[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABD99890.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dclB.bssp"
#ERROR : Can't open dsspfile "2abkA.bssp"

## Summary of PDB Search
:183
    1e-20  17%  2dclB  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
    8e-16  14%  2abkA  [x.x.x] ENDONUCLEASE III
:183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxADQLMIDYHDKEWGRPLHDERGLFELLCLEGLQAGLSWKIVLNKRKFLREAFDNFEVEKISQ
2dclB           -------------IGENDKWEGRPL------YKVIVEKLREMGIAGATVYRGIYGFGKKSTDLPIIVEVV
2abkA           --------RLEILTRLRENNPHTTELNFSSPFELLIAVLLSAQATDVSVNKATAKLYPVANT--PAAMLE


                         .         .         *         .         .         .         .:140
query           YTLDDVEKLLTDPRIIRNRRKIEAIINNAKIVNALHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dclB           DRGHNIEKVVKDGMITVEPTIVLWV---------------------------------------------
2abkA           LGVEGVKTYIKTIGLYNSKAE--NIIKTCRILLEQH----------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dclB           -------------------------------------------
2abkA           -------------------------------------------