[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00286.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "3dpuB.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"

## Summary of PDB Search
:296
    3e-29  18%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-26  19%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    5e-24  19%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    6e-24  16%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    8e-22  13%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    3e-21  10%  3dpuB  [x.x.x] RAB FAMILY PROTEIN
    6e-13  17%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-06  14%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    3e-06  16%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    3e-05  18%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    7e-05  17%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
:296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxNKESDEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDENV
3dh3B           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV-----------K
3dh3A           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLI-----
3dh3C           ---------DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKR-----------ATIGDQVKPGDVVK
2apoA           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dpuB           -------TIGVYRIINSSKTKNGHLNTSALGYILNEENNKFTYTLLEQRYLLDIMKQFELDEGKGLFIIP
2ausA           -----------------------------------------------------KREVIVKDDKAETNPKW
1dm9A           ---------AVEVRLDKWLWAARYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQGNDERTVI
1c05A           -----NFMILLESRLDNLVYRLGL-ARTRRQARQTHGHILVDGSRVNPSYRVKPGQTIAVREKSRNL-QV
3bbnD           -----VLLQLLEMRLDNILFRLGMA-PTIPGARQLHRHILVNGRIVDIPSYRCKPQDTIMARDEQKSIAL
2ausC           --------------------------------------------------------------NPKWGFPP


                         .         .         *         .         .         .         .:140
query           KMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLV
3dh3B           VNGQLIEPREAEDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRV---------FPIGRLDKDSQGLI
3dh3A           ------EPREAEDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRV---------FPIGRLDKDSQGLI
3dh3C           VNGQLIEPREAEDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRV---------FPIGRLDKDSQGLI
2apoA           ----ERKIEDLIKYGVVVVDKPRGPTSHEV--------STWVKKILNLDK-----AGHGGTLDPKVTGVL
2ab4A           ------------KHGILVAYKPKGPTSHD--------VVDEVRKKLKTRK-----VGHGGTLDPFACGVL
3dpuB           SNLPTQIDNEPEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRY------GMVLKSQDHEGALAK
2ausA           GFPPDKRPIEHIQYGVINLDKPPGPTSHE--------VVAWIKRILNLEK-----AGHGGTLDPKVSGVL
1dm9A           VKAITEQRRPASEAALLYEETAE-----------------------------------------------
1c05A           IKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEINE-----------------------------
3bbnD           IQNSLDLSPREELPKHLTLNPFPYKG-----------LVNQ--------------IIDSKWVGLKINELL
2ausC           D---KRPIELHIQYGVINLDKPPGPTSHEVV--------AWIKRILNLEK----AGHGG-TLDPKVSGVL


                         +         .         .         .         .         *         .:210
query           LVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVRE
3dh3B           FLTNHGDLVNKILRAG--NDHEKEYLVTVDKPITEEFIRGMSAG---------VPILGTVTKKCKVKKEA
3dh3A           FLTNHGDLVNKILRA--GNDHEKEYLVTVDKPITEEFIRGMSAGVPILGT------------VTKKCKVK
3dh3C           FLTNHGDLVNKILRAG--NDHEKEYLVTVDKPITEEFIRGMSAG---------VPILGTVTKKCKVKKEA
2apoA           PVALERATKTIP----MWHIPPKEYVCLMHLHRDASEEDILRVF------KEFTGRIYQRRIRKIHELEL
2ab4A           IIGVNQGTR----ILEFYKDLKKVFWVKMRLGLITETFDITSFVGEYDQVPPAYKIINLPPKRVKIFKIW
3dpuB           VVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINDVKEFIPLPLVEYKELLGLEKMGRDRYVSGKLEK
2ausA           PVALERATRVVQ----ALLPAGKEYVALMHLHGDVPEDKIRAVMKE-------FEGEIIQRKVYYIEILE
1dm9A           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           VV--------------------------------------------------------------------
2ausC           PVALERATRVVQALLPAGKE-----------YVALMHLHGDVPEDKIRAVMKEFEGEIIQRTRKVYYIEI


                         .         .         .         +         .         .         .:280
query           YLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGRLDWGLERQALHAYQLAYVDPFTQEEKLFK
3dh3B           P-----FVFRITLVQGLNRQIRRMCEHFGYEVKKLERT------RIMNVSLSGIPLGEWRDLTDDELIDL
3dh3A           KEAP--FVFRITLVQGLNRQIRRMCEHFGYEVKKLERT------RIMNVSLSGIPLGEWRDLTDDELIDL
3dh3C           P-----FVFRITLVQGLNRQIRRMCEHFGYEVKKLERT------RIMNVSLSGIPLGEWRDLTDDELIDL
2apoA           LDKDG-KDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQ-----ELRRTKSGCFEEKDAVYLQDLLDAYV
2ab4A           DVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVE-----LVRESVGPHTIEESLNVFEAAPEEI
3dpuB           VFSV-SKMLDSVIS--------------------------------------------------------
2ausA           IDGRDVLFVGVEAGTYIRSLIHHIGLALGVGAHMAELR--------------------------------
1dm9A           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
2ausC           LEIDG-RDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMAEL-----------------------------


                         .         *         .         .         .         .         +:350
query           SEMPKDLENLIxxxxx
3dh3B           FKLIENSSSEV-----
3dh3A           FKLIENSS--------
3dh3C           FKLIENSS--------
2apoA           FWKEDGDEEEL-----
2ab4A           ENRIIPLEKCL-----
3dpuB           ----------------
2ausA           ----------------
1dm9A           ----------------
1c05A           ----------------
3bbnD           ----------------
2ausC           ----------------