[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00014.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a95B.bssp"
#ERROR : Can't open dsspfile "1a95D.bssp"
#ERROR : Can't open dsspfile "1a97B.bssp"
#ERROR : Can't open dsspfile "1a97D.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "3dmpA.bssp"
#ERROR : Can't open dsspfile "2e55A.bssp"
#ERROR : Can't open dsspfile "1a96D.bssp"
#ERROR : Can't open dsspfile "1a97A.bssp"
#ERROR : Can't open dsspfile "1d6nA.bssp"
#ERROR : Can't open dsspfile "2dy0B.bssp"
#ERROR : Can't open dsspfile "3efhA.bssp"
#ERROR : Can't open dsspfile "2ehjA.bssp"
#ERROR : Can't open dsspfile "1bd3D.bssp"
#ERROR : Can't open dsspfile "1a4xA.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"
#ERROR : Can't open dsspfile "3dahC.bssp"
#ERROR : Can't open dsspfile "1cjbC.bssp"
#ERROR : Can't open dsspfile "1a98A.bssp"
#ERROR : Can't open dsspfile "1dbrC.bssp"
#ERROR : Can't open dsspfile "1a3cA.bssp"
#ERROR : Can't open dsspfile "1dkrB.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "1dkrA.bssp"
#ERROR : Can't open dsspfile "2dy0A.bssp"
#ERROR : Can't open dsspfile "2aeeB.bssp"

## Summary of PDB Search
:228
    7e-08  15%  1a95B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-07  12%  1a95D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-07  14%  1a97B  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    6e-07  12%  1a97D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    7e-07  21%  1bzyA  [c.61.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    7e-07  14%  3dmpA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    7e-07  16%  2e55A  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    2e-06  11%  1a96D  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    2e-06  12%  1a97A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    1e-05  12%  1d6nA  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    1e-05  13%  2dy0B  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    3e-05  17%  3efhA  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE 1
    4e-05  16%  2ehjA  [x.x.x] URACIL PHOSPHORIBOSYLTRANSFERASE
    1e-04  13%  1bd3D  [c.61.1] URACIL PHOSPHORIBOSYLTRANSFERASE
    2e-04  18%  1a4xA  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    2e-04  12%  1a95A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    3e-04  31%  3dahC  [x.x.x] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE
    3e-04  16%  1cjbC  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    4e-04  11%  1a98A  [c.61.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    5e-04  17%  1dbrC  [c.61.1] HYPOXANTHINE GUANINE XANTHINE
    5e-04  26%  1a3cA  [x.x.x] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    5e-04  27%  1dkrB  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    6e-04  29%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    7e-04  27%  1dkrA  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    7e-04  13%  2dy0A  [x.x.x] ADENINE PHOSPHORIBOSYLTRANSFERASE
    8e-04  24%  2aeeB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a95B           ----------------------------------------------------------------------
1a95D           ----------------------------------------------------------------------
1a97B           ----------------------------------------------------------------------
1a97D           ----------------------------------------------------------------------
1bzyA           ----------------------------------------------------------------------
3dmpA           ----------------------------------------------------------------------
2e55A           ----------------------------------------------------------------------
1a96D           ----------------------------------------------------------------------
1a97A           ----------------------------------------------------------------------
1d6nA           ----------------------------------------------------------------------
2dy0B           ----------------------------------------------------------------------
3efhA           ----------------------------------------------------------------------
2ehjA           ----------------------------------------------------------------------
1bd3D           ----------------------------------------------------------------------
1a4xA           ----------------------------------------------------------------------
1a95A           ----------------------------------------------------------------------
3dahC           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
1a98A           ----------------------------------------------------------------------
1dbrC           ----------------------------------------------------------------------
1a3cA           ----------------------------------------------------------------------
1dkrB           ----------------------------------------------------------------------
3dezA           ----------------------------------------------------------------------
1dkrA           ----------------------------------------------------------------------
2dy0A           ----------------------------------------------------------------------
2aeeB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxSIYTYDNLIIKKYFERYKFMGDYYWRKIFNIEFKNFITNNYPSKDWIYIPIPVDEYTMQHRGF
1a95B           ---------------------------------------------------------YIVTWDMLQIHAR
1a95D           ---------------------------------------------------------YIVTWDMLQIHAR
