[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d5bG.bssp"
#ERROR : Can't open dsspfile "3bboH.bssp"

## Summary of PDB Search
:180
    3e-74  56%  3d5bG  [x.x.x] 50S RIBOSOMAL PROTEIN L5
    8e-45  58%  3bboH  [x.x.x] RIBOSOMAL PROTEIN L5
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVNRLKEKYDNEIVPSLMEKFNYTSIMQAPKVDKIVINMGVGDAVSNAKRLDEAVDELTLIAGQKPVITK
3d5bG           LDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTR
3bboH           ---RLKTNYIEKMVPLLKEEFSYSNILEVPKVVKIVVNCGIGDASQNAKGLDAAINELALITGQRPVKTK


                         .         .         *         .         .         .         .:140
query           AKKSIAGFRLREGMAIGAKVTLRGQRMYEFLDKLVSVSLPRVRDFHGVSKRAFDGRGNYTLGIREQLIFP
3d5bG           AKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFP
3bboH           AKTSIAGFKVREGMTLGIAVTLRGNLMYSFLDRLINLALPRTRDFQGVNPNSFDGHGNYSVGFREQSVFP


                         +         .         .         .         .         *         .:210
query           EIDFDDVNKVRGMDIVIVTTANTDEESRELLTQLGMPFAK
3d5bG           EITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK
3bboH           EIKPEIVGKARGMDVCITTTAKTDKEAYKLLSLMGMPF--