[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00071.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ahrE.bssp"
#ERROR : Can't open dsspfile "2ahrD.bssp"
#ERROR : Can't open dsspfile "3d1lB.bssp"
#ERROR : Can't open dsspfile "2ahrA.bssp"
#ERROR : Can't open dsspfile "3ckyB.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "2ahrC.bssp"
#ERROR : Can't open dsspfile "3ckyA.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "3c24B.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2amfD.bssp"
#ERROR : Can't open dsspfile "2b0jA.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "3dafA.bssp"
#ERROR : Can't open dsspfile "3ceaA.bssp"
#ERROR : Can't open dsspfile "3egoA.bssp"
#ERROR : Can't open dsspfile "3c7aA.bssp"
#ERROR : Can't open dsspfile "3ckyC.bssp"
#ERROR : Can't open dsspfile "3e82D.bssp"
#ERROR : Can't open dsspfile "3e82E.bssp"
#ERROR : Can't open dsspfile "3ceaC.bssp"
#ERROR : Can't open dsspfile "3c7dB.bssp"
#ERROR : Can't open dsspfile "3cumA.bssp"
#ERROR : Can't open dsspfile "3dttA.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "3e82B.bssp"
#ERROR : Can't open dsspfile "3egoB.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "3db2C.bssp"
#ERROR : Can't open dsspfile "2duwA.bssp"
#ERROR : Can't open dsspfile "1d1qB.bssp"
#ERROR : Can't open dsspfile "2cfiA.bssp"

## Summary of PDB Search
:264
    3e-19  32%  2ahrE  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    3e-19  35%  2ahrD  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    6e-19  12%  3d1lB  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
    1e-18  36%  2ahrA  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    3e-18  19%  3ckyB  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    3e-18  38%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    4e-17  36%  2ahrC  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    1e-16  17%  3ckyA  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    2e-16  38%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    6e-16  13%  3c24B  [x.x.x] PUTATIVE OXIDOREDUCTASE
    9e-16  35%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    8e-15  37%  2amfD  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    3e-13  11%  2b0jA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    2e-11  11%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    1e-10  10%  3dafA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    2e-08  12%  3ceaA  [x.x.x] MYO-INOSITOL 2-DEHYDROGENASE
    4e-08  12%  3egoA  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    4e-08  14%  3c7aA  [x.x.x] OCTOPINE DEHYDROGENASE
    6e-08  22%  3ckyC  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    2e-07  19%  3e82D  [x.x.x] PUTATIVE OXIDOREDUCTASE
    9e-07  16%  3e82E  [x.x.x] PUTATIVE OXIDOREDUCTASE
    4e-06  12%  3ceaC  [x.x.x] MYO-INOSITOL 2-DEHYDROGENASE
    9e-06  17%  3c7dB  [x.x.x] OCTOPINE DEHYDROGENASE
    1e-05  13%  3cumA  [x.x.x] PROBABLE 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    2e-05  13%  3dttA  [x.x.x] NADP OXIDOREDUCTASE
    1e-04   9%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    1e-04  19%  3e82B  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-04  12%  3egoB  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-04  16%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    3e-04  13%  3db2C  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    4e-04  13%  2duwA  [x.x.x] PUTATIVE COA-BINDING PROTEIN
    7e-04  37%  1d1qB  [c.44.1] TYROSINE PHOSPHATASE (E.C.3.1.3.48)
    8e-04  21%  2cfiA  [x.x.x] 10-FORMYLTETRAHYDROFOLATE DEHYDROGENASE
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKP
