGSWR
3cr7B           --------------------------
1e9rD           EHVTMPDGD-----------------
3cm0A           --------------------------
1e59A           LELNIPTGVPLVYEFDENFKPLKR--
2boeX           AYAG-KALKAGSSQARIY--------
2ck3C           TALPVIETQAGDVSAY----------
2bhjA           IRYAGYQMPD----------------
2a1fF           DHMGMLATVMNGLAMRD---------
1e1qB           --------------------------
1b0uA           EEEGDPEQVNPQSPRLQQF-------
3d3qB           NEVQHLV-------------------
1ckvA           --------------------------
2cvfA           --------------------------
2dr3F           DGELKRSLIVWKM-------------
1e2gA           IEAVHEDIRVLSEDAIATA-------
3adkA           --------------------------
3dfnC           ADDGRP--------------------
2drcA           VEGDTHFPD-YEPDDWESVFSE----
2d2fA           VATGGPELALELEAKGYEW-------
1cjaA           --------------------------
3cnnA           --------------------------
1cfrA           LMKALYTHL-----------------
3b55A           SQHLTPVFKTKELDLLDWIRQYNANP
1bglA           SDTPHPARIGLNCQLA----------
3dlbB           LSIP----------------------
3a00A           --------------------------
1ak2A           SAIDASQTPDVVFASILAA-------
1culC           --------------------------
3cueF           --------------------------
3dfnA           ADDGRP--------------------
2dr3D           RLDLDEDGELKRSLIVWKMR------
1cr2A           VLVRIL--------------------
2d2eA           VATGGPLALELEAKGYEWLK------
1aldA           ADDGRP--------------------
1e2kA           GERLDLAMLAAIRRVYGLL-------
2c7cH           PGFGDRR-------------------
6aldA           ADDGRP--------------------
3dfpD           ADDGRP--------------------
1e9rF           DPNGGNLFITWREDMGPALRPL----
2bkeA           IARVVDAPHLPEGEVV--FALTEEG-
3dfoD           ADDGRP--------------------
1e9sI           EHVTMPDG------------------
1draA           VEGDTHFPD-YEPDDWESVFSE----
1e9sL           FITWREDMGPALRPLISAW-------
3dfqD           ADDGRP--------------------
3dftC           ADDGRP--------------------
2a1fD           DHMGMLATV-----------------
2dftC           --------------------------
3dauA           VEGDTHFPD-YEPDDWESVFSE----
2bbtA           YFYGTFSELQNLRPDF----------
3dfnD           ADDGRP--------------------
1dvrA           GVDASQPP----ATVWADILNK----
1e9rG           FITWREDMGPALRPLISAW-------
3dfpC           ADDGRP--------------------
2aunB           --------------------------
3dftD           ADDGRP--------------------
1dekA           PGQKSNDTHITE--------------
1e9sE           --------------------------
2a2zB           FKDKYESLVEKVKEFLSTL-------
2dftA           --------------------------
3a00B           --------------------------
2czvB           --------------------------
1cr0A           VLVRILKFTGDTGI------------
2d4uB           --------------------------
3d1mA           VDITTSDRDRSKYGMLARL-------
2e85B           PDIVGF--------------------
1eamA           NKVVVNFYPNQEYDYFHM--------
3czjA           SDTPHPARIGLNCQLAQ---------
1adoA           KADDGRPFP-----------------
2bjbA           RITGWPVSVQPADHILAILRQ-----
1bmfC           TALPVIETQAGDVSAYIPT-------
3bk7A           GRHGRALPPMGMREGMNRFLA-----
3brwA           GNDIVAVVFQDENTPF----------
2aumB           ATGLGLEQ------------------
1cs4C           --------------------------
1ek0A           --------------------------
3dymA           ASDTPHPA------------------
1e4vA           VAEVRADLEKI---------------
5dfrA           VEGDTHFPDY-EPDDWESVF------
2ccjA           LENVVEDTYQTIIKYLEK--------
1e2iA           PH------------------------
3d1mB           VDITTSDRDRSKYGMLARL-------
4dfrA           VEGDTHFPD-YEPDDWESVFSE----
2bhvA           GINQVVNQILRDKSKIAPIVVIREGS
2dpyA           --------------------------
1akeA           VAEVRADLEKI---------------
3dm5B           IKFIGTGEK-----------------
2b8tD           LNSNSEEFIKFKNKK-----------
3cmwC           NVVGSETRVKVVKNKI----------
3ecpA           WMRPDDPADADEKESG----------
1cjtC           --------------------------
1d2zD           --------------------------
3d3qA           NEVQHLV-------------------
1d6aA           --------------------------
3do6A           --------------------------
3dyoA           SDTPHPARIGLNCQLAQVA-------
