[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00290.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c00A.bssp"
#ERROR : Can't open dsspfile "1b41A.bssp"
#ERROR : Can't open dsspfile "2c7bB.bssp"
#ERROR : Can't open dsspfile "3djyA.bssp"
#ERROR : Can't open dsspfile "3dl7A.bssp"
#ERROR : Can't open dsspfile "3bjrA.bssp"
#ERROR : Can't open dsspfile "2c58A.bssp"
#ERROR : Can't open dsspfile "1amnA.bssp"
#ERROR : Can't open dsspfile "1cpyA.bssp"
#ERROR : Can't open dsspfile "3dl4A.bssp"
#ERROR : Can't open dsspfile "2c7bA.bssp"
#ERROR : Can't open dsspfile "1ea5A.bssp"
#ERROR : Can't open dsspfile "1crlA.bssp"
#ERROR : Can't open dsspfile "3ccbA.bssp"
#ERROR : Can't open dsspfile "1acjA.bssp"
#ERROR : Can't open dsspfile "3dnmA.bssp"
#ERROR : Can't open dsspfile "1e3qA.bssp"
#ERROR : Can't open dsspfile "1aclA.bssp"
#ERROR : Can't open dsspfile "3dl7B.bssp"
#ERROR : Can't open dsspfile "2dfpA.bssp"
#ERROR : Can't open dsspfile "3dl4B.bssp"
#ERROR : Can't open dsspfile "1c7jA.bssp"
#ERROR : Can't open dsspfile "3dnmD.bssp"
#ERROR : Can't open dsspfile "3bl8D.bssp"
#ERROR : Can't open dsspfile "3c8hB.bssp"
#ERROR : Can't open dsspfile "3bxpA.bssp"
#ERROR : Can't open dsspfile "1cleA.bssp"
#ERROR : Can't open dsspfile "3bxpB.bssp"
#ERROR : Can't open dsspfile "3ccbB.bssp"
#ERROR : Can't open dsspfile "3d3nB.bssp"
#ERROR : Can't open dsspfile "1c7iA.bssp"
#ERROR : Can't open dsspfile "2d81A.bssp"
#ERROR : Can't open dsspfile "3eblA.bssp"
#ERROR : Can't open dsspfile "3be8A.bssp"
#ERROR : Can't open dsspfile "3dnmB.bssp"
#ERROR : Can't open dsspfile "3dnmC.bssp"
#ERROR : Can't open dsspfile "3bl8C.bssp"
#ERROR : Can't open dsspfile "3bl8B.bssp"
#ERROR : Can't open dsspfile "3bixA.bssp"
#ERROR : Can't open dsspfile "1c2bA.bssp"
#ERROR : Can't open dsspfile "1e5tA.bssp"
#ERROR : Can't open dsspfile "3eblF.bssp"
#ERROR : Can't open dsspfile "3c8dC.bssp"
#ERROR : Can't open dsspfile "1dx4A.bssp"
#ERROR : Can't open dsspfile "1aqlA.bssp"
#ERROR : Can't open dsspfile "2eepA.bssp"
#ERROR : Can't open dsspfile "3be8B.bssp"
#ERROR : Can't open dsspfile "1dqzA.bssp"
#ERROR : Can't open dsspfile "3b3qA.bssp"
#ERROR : Can't open dsspfile "1dqyA.bssp"
#ERROR : Can't open dsspfile "3eblB.bssp"
#ERROR : Can't open dsspfile "3ed1A.bssp"
#ERROR : Can't open dsspfile "3eblE.bssp"
#ERROR : Can't open dsspfile "1e8mA.bssp