1a97B           ---------------------------------------------------------YIVTWDMLQIHAR
1a97D           ---------------------------------------------------------YIVTWDMLQIHAR
1bzyA           ----------------------------------------------------------------------
3dmpA           ------------KDTSTRTFRELLREITLLMGYEITR---------NLPITT-KRVETPLVEIDAPVIAG
2e55A           --------------------------LGFMLVYEALK----------DILLEEKEVRTWIGNKRFNYLNE
1a96D           ---------------------------------------------------------YIVTWDMLQIHAR
1a97A           ---------------------------------------------------------YIVTWDMLQIHAR
1d6nA           -------------------------------------------VMKEMGGHHIVALCVL-------AGGY
2dy0B           -----------------------FRDVTSLLEDPKAYALSIDLLVERYKNAGITKV-VGTE-----ARGF
3efhA           -----------------------------------------------HASQIQGFFDIPVDNLYAEPAVL
2ehjA           ------------------------------------------EATADLETEKVTIEGWNGPVEIDQIKGK
1bd3D           ---------------------------------------------------QKKEVTTPLDVSYHGVSFY
1a4xA           ----------------------------------------------------------------------
1a95A           ---------------------------------------------------------YIVTWDMLQIHAR
3dahC           ----------------------------------------------------------------------
1cjbC           ------------------------------------------------------YNNEEFHILCLLKGSR
1a98A           ----------------------------------------------------------------------
1dbrC           -------TFYNADDFHCKPYIDKILLPGGLVKDRVEKLAYD--IHRTYFGEELHIICIL-------KGSR
1a3cA           ----------------------------------------------------------------------
1dkrB           ----------------------------------------------------------------------
3dezA           ----------------------------------------------------------------------
1dkrA           ----------------------------------------------------------------------
2dy0A           ----------------IKSIQDLFRDVTSLLEDPKAYALSIDLLVERYKNAGITKV------VGTEARGF
2aeeB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NQVEGLIGDLPYSRVLXXXXXXXXXXQSEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQ
1a95B           KLASRLMPSEVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGGFIVIDDLVDTGGTAVAIR
1a95D           KLASRLMPSEQWKGIIAVSRGGLVPGELGIRHVDTVCISSYREKRAEGDGEGFIVIDDLVDTGGTAVAIR
1a97B           KLASRLMPSEVPGALLARELGIRHVDTVAISSYDHDNQRELKVLKRAEGDGGFIVIDDLVDTGGTAVAIR
1a97D           KLASRLMPSEQWKGIIAVSRGGLVPGELGIRHVDTVAISSYLKVLRAEGDGGFIVIDDLVDTGGTAVAIR
1bzyA           --------------------------------------------LSTLTGKNVLIVEDIIDTGKTMQTLL
3dmpA           KKLAILRAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAI
2e55A           EEIVFVRAGLSFLEGALQVVPNAKVGFLGIKRNEETLESHIYYSRLPELKGIVVILDPMLATGGTLEVAL
1a96D           KLASRLMPSEQWKGIIAVSRGGLVPGALVDTVCISSYRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIR
1a97A           KLASRLMPSEQWKGIIAVSRGGLVPGALVDTVAISSYDRELKVLKRAEGDGEGFIVDDLVDTGGTAVAIR
1d6nA           KFFADLLDYIKSDRSIPMTVDFIRLGSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLL
2dy0B           LFGAPVGLGVGF-VPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATV
3efhA           KWIRENISEWRNCTIVSPDAGGAKRVDRLNVDFALIHKERKMVLVGDVKDRVAILVDDMADTCGTICHAA
2ehjA           KITVVPIAGLGMMDGVLENVPSARISVVGMYRNEETLEPVPYFQLVSNIDERMALIDPMLATGGSVIATI
1bd3D           SKICGVSAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYKLPADIRERWVMLDPMCATAGSVCKAI
1a4xA           -------------------------------ITLYREPLVKGADIPVDITDKVILVDDVLYTGRTVRAGM
1a95A           KLASRLMPSEQWKGIIAVSRGGLVPGALVDTVCISSYNQRELKVLAEGDGEGFIVIDDLVDTGGTAVAIR
3dahC           ---------------------------------------------GEVEGRTCVIMDDMVDTAGTLCKAA
1cjbC           GFFTALIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGHVLIVEDIIDTGKTLVKFC
1a98A           ----------------------------------ARELGIRHVDTVAIGDGEGFIVDDLVDTAVAIREMY
1dbrC           GFFNLLIDYLATIQKYSGRESSVPPFFEHYVRLLTVLSDDL----SIFRDKHVLIVEDIVDTGFTLTEFG
1a3cA           -----------------------------------------------------ILVDDVLYTGRTVRAGM
1dkrB           ----------------------------------------RMNIVGNIEGKTAILIDDIIDTAGTITLAA
3dezA           ----------------------------------------------------MVIIEDLISTGGSVLDAV
1dkrA           ----------------------------------------RMNIVGNIEGKTAILIDDIIDTAGTITLAA
2dy0A           LFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGKVLVVDDLLATGGTIEATV
2aeeB           ---------------------------------------------RVLKGQKMVIIEDLISTGGSVLDAA


                         .         .         .         +         .         .         .:280
query           ELLLKNGASRVCSVTLAR
1a95B           EMYPKAHFVTIFAKPAGR
1a95D           EMYPKAHFVTIFAKPA--
1a97B           EMYPKAHFVTIFAKPA--
1a97D           EMYPKAHFVTIFAKPAG-
1bzyA           SLVRQYNPKMVKVASLL-
3dmpA           DVLKRRGVPGERLMFLAL
2e55A           REILKHSPLKVKSVHAIA
1a96D           EMYPKAHFVTIFAKPA--
1a97A           EMYPKAHFVTIFAKPA--
1d6nA           SLVRQYNPKMVKVASLL-
2dy0B           KLIRRLGGEVADAAFI--
3efhA           DKLLSAGATRVYAILTH-
2ehjA           DLLKKAGCSSIKVLVLVA
1bd3D           EVLLRLGVKEERIIFVNI
1a4xA           DALVDVGRPSSIQLAVL-
1a95A           EMYPKAHFVTIFAKPA--
3dahC           QVLKERGAKQVFAYATH-
1cjbC           EYLKKFEIKTVAIACLFI
1a98A           PKAHFVTIFAK-------
1dbrC           ERLKAVGPKSM-------
1a3cA           DALVDVGRPSSIQLAVL-
1dkrB           NALVENGAKEVYAC----
3dezA           AAAQREGADVLGVVAI--
1dkrA           NALVENGAKEVYAC----
2dy0A           KLIRRLGGEVADAAFI--
2aeeB           AAASREGADVLGVVAI--