[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00050.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbo3.bssp"

## Summary of PDB Search
:50
    3e-08  41%  3bbo3  [x.x.x] RIBOSOMAL PROTEIN L33
:50

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xANKKKVALACSECGSRNYTITENPNRTERLEVQKFCKYCGKHTLHRETK
3bbo3           -DVRVKVILECTGCVRKSVNKGSRGNTPSRLELRKFCPYCYKHTIHGEIK