[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00097.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3bl9A.bssp"
#ERROR : Can't open dsspfile "3bl9B.bssp"
#ERROR : Can't open dsspfile "3bjdA.bssp"
#ERROR : Can't open dsspfile "3dkyA.bssp"
#ERROR : Can't open dsspfile "2b7wA.bssp"
#ERROR : Can't open dsspfile "2do9A.bssp"
#ERROR : Can't open dsspfile "2cb6G.bssp"
#ERROR : Can't open dsspfile "3csoA.bssp"

## Summary of PDB Search
:807
      0.0  42%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
      0.0  42%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
      0.0  42%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
      0.0  42%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
      0.0  42%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
      0.0  42%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    e-144  40%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-141  42%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    e-141  40%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-140  40%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-140  42%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    e-139  40%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-136  40%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-136  42%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    e-136  42%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-134  40%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-133  41%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-133  40%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    e-133  40%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-132  42%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-131  42%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    e-131  40%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-129  40%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-129  42%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-128  41%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-126  41%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    e-124  41%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-121  42%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    e-120  41%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-120  42%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-120  43%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-119  42%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-117  41%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-115  43%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-114  42%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    e-113  41%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-111  42%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    e-100  39%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-52  15%  3bl9A  [x.x.x] SCAVENGER MRNA-DECAPPING ENZYME DCPS
    1e-46  14%  3bl9B  [x.x.x] SCAVENGER MRNA-DECAPPING ENZYME DCPS
    3e-30   7%  3bjdA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    9e-29  14%  3dkyA  [x.x.x] REPLICATION PROTEIN REPB
    8e-26  15%  2b7wA  [x.x.x] LYSOZYME
    7e-22   9%  2do9A  [x.x.x] NACHT-, LRR- AND PYD-CONTAINING PROTEIN 10
    8e-18   7%  2cb6G  [x.x.x] MOSQUITOCIDAL TOXIN
    3e-07   3%  3csoA  [x.x.x] RNA-DIRECTED RNA POLYMERASE
:807

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxRLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEF
3e3nA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nD           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nB           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nH           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2ecpA           --------------QWQRYGLNSAAEMTPRQWWLAVSEALAEM----LRAQPFAKPVANQRHVNYISMEF
1ahpA           --------------QWQRYGLNSAAEMTPRQWWLAVSEALAEM----LRAQPFAKPVANQRHVNYISMEF
3cuvA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1e1yA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lD           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1bx3A           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lB           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3lC           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1b4dA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3dd1B           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3e3oD           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nE           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1a8iA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3nC           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3ddwB           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1e4oA           --------------QWQRYGLNSAAEMTPRQWWLAVSEALAEM----LRAQPFAKPVANQRHVNYISMEF
3e3oC           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3e3oB           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1c8kA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2c4mB           -------------------AGTPADLATDRKFWTGLSRAVQERIADDWERTREAY--GAARQQHYFSAEF
3e3oA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2amvA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1abbA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
1axrA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3ddsB           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2atiA           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3cehA           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
2c4mC           ------------------AAGTPADLATDRKFWTGLSRAVQERIADDWERTREAYGA--ARQQHYFSAEF
3cejA           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
1c8lA           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
2c4mA           ------------------AAGTPADLATDRKFWTGLSRAVQERIADDWERTREAYGA--ARQQHYFSAEF
3ddsA           --------------HLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEF
3e3nF           --------------HLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEF
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI
3e3nA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nD           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nB           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nH           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2ecpA           LIGRLTGNNLLNLGWYQDVQDSLKAYDINLTDLLEEEIDPALGNGGLGRLAACFLDSMATVGQSATGYGL
1ahpA           LIGRLTGNNLLNLGWYQDVQDSLKAYDINLTDLLEEEIDPALGAGGLGRLAACFLDSMATVGQSATGYGL
3cuvA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1e1yA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3lD           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3lA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1bx3A           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3lB           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3lC           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1b4dA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3dd1B           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3oD           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nE           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1a8iA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nC           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3ddwB           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1e4oA           LIGRLTGNNLLNLGWYQDVQDSLKAYDINLTDLLEEEIDPALGNGGLGRLAACFLDSMATVGQSATGYGL
3e3oC           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3oB           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1c8kA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2c4mB           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDAALGNGGLGRLAACFLDSAVTQDYPVTGYGL
3e3oA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2amvA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1abbA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1axrA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3ddsB           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2atiA           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3cehA           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2c4mC           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDAALGNGGLGRLAACFLDSAVTQDYPVTGYGL
3cejA           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
1c8lA           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
2c4mA           LMGRALLNNLTNLGLVDEAAAATRELGHELTDILEIENDAALGNGGLGRLAACFLDSAVTQDYPVTGYGL
3ddsA           YMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3e3nF           YMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           -----------------------------LYQLISTRIPSFASPNGLHMREQTIDSNTGQIQIDNEHRLL
3csoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVP
3e3nA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nH           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
2ecpA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGAV--TKDG-----RWEPEFTITGQA
1ahpA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGAV--TKDG-----RWEPEFTITGQA
3cuvA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1e1yA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGR---VEHTSQGA-KWVDTQVVLAMP
3e3lD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3lA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYG---RVEHTSQG-AKWVDTQVVLAMP
1bx3A           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRV----EHTSQGAKWVDTQVVLAMP
3e3lB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGA----KWVDTQVVLAMP
3e3lC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRV----EHTSQGAKWVDTQVVLAMP
1b4dA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGR---VEHTS-QGAKWVDTQVVLAMP
3dd1B           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKV----EHTNTGTKWIDTQVVLALP
3e3oD           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGA----KWVDTQVVLAMP
3e3nE           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEH----TSQGAKWVDTQVVLAMP
1a8iA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
3e3nC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQV----VLAMP
3ddwB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGK---VEHTNT-GTKWIDTQVVLALP
1e4oA           NYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDVQVGIGGKVTKDG-------RWEPEFTITGQA
3e3oC           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTS----QGAKWVDTQVVLAMP
3e3oB           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRV----EHTSQGAKWVDTQVVLAMP
1c8kA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTS----QGAKWVDTQVVLAMP
2c4mB           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCFDDMK------------------TRAIP
3e3oA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHT----SQGAKWVDTQVVLAMP
2amvA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTS----QGAKWVDTQVVLAMP
1abbA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKWVDTQVVLAMP
1axrA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTS----QGAKWVDTQVVLAMP
3ddsB           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGK---VEHTNT-GTKWIDTQVVLALP
2atiA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGK---VEHTNT-GTKWIDTQVVLALP
3cehA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGK---VEHTNT-GTKWIDTQVVLALP
2c4mC           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCFDDMK------------------TRAIP
3cejA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTG----TKWIDTQVVLALP
1c8lA           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQV----VLAMP
2c4mA           LYRFGLFRQSFNEGFQVEKPDPWREEEYPFTIRRASDQLVVCFDDMKTR------------------AIP
3ddsA           RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKV----EHTNTGTKWIDTQVVLALP
3e3nF           RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQ----GAKWVDTQVVLAMP
3bl9A           ----------------------------PFSGFRLQKVLRESARDKIIFLHG-------KVNEEDAVVIL
3bl9B           --------------------------------------VRLPFSGQKVLRESARD------KIIFLHGKV
3bjdA           -----------------------------------------------------------------LSDDV
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           RWDRRPPNDIFLNGFIPRVTNQNLSPVEDTHLLNYLRTNSPSIFVS----------------------TT
3csoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSA
3e3nA           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nD           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3e3nB           YDTPVPGYRNNVVNTMRLWSAKAP---NGYIQAVLDRNLAENISRVLYP------GKELRLKQEYFVVAA
3e3nH           YDTPVPGYRNNVVNTMRLWSAKAP---NGYIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
2ecpA           WDLPVVGYRNGVAQPLRLWQATHAFNDGDFLRAEQQGINAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
1ahpA           WDLPVVGYRNGVAQPLRLWQATHAFNDGDFLRAEQQGINAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
3cuvA           YDTPVPGYRNNVVNTMRLWSAKAPNDNVGGYQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1e1yA           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3lD           YDTPVPGYRNNVVNTMRLWSAKAP--NDFYIQAVLDRNLAENISRVLYEGK------ELRLKQEYFVVAA
3e3lA           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYQAVLDRNLAENISRVLYPEG-----KELRLKQEYFVVAA
1bx3A           YDTPVPGYRNNVVNTMRLWSAKAPGYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3lB           YDTPVPGYRNNVVNTMRLWSAKAPNDFGGYIQAVLDRNLAENISRVLYPGK------ELRLKQEYFVVAA
3e3lC           YDTPVPGYRNNVVNTMRLWSAKAPNDLGGYIQAVLDRNLAENISRVLYKEL--------RLKQEYFVVAA
1b4dA           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3dd1B           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3oD           YDTPVPGYRNNVVNTMRLWSAKAP--NDFYIQAVLDRNLAENISRVLYE------GKELRLKQEYFVVAA
3e3nE           YDTPVPGYRNNVVNTMRLWSAKAP---NGYIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
1a8iA           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3nC           YDTPVPGYRNNVVNTMRLWSAKAPNG---YIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3ddwB           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1e4oA           WDLPVVGYRNGVAQPLRLWQATHAHPFDLTLRAEQQGINAEKLTKVLYPNDNHTAGKKLRLMQQYFQCAC
3e3oC           YDTPVPGYRNNVVNTMRLWSAKAPNDLGGYIQAVLDRNLAENISRVLYKEL--------RLKQEYFVVAA
3e3oB           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYIQAVLDRNLAENISVLYPEGKE-----LRLKQEYFVVAA
1c8kA           YDTPVPGYRNNVVNTMRLWSAKAPNDVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2c4mB           YDMPITGYGTHNVGTLRLWKAEPWEEFDYDTDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
3e3oA           YDTPVPGYRNNVVNTMRLWSAKAPNDFVGGYQAVLDRNLAENISRVLYPEG-----KELRLKQEYFVVAA
2amvA           YDTPVPGYRNNVVNTMRLWSAKAPNDVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1abbA           YDTPVPGYRNNVVNTMRLWSAKAPNDVGGYIQAVLDRNLAENISRVLYP-----EGKELRLKQEYFVVAA
1axrA           YDTPVPGYRNNVVNTMRLWSAKADFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3ddsB           YDTPVPGYMNNTVNTMRLWSARAPNDFNLRIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2atiA           YDTPVPGYMNNTVNTMRLWSARAPDYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3cehA           YDTPVPGYMNNTVNTMRLWSARAPNDFDYIQAV-LDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2c4mC           YDMPITGYGTHNVGTLRLWKAEPWENAQRFTDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
3cejA           YDTPVPGYMNNTVNTMRLWSARAPDYIQA----VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
1c8lA           YDTPVPGYRNNVVNTMRLWSAKAPNGGYIQA--VLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
2c4mA           YDMPITGYGTHNVGTLRLWKAEPWENAQRFTDAIIERERVSDICRVLYPNDTTYEGKKLRVRQQYFFTSA
3ddsA           YDTPVPGYMNNTVNTMRLWSARAPNDGD-YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAA
3e3nF           YDTPVPGYRNNVVNTMRLWSAK---APNGYIQAVLDRNLAENISRVLY-------GKELRLKQEYFVVAA
3bl9A           EKTPFQVEQVAQLLTGPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEK--HLQKYLRQDLRLIRE
3bl9B           NEDAVVILEKTPFQVEQVAQLLTGSPELQLYHLFPPRQLNDVKTTVVYPATEKHLQK--YLRQDLRLIRE
3bjdA           ATAQTRRWLARAIYRVEERFPAADLSRALQKRLEQEIAAQERHPSQVFSGSASRAQLQVFLRHQWFRTFR
3dkyA           ----------------------------------------RYFTFLLYPESIPSDWELKLETLGVPMAIS
2b7wA           ----------------------------------------------------------------------
2do9A           --------------------------------------------------SGSSGMALARANSPQEALLW
2cb6G           RARYNNLGLEITPWTPHSANNNIIYRYEIFAPGGIDINASFNQDEITFPGGIRPEFIRSTYEYHNGEIVR
3csoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIM
3e3nA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nD           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nB           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3nH           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2ecpA           SVADILRRHHLAGRELHELADYEVIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLM
1ahpA           SVADILRRHHLAGRELHELADYEVIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLM
3cuvA           TLQDIIRRFKSSKN-FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1e1yA           TLQDIIRRFK---SNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3lD           TLQDIIRRFKSSTNFD-AFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3lA           TLQDIIRRFKSTNFD--AFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1bx3A           TLQDIIRRFK---SNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3lB           TLQDIIRRFKSSTN-FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3e3lC           TLQDIIRRFKSS-TNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1b4dA           TLQDIIRRFKSSKN-FDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3dd1B           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3e3oD           TLQDIIRRFKSSTNFD-AFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3nE           TLQDIIRRFKSSNFDAFP--DKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1a8iA           TLQDIIRRFKSSKFNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3nC           TLQDIIRRFKSSNFDAFP--DKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3ddwB           TLQDIIRRFKASKFGGTVFDAFPDIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1e4oA           SVADILRRHHLAGRKLHELADYEVIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLM
3e3oC           TLQDIIRRFKSSRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
3e3oB           TLQDIIRRFKSSKTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1c8kA           TLQDIIRRFKSSKFNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2c4mB           SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMRLLMDEHDMGWEESWAIVSKTFAYTNHTVL
3e3oA           TLQDIIRRFKSTNFD--AFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
2amvA           TLQDIIRRFKSSKFNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
1abbA           TLQDIIRRFKSVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVI
1axrA           TLQDIIRRFKSSKFNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3ddsB           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2atiA           TLQDIIRFKASKFTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3cehA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
2c4mC           SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMRLLMDEHDMGWEESWAIVSKTFAYTNHTVL
3cejA           TLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
1c8lA           TLQDIIRRFKSSNFDAFP--DKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
2c4mA           SLQAMIQDHLAHHKDLSNFAEFHSVQLNDTHPVLAIPELMRLLMDEHDMGWEESWAIVSKTFAYTNHTVL
3ddsA           TLQDIIRRFRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVL
3e3nF           TLQDIIRRFKSSKFNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVL
3bl9A           DYRNITLPHLEVYNILDKKAEADRIVFENPDPSDGFVLI-----------PDLKW--NQQQLDDLYLIAI
3bl9B           DYRNITLPHLWVYNILDKKAEADRIVFENPDPSDGFVLIP-------DLKWNQ------QQLDDLYLIAI
3bjdA           LYRDAADLLVNLTDEAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQAVSTPEEIAYLNN-RA
3dkyA           PLHDKDKSSIKGQKY-KKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHSKD
2b7wA           -------------------------------------NIFEMLRIDEGLRKDTEGYYTIGI----GYTSL
2do9A           ALNDLENSFKTLKF----------HLRDVTQFHLARGELESLSKLISMYGAQEAVRVVSRSLLAMNLMEL
2cb6G           ---IWINPNFINPSTLNDVKVFWHENHSEGNNMDSKGFILDLDYNQDF----------------------
3csoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGV
3e3nA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFDVDRLRRMSLVEEGRINMAHLCIAGSHAVNGV
3e3nD           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFDVDRLRRMSLVEEGRINMAHLCIAGSHAVNGV
3e3nB           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFDVDRLRRMSLVEEGRINMAHLCIAGSHAVNGV
3e3nH           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFDVDRLRRMSLVEEKRINMAHLCIAGSHAVNGV
2ecpA           PEALERWDVKLVKGLLPRHMQIINEINTRFKTLVEKTWDEKVWAKLAVVHDKQVHMANLCVVGGFAVNGV
1ahpA           PEALERWDVKLVKGLLPRHMQIINEINTRFKTLVEKTWDEKVWAKLAVVHDKQVHMANLCVVGGFAVNGV
3cuvA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMGAVKRINMAHLCIAGSHAVNGV
1e1yA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRREGAVKRINMAHLCIAGSHAVNGV
3e3lD           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRREGAVKRINMAHLCIAGSHAVNGV
3e3lA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRAAFPGDVDRLRRMSLVEVKRINMAHLCIAGSHAVNGV
1bx3A           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVKRINMAHLCIAGSHAVNGV
3e3lB           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMGAVKRINMAHLCIAGSHAVNGV
3e3lC           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRAAFPGDVDRLRRMSLVEEKRINMAHLCIAGSHAVNGV
1b4dA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDRMSLVEEGAVKRINMAHLCIAGSHAVNGV
3dd1B           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGV
3e3oD           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRREGAVKRINMAHLCIAGSHAVNGV
3e3nE           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMGAVKRINMAHLCIAGSHAVNGV
1a8iA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRLVEEGAVKRINMAIAGSHAVNGV
3e3nC           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVMSLVEEGAVKRINMAHLCIAGSHAVNGV
3ddwB           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLIEEEGSKRINMAHLCIVGSHAVNGV
1e4oA           PEALERWDVKLVKGLLPRHMQIINEINTRTLVEKTWPGDEKVWAKLAVVHDKQVHMANLCVVGGFAVNGV
3e3oC           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPVDRLRRMSLVEEGAINMAHLCIAGSHAVNGV
3e3oB           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVKRINMAHLCIAGSHAVNGV
1c8kA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRREGAVKRINMAHLCIAGSHAVNGV
2c4mB           TEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLEAADGLDEETINRMAPIQHGTVHMAWIACYAAYSINGV
3e3oA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDRMSLVEEGAVKRINMAHLCIAGSHAVNGV
2amvA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV
1abbA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDRMSLVEEGAVKRINMAHLCIAGSHAVNGV
1axrA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRREGAVKRINMAHLCIAGSHAVNGV
3ddsB           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIKRINMAHLCIVGSHAVNGV
2atiA           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRREEGSKRINMAHLCIVGSHAVNGV
3cehA           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDRMSLIEEEGSKRINMAHLCIVGSHAVNGV
2c4mC           TEALEQWDEQIFQQLFWRVWEIIAEIDRRFLERAADGLDEETINRMAPIQHGTVHMAWIACYAAYSINGV
3cejA           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIKRINMAHLCIVGSHAVNGV
1c8lA           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV
2c4mA           TEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADGLDEETINRMAPIHGTVHMAWIACYAAYSINGV
3ddsA           PEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRREEGSKRINMAHLCIVGSHAVNGV
3e3nF           PEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDRMSLVEEGAVKRINMAHLCIAGSHAVNGV
3bl9A           CHRRGIRSL---RDLTPEHLPLLRNILHQGQEAILQRYRMKG-DHLRVYSYYHLHVHFTALGFEAPGSGV
3bl9B           CHRRGIRSL---RDLTPEHLPLLRNILHQGQEAILQRYRMKG-DHLRVYSYYHLHVHFTALGFEAPGSGV
3bjdA           RAFRHAEVGWGLAVFYITEL-VVPGNHEKLYRALLQAGQAEYYKVHISLVPKQLIARRIPDVQFQNAFLT
3dkyA           AIAKKKHVKLINNFDIDRYVTLDVEEKTELFNV-----VVSLIRAYTLQNLYDFIDENGETYGINLVNEV
2b7wA           NAAKSELDKAIGRNTNGVITK--DEAEKLFNQDVD-AAVRGILRNAKLKPDAVRRAALINMVFQMGETGV
2do9A           VDYLNQVCLNDYREIYREHVS-------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ
3e3nA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3nD           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3nB           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3nH           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