1e2lA           QLSGPRPHIGDTLFTLFRAPELLAPN
2bwjA           --------------------------
1drbA           VEGDTHFPDY-EPDDWESVF------
1e2jA           WREDWGQLSGPRPHIGDTLFTL----
1dyhA           VEGDTHFPD-YEPDDWESVFSE----
3dfqC           ADDGRP--------------------
3c85A           --------------------------
3bwdD           --------------------------
3c15C           --------------------------
2dpyB           --------------------------
2e85A           PDIVGFYYPQPIKDAVETV-------
2a1fE           DHMGMLATV-----------------
2d7vA           --------------------------
3bv4A           --------------------------
2bv7A           --------------------------
2ancD           SRQKQRH-------------------
1dekB           YDYYIVPDTRQEMDAARAMGATVI--
2b0lC           GMKGTYIKVL-NNKFLIEL-------
2ancF           --------------------------
3c14C           --------------------------
2awoD           LPSDIAD-------------------
2d7vB           --------------------------
2bhvD           VFISPNTDIFFPIPRENEVIA-----
1cjuC           --------------------------
3cqcA           YLVFSKEELRK---------------
2cbzA           SEMGSYQELLARDGAFAEF-------
2anbA           SRQKQRH-------------------
3dfdA           --------------------------
1e9sM           EDP-----------------------
3dfoC           --------------------------
4atjA           LPDPTLNYLQTLRGLC----------
2a1fC           DHMGMLATV-----------------
2aexA           FEKAGVSISVVHGNLS----------
3cd9A           --------------------------
3cioD           --------------------------
1e2mB           --------------------------
3be4A           K-------------------------
3crmA           GIIATRQLAKRQFTWLRSWSHLHW--
3b9qA           VKFIGVGVEDLQPFDPEAF-------
2c9gA           --------------------------
3cddA           IVNEEVTA-EGAAKRGQ---------
1dp0A           SDTPHPARIGLNCQLAQ---------
3cmuA           NVVGSETRV-----------------
1e9rB           --------------------------
3cphA           --------------------------
1c9kC           --------------------------
2bboA           YFYGTFSELQNLQPDFSSK-------
3e8aC           --------------------------
1azsC           --------------------------
2an9A           SRQKQRH-------------------
3b85B           --------------------------
1e2kB           ERLD-LAMLAAIRRVYGLL-------
1e2lB           AKRLDLAMLAAIRRVYGLL-------
2ancB           SRQQRHDALIS---------------
3bjqB           YSIVPSALE-----------------
2bhvC           --------------------------
1e2nA           LLANTVRYLQCGGSWREDWGQLS---
2c9oA           GIAELVPGVLFVDEVHMLDIEC----
1dw9A           --------------------------
3c7kA           --------------------------
1e2nB           --------------------------
1e9sA           FITWREDMGPALRPLIS---------
1e2mA           GERLDLAMLAAIRRVYGL--------
3dmdA           --------------------------
3cddE           --------------------------
1ckeA           E-------------------------
3dvlD           ILRNVLEG------------------
1e2hA           WREDWGQLSGPRPHIGDTLFTL----
1chdA           KEAEDGERVL----------------
1bccF           --------------------------
3cbqA           --------------------------
2a5vA           --------------------------
3dkvA           --------------------------
2c5mD           IELGGTVGDIESMPF-----------
3cddB           DVTDSEIGRYR---------------
1cjvC           --------------------------
3e70C           ILFVGVGQG-----------------
1e9sK           --------------------------
2a78A           --------------------------
2axnA           --------------------------
2a5vB           --------------------------
2dykA           --------------------------
2ax4A           --------------------------
2b0lB           GMKGTYIKVLN-NKFLIELENL----
2ce2X           --------------------------
2atxA           --------------------------
2cdnA           --------------------------
2ax4B           --------------------------
2c1lA           --------------------------
3ci2A           NIAQVP--------------------
3cmwA           RMKIGVMFGNP---------------
2cxxA           --------------------------
1dwmA           VVTSVP--------------------
3bfkC           --------------------------
2cxxB           --------------------------
2c9oB           --------------------------
1a2kE           --------------------------