2ahrE           AKIGIIGVGKASAIIKGLKQTPH----ELIISGSSLERSKEIAEQLALPY-ASHQDLIDQVDLVILGIKP
2ahrD           AKIGIIGVGKASAIIKGLKQTPH---ELIISGSSLERSKEIAEQL--ALPYASHQDLIDQVDLVILGIKP
3d1lB           TPIVLIGAGNLATNLAKALYRKG---FRIVQVYSRTEESARELAQ-KVEAEYTTDLAEVNPYAKLYIVSL
2ahrA           -KIGIIGVGKASAIIKGLKQTPH---ELIISGSSLERSKEIA--EQLALPYASHQDLIDQVDLVILGIKP
3ckyB           IKIGFIGLGAMGKPMAINLLKEGVTVYAFDLMEANVA--AVVAQ--GAQACENNQKVAAASDIIFTSLPN
2amfC           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
2ahrC           -KIGIIGVGKAS-AIIKGLKQTPHELIISGSSLERSKEI----AEQLALPYASHQDLIDQVDLVILGIKP
3ckyA           IKIGFIGLGAMGKPMAINLLKEGV---TVYAFDLMEANVAAVVAQ-GAQACENNQKVAAASDIIFTSLPN
2amfA           MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKP
3c24B           KTVAILGAGGKGARITRKIHDSAHH---LAAIEIAPEGRDRLQGGI---PLTDGDGWIDEADVVVLALPD
2amfE           MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQLF
2amfD           MKIGIIGVGKMASAIIKGLKQTPHELIISGSS-----------LERSKEIAEQLALPYAMSHQDLIDQVD
2b0jA           -------------------------------------------EDVGLKVTSDDREAVEGADIVITWLPK
3c24A           KTVAILGAGGKGARITRKIHDSAH--HLAAIEIAPEGRDRLQGGIPLTDGDGWIDEADVVVLALPDNIIE
3dafA           -EVMEAHLSGNPESIMPKIREVVKAKAKELPKPPKACIHLVHPEDVGLKVTSDDREAVEGADIVITWLPK
3ceaA           LRAAIIGLGRLGERHARHLVNKIQGVKLVAACALDSNQLEWAKNELGVETTYTNYKDIDTENIFIVAPTP
3egoA           LKIGIIGGGSVGLLCA-YYLSLYVTVVTRRQEQAAAIQRLYKGGEEFRADCSADTSINSDFDLLVVTVKQ
3c7aA           VKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFAEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPA
3ckyC           IKIGFIGLGAMGKPMAINLLKEGV---TVYAFDLMEANVAAVVAQ-GAQACENNQKVAAASDIIFTSLNA
3e82D           INIALIGYGFVGKTFHAPLIRSVPGLNLAFVASRDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVIASPN
3e82E           INIALIGYGFVGKTFHAPLIRSVPGLNLAFVASRDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVIASPN
3ceaC           LRAAIIGLGRLGERHARHLVNKIQGVKLVAACALDSNQLEWAKNELGVETTYTNYKDIDTENIDAIAPTP
3c7dB           VKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPA
3cumA           -QIAFIGLGHGAPATNLLKAGYL---LNVFDLVQSAVDGLV---AAGASAARSARDAVQGADVVISLPAS
3dttA           -KIAVLGTGTVGRTAGALADLGHIGTRDPKATLARAPPFSQWLPEHPHVHLAAFADVAAGAELVVNATE-
1e5lA           KSVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKHDLVI
3e82B           INIALIGYGFVGKTFHAPLIRSVPGLNLAFVASRDEEKVKRDLPDVTVIASPEAAVQHPDVDLVVIASPN
3egoB           LKIGIIGGGSVGLLCA-YYLSLYHDV-TVVTRRQEQAARLYKGGEEFRADCSADTSINSDFDLLVVTVKQ
3dojA           MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELV----EHGASVCESPAEVIKKCKYTIAMLSD
3db2C           VGVAAIGLGRWAYVADAYTKSEKLK--LVTCYSRTEDKREKFGKRYNCAGDATEALLAREDVEVIITVPN
2duwA           RTIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGK---TLLGQQGYATLADVPEKVDMVDVFRNS
1d1qB           ISVAFIALGNMAEAIFKHVEKANLENRFNKIDSFGTSNYHV-----------------------------
2cfiA           MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPAEKDGVPVFKYSRWRAKGQALPDVVAGAELNVLP---


                         .         .         *         .         .         .         .:140
query           IVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSD
2ahrE           QLFETVLKPLHFKQPIISAAGISL-------QRLATFVGQDLPLLRIPNNAQILQSSTALTGNALVS--Q
2ahrD           QLFETVLKPLHFKQPIISAAGISL---------QRLATFVGQDLPLLRIPNNAQILQSSTALTGNALVSQ
3d1lB           KDSAFAELLQGIVEGKREEALVHTAGSIPNVWEGHVPHYG---VFYPQTFSKQREVDFKEIPFFIEASST
2ahrA           QLFETVLKPLHFKQPIISAAGISLQRLATFVGQDLPLL---------RIPNNAQILQSSTALTGNALVSQ
3ckyB           AGIVETVMNGPGGVLSACKAGTVIVDMSSVSKMAKVAAEKGIDYVD-APVSGGTKGAEAGTLTIMVGASE
2amfC           QLFETVLKPLHFKQPIISMAAGISLQR------LATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2ahrC           QLFETVLKPLHFKQPIISA---------AGISLQRLATFVGQDLPLLRIPNNAQILQSSTALTGNALVSQ
