[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00183.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bkoA.bssp"
#ERROR : Can't open dsspfile "2bknA.bssp"
#ERROR : Can't open dsspfile "2aemA.bssp"
#ERROR : Can't open dsspfile "2aefA.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"

## Summary of PDB Search
:618
    2e-10  10%  2bkoA  [x.x.x] HYPOTHETICAL PROTEIN PH0236
    3e-10  13%  2bknA  [x.x.x] HYPOTHETICAL PROTEIN PH0236
    6e-08  15%  2aemA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    1e-05  15%  2aefA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    4e-05  16%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    2e-04  16%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
2aefA           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIIGVNLVTVSAAQQLS
2bkoA           ----------------------------------------------------------------------
2bknA           ----------------------------------------------------------------------
2aemA           ------------------------------------------------------ICGWSESTLECLRELR
2aefA           ------------------------------------------------------ICGWSESTLECLRELR
2aefB           ------------------------------------------------------ICGWSESTLECLRELR
2aejB           ------------------------------------------------------ICGWSESTLECLRELR


                         .         .         +         .         .         .         .:490
query           KGMYDVQMYTDNSKNFTTYNSQANVHFLDSLDPDELIANHIFDTDILVLGYADYNVNYKLSLAAKKYGVN
2bkoA           ----------------------PKSVKEIFIEMKDTVELMVDLAYASLIDLLNYQLMMHSVLAARNVKEA
2bknA           ------------------------SVKEIFIEMKDTVELMVDLAYASLLFGDKYQLMMHSVLAARNVKEA
2aemA           GSEVFV-LAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKDESV
2aefA           GSEVFVLAE-DENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHC-ILGIRKIDE
2aefB           GSEVFVLAE-DENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDSV
2aejB           GSEVFVLAE-DENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVDLESDSETIHILGIRKIDESV


                         *         .         .         .         .         +         .:560
query           RVIVRFENRNPLNDMEDELKKAGIEYFSYFDINVGMMRSMIDSPSMLQILTSSESRLYEVVVNDSIFVGV
2bkoA           EQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKI--------QVYPESVIVGK
2bknA           EQVITILQIANA---IEDISNAAGDLAKMV-----LEGVELHPVIKETILEGEEIIGKIQVYPESVIVGK
2aemA           RIIAEAERYENIEQLRMAGADQVIMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSV-LDA
2aefA           SVRIIAEAERYENIEQLRMAGADQVISPFVISGRMFVQDVLATRRMVEVPIPEGSKLEGVSVLD-----A
2aefB           RIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQAEESTRRMVEVPIPEGSKLEGA
2aejB           RIIAEAERYENIEQLRMAGADQVISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKA


                         .         .         .         *         .         .         .:630
query           EVKDLPHIDKITISRIYRNGHAIAPHGYTQLQLGDHIIFSASAEESAYFRRKLQRRNE
2bkoA           TLGELATNTGVWIIAVRRGKRWIGPNENFKIRAGDVLIGRGTRTSIDHLKEIAR----
2bknA           TLGELATNTGVWIIAVRRGKRWIGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR
2aemA           DIHDVTGVIIIGVGR--GDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYIS----
2aefA           DIHDVTGVIIIGVGR--GDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALV-
2aefB           DIHDVTGVIIIGVGR--GDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYI-----
2aejB           DIHDVTGVIIIGVGR--GDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYI-----