[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00229.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bboM.bssp"

## Summary of PDB Search
:122
    1e-40  52%  3bboM  [x.x.x] RIBOSOMAL PROTEIN L14
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIQQESRLKVADNSGAREILVIKILGGSRVKTANIGDIIVATVKQATPXXXXXXXXXXXXXXXRTKYGTH
3bboM           MIQPQTHLNVADNSGARELMCIRIIGASNRRYARIGDVIVAVIKEAIPNTPLERSEVIRAVVVRTCKELK


                         .         .         *         .         .         .         .:140
query           RPDGSYIKFDENAAVIIGEDKSPKGTRIFGPVARELRDGNFMKIVSLAPEVL
3bboM           RDNGMIIRYDDNAAVIIDQEGNPKGTRIFGAIARELRQ-KFAKIVSLAPEVL