3ckyA           AGIVETVMNGPGGVLSACKAGTVIVDMSSVSPSSTKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGASE
2amfA           QLFETVLKPLHFKQPIISMAAGISLQRLATF------VGQDLPLLRIMPNMNAQILQSSTALTGNALVSQ
3c24B           NIIEKVAEDIPGTIVLILDAAAPYAGVPERADITYFIGHPFNDETDPAARTDYHGGIAKQAIVCALQGPE
2amfE           ETVLKPLHFKQPIISMAAGISLQRLA---------TFVGQDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2amfD           LVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLFVGQDLPLLRIMPNMNAQILQSSTALTGNALVSQ
2b0jA           GNKQPDIIKKFADAIPEG-AIVTHACTIPTTKFAKIFKDLGREDLNITSYHPGCVPEMKQVYIAEGYASE
3c24A           KVAEDIVPRVRPGTIVLDAAAPYAGVPERADITYFIGHPCHNDETDPAARTDYHGGIAKQAIVCALQGPE
3dafA           GKQPDIIKKF-ADAIPEGAIVTHACTIPTTKFAKIFKDLGREDLNITSYHPGCVPEMKGQVYIAEGYASE
3ceaA           FHPETIYANAGLNVFCEKPLGLDFNEVDEAKVIKSHPNQIFQSGFRRYDDSYRYAKKIVDNGDIGIDPIS
3egoA           HQLQSVFSSLTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEP
3c7aA           FAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGT
3ckyC           GIVETVMNG-PGGVLSACKAGTVIVDMSSVSKMAKVAAEKGIDYVDAPVSGGTKAEAGTLTIMVGA--SE
3e82D           ----------------------------------------------------------------------
3e82E           ATHAPLARL-------------------------------------------------------------
3ceaC           FHPETIYANAGLNVFCEKPLGLDFNEVDEAKVIKSHPNQIFQSGFRSYRYAKKIVDNGIIYRGYGIDPIS
3c7dB           FAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVE-VLG
3cumA           LDDDGLLAHIAPGTLVLE---CSTIAPTSARKIHAAARERGLALDAPVSGGTAGAAAGTLTF---VGGDA
3dttA           ----------------------------------------------------------------------
1e5lA           SLIPYTF---------------------------------------------------------------
3e82B           ----------------------------------------------------------------------
3egoB           HQLQSVFSSLTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEP
3dojA           PCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDK
3db2C           DKHAEVIEQCA-----------------------------------------------------------
2duwA           EAAWGVAQEAIAI---GAKTLWLQLGVINEQAAVLAR---EAGLSVVMDRCPAIELPRL-GLAK------
1d1qB           ----------------------------------------------------------------------
2cfiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGS
2ahrE           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrD           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
3d1lB           EDAAFLKAIASTLSNRVYDADSEQRKSLHLAAVFTCNFTNHYALAAELLKKYNLPFDVL-----PLIDET
2ahrA           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
3ckyB           AVFEKIQPVLSVIGKDIYHVGDTGAGDAVVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSSGRS
2amfC           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2ahrC           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
3ckyA           AVFEKIQPVLSVIGKIYHVGDTGAGDAVKIVNNLLLGCMASLAEALVLGVKCGLKPETMQEIIGKSSGRS
2amfA           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
3c24B           EHYAIGADICETWSPVTRTHRVEQLAILEPGLSEVAPFVETVHAVDECADRYGIDRQAALDFIGHLNVEI
2amfE           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2amfD           ELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVLAS
2b0jA           EAVNKLYEIGKIARGKAFKMPANLIGPVDMCSAVTATVYAGLLAYRDAVTILGAPADFAQMMADEALTQI
3c24A           EHYAIGADICETWSPVTHRVTTEQLAILEPGLSEVAPFVETVHAVDECADRYGIDRQAALDFIGHLNVEI
3dafA           EAVNKLYEIGKIARGKAFKMPANIGPVCDMCSAVTATVYAGLLAYRAVTKILGAPADFAQMMADEALTQI
3ceaA           GESFTKFATEADSGGIFVDNIHDIDLIRWFTGQDPVQAYGLTSNIAAPQLADIGEFETGVAQLKSDGVIA
3egoA           DRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVK-NGELLTTPAYLAFMKLV------