2ecpA           AALHSDLVVKDLFPEYHQLWPNKFHNVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLVKLA
1ahpA           AALHSDLVVKDLFPEYHQLWPNKFHNVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLVKLA
3cuvA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1e1yA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3lD           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3lA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1bx3A           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3lB           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3lC           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1b4dA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3dd1B           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
3e3oD           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3nE           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1a8iA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3nC           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3ddwB           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
1e4oA           AALHSDLVVKDLFPEYHQLWPNKFHNVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLEKFA
3e3oC           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3e3oB           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1c8kA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
2c4mB           AALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTRLSGDDWVTDLDELKKLRSYA
3e3oA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
2amvA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1abbA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
1axrA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3ddsB           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
2atiA           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
3cehA           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
2c4mC           AALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTRLSGSDWVTDLDELKKLRSYA
3cejA           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
1c8lA           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
2c4mA           AALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTRLSGSDWVTDLDELKKLRSYA
3ddsA           AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFL
3e3nF           ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYV
3bl9A           ERAH---LLAEVI-ENLECDPRHYQQRTLTFALRA-----DDPLLKLLQEA-------------------
3bl9B           ERAHLL----AEVIENLECDPRHYQQRTLTFALRA-----DDPLLKLLQEA-------------------
3bjdA           SLSQHFRVERAYYDAIWEEQS-------------------------------------------------
3dkyA           IAGKTGFMKLLFDGAYQ-----------------------------------------------------
2b7wA           AG-FTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWD---------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKV
3e3nA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
3e3nD           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
3e3nB           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
3e3nH           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
2ecpA           DDAKFRDLYRVIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLNLLRILALYKEIRENPQ
1ahpA           DDAKFRDLYRVIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLNLLRILALYKEIRENPQ
3cuvA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
1e1yA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
3e3lD           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3e3lA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLL-NCLHVITLYNRIKKEP
1bx3A           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3e3lB           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3e3lC           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
1b4dA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP-
3dd1B           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
3e3oD           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3e3nE           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
1a8iA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3e3nC           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3ddwB           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
1e4oA           DDAKFRDQYREIKQANKVRLAEFVKVRTGIEINPQAIFDIQIKRLHEYKRQHLNLLHILALYKEIRENPQ
3e3oC           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP-
3e3oB           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP-
1c8kA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
2c4mB           DDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKE-DG
3e3oA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
2amvA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPN
1abbA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
1axrA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPN
3ddsB           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPK
2atiA           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
3cehA           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
2c4mC           DDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKE-DG
3cejA           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
1c8lA           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKE-P
2c4mA           DDKSVLEELRAIKAANKQDFAEWILERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKE-DG
3ddsA           GDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKK-DP
3e3nF           DDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK-EP
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISE
3e3nA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3nD           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3nB           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3nH           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
2ecpA           A-DRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISE
1ahpA           A-DRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISE
3cuvA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1e1yA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3lD           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3lA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1bx3A           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3lB           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3lC           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1b4dA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3dd1B           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
3e3oD           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3nE           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1a8iA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3nC           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3ddwB           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
1e4oA           A-DRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISE
3e3oC           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3e3oB           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1c8kA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
2c4mB           LTDIPARTVIFGAKAAPGYVRAKAIIKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSE
3e3oA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
2amvA           K-FVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1abbA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
1axrA           K-FVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3ddsB           KLFVPRTVIIGG-KAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
2atiA           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
3cehA           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
2c4mC           LTDIPARTVIFGAKAAPGYVRAKAIIKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSE
3cejA           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
1c8lA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
2c4mA           LTDIPARTVIFGAKAAPGYVRAKAIIKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSE
3ddsA           KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSE
3e3nF           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSE
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           QISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN
3e3nA           QISTAGTEASGTGNMF-MLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3nD           QISTAGTEASGTGNMF-MLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3nB           QISTAGTEASGTGNMF-MLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3nH           QISTAGTEASGTGNMF-MLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
2ecpA           QISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKAILAKG-YDPVKWRK
1ahpA           QISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKAILAKG-YDPVKWRK
3cuvA           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAG-EENFFIFGMRVEDV-DRLDQRGYNAQEYYD
1e1yA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
3e3lD           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAG-EENFFIFGMRVEDV-DRLDQRGYNAQEYYD
3e3lA           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAG-EENFFIFGMRVEDV-DRLDQRGYNAQEYYD
1bx3A           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
3e3lB           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3lC           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
1b4dA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
3dd1B           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
3e3oD           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEE-NFFIFGMRVEDV-DRLDQRGYNAQEYYD
3e3nE           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
1a8iA           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3nC           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDV-DRLDQRGYNAQEYYD
3ddwB           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
1e4oA           QISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKAILAKGYDPVKWRKK
3e3oC           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
3e3oB           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
1c8kA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
2c4mB           QISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIF--GARVEELPALRESYKPYELYE
3e3oA           QISTAGTEASGTGNMFMLNGA-LTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
2amvA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDR
1abbA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
1axrA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDR
3ddsB           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDV-AALDKKGYEAKEYYE
2atiA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
3cehA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDV-AALDKKGYEAKEYYE
2c4mC           QISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIF--GARVEELPALRESYKPYELYE
3cejA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
1c8lA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRG-YNAQEYYD
2c4mA           QISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIF--GARVEELPALRESYKPYELYE
3ddsA           QISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYE
3e3nF           QISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFG--MRVEDVDRLDQRGYNAQEYYD
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           -----------------------------------------------------LWARMILMTHFFSILLA


                         .         .         .         .         +         .         .:770
query           NHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLV
3e3nA           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3nD           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3nB           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3nH           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
2ecpA           KDKVLDAVLKELESGYSDGDKHAFDQMLHSGKQGGDPYLVMADFAAYVEAQKQVDVLYRDQEAWTRAAIL
1ahpA           KDKVLDAVLKELESGYSDGDKHAFDQMLHSGKQGGDPYLVMADFAAYVEAQKQVDVLYRDQEAWTRAAIL
3cuvA           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1e1yA           RIPELRQIIEQLSGFFSPKQPDLFKDIVNML-MHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3lD           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3lA           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1bx3A           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3lB           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3lC           RIPELRQIIEQLSSGFSPKQPDLFKDIVNML-MHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1b4dA           RIPELRQIIEQLSSGFSPKQPDLFKDIVNML-MHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3dd1B           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
3e3oD           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3nE           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1a8iA           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3nC           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3ddwB           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
1e4oA           DKVLDAVLKELESGKYSDGDKHAFDQMLHSIGQGGDPYLVMADFAAYVEAQKQVDVLYRDQEAWTRAAIL
3e3oC           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3e3oB           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1c8kA           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
2c4mB           TVPGLKRALDALDNGLNDNNSGLFYDLKHSLIHASDTYYVLGDFADYRETRDRMAADYADPLGWARMAWI
3e3oA           RIPELRQIIEQLSSGFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
2amvA           IPELRQIIEQLSSGFFSPKQPDLFKDIVNML-MHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1abbA           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
1axrA           IPELRQIIEQLSSGFFSPKQPDLFKDIVNML-MHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3ddsB           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
2atiA           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
3cehA           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
2c4mC           TVPGLKRALDALDNGLNDNNSGLFYDLKHSLIHGYDTYYVLGDFADYRETRDRMAADYASPLGWARMAWI
3cejA           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
1c8lA           RIPELRQIIEQLSGFFSPKQPDLFKDIVNMLMH-HDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
2c4mA           TVPGLKRALDALDNGLNDNNSGLFYDLKHSLIHGYDTYYVLGDFADYRETRDRMAADYSDPLGWARMAWI
3ddsA           ALPELKLVIDQIDNGFSPKQPDLFKDIINMLFY-HDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLK
3e3nF           RIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIR
3bl9A           ----------------------------------------------------------------------
3bl9B           ----------------------------------------------------------------------
3bjdA           ----------------------------------------------------------------------
3dkyA           ----------------------------------------------------------------------
2b7wA           ----------------------------------------------------------------------
2do9A           ----------------------------------------------------------------------
2cb6G           ----------------------------------------------------------------------
3csoA           QEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFTLHSYSPGEINRVASCLRKLGVPPLRTWRHRAR


                         .         .         *         .         .         .         .:840
query           NIAYGGMFSSDDTIKRYAEDIWNISPLKDEKxxxxxx
3e3nA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3nD           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3nB           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3nH           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
2ecpA           NTARCGMFSSDRSIRDYQARIWQA-------------
1ahpA           NTARCGMFSSDRSIRDYQARIWQA-------------
3cuvA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1e1yA           NIATSGKFSSDRTIAQYAREIWGVEP-----------
3e3lD           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3lA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1bx3A           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3lB           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3lC           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1b4dA           NIATSGKFSSDRTIAQYAREIWGVEPSRQR-------
3dd1B           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
3e3oD           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3nE           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1a8iA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3nC           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3ddwB           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
1e4oA           NTARCGMFSSDRSIRDYQARIWQA-------------
3e3oC           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3e3oB           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1c8kA           NIATSGKFSSDRTIAQYAREIWGVEPSRQR-------
2c4mB           NICESGRFSSDRTIRDYATEIWKLEPTP---------
3e3oA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
2amvA           NIATSGKFSSDRTIAQYAREIWGVEPSRQR-------
1abbA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
1axrA           NIATSGKFSSDRTIAQYAREIWGVEPSRQR-------
3ddsB           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
2atiA           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
3cehA           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
2c4mC           NICESGRFSSDRTIRDYATEIWKLEPTPAVK------
3cejA           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
1c8lA           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
2c4mA           NICESGRFSSDRTIRDYATEIWKLEP-----------
3ddsA           NIAASGKFSSDRTIKEYAQNIWNVEP-----------
3e3nF           NIATSGKFSSDRTIAQYAREIWGVEPSR---------
3bl9A           -------------------------------------
3bl9B           -------------------------------------
3bjdA           -------------------------------------
3dkyA           -------------------------------------
2b7wA           -------------------------------------
2do9A           -------------------------------------
2cb6G           -------------------------------------
3csoA           SVRAKLSQGGRAATCGRYLFNWAVRT-----------