3c7aA           KSVLAASLIKGTAKTVDPL---------------------------------------------------
3ckyC           AVFEKIQPVLSVIGDIYHVGDTGAGDAVKIVNN--LLLGCNMASLAEAGVKCGLKPETMQEIIGKSSGRS
3e82D           ----------------------------------------------------------------------
3e82E           ----------------------------------------------------------------------
3ceaC           GESFTKFATEADSGGIFVDNIHDIDLIRWFTGQDPVQAYGLTSNIAAPQLADIGEFETGVAQ--------
3c7dB           TKSVLAASLIKGTAKTVD----------------------------------------------------
3cumA           EALEKARPLFEAGRNIFHAGPDGAGQVAKVCN--NQLLAVLIGTAEAALGGLEAKVLAEIRRSS----GG
3dttA           ----------------------------------------------------------------------
1e5lA           ----------------------------------------------------------------------
3e82B           ----------------------------------------------------------------------
3egoB           DRLNILFQHNHSDFPI------------------------------------------------------
3dojA           ALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTN
3db2C           ----------------------------------------------------------------------
2duwA           ----------------------------------------------------------------------
1d1qB           ----------------------------------------------------------------------
2cfiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDKx
2ahrE           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTIDK---
2ahrD           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDK-------
3d1lB           ARKVHELEPKTAQTGPAIRYDENVIGNHLRLADDPA------------------
2ahrA           ASNLKTSSQSPHDFIDAICSPGGTTIAG-LELERLGLTATVSSAIDKTI-----
3ckyB           YAMEAKMEKFIMSGDFAGGFAMKDLGLALEAGKEGNVPLPMTAMATQ-------
2amfC           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTI-----
2ahrC           ASNLKTSSQSPHDFIDAICSPGGTTIAGLELE-RLGLTATVSSAIDKTIDKAK-
3ckyA           YAMEAKMEKFIMSGDFAGGFAMKDLGLALEAGKEGNVPLPMTAMATQ-------
2amfA           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTI-----
3c24B           AW--FGYSPKVAALRLEFAKDIVVKEDWREALNPAKV-----------------
2amfE           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTIDK---
2amfD           ASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTID----
2b0jA           HANMEEALDPAALLGTADSMCFGPLAEILPTALKV-------------------
3c24A           AW--FGYSPKVAALRLEFAKDIVVKEDWREALNPAKV-----------------
3dafA           H-NLMKALDPAALLGTADSMCFGPLAEILPTALKVLE-----------------
3ceaA           TLIGGRHAAHGNQVELEVGSNGWVRIGEH-------------------------
3egoA           ------------------------------------------------------
3c7aA           ------------------------------------------------------
3ckyC           ------------------------------------------------------
3e82D           ------------------------------------------------------
3e82E           ------------------------------------------------------
3ceaC           ------------------------------------------------------
3c7dB           ------------------------------------------------------
3cumA           NWALEVYNPWPGVENAPASRDYSGGFA--QLAKDLG------------------
3dttA           ------------------------------------------------------
1e5lA           ------------------------------------------------------
3e82B           ------------------------------------------------------
3egoB           ------------------------------------------------------
3dojA           ------------------------------------------------------
3db2C           ------------------------------------------------------
2duwA           ------------------------------------------------------
1d1qB           ------------------------------------------------------
2cfiA           ------------------------------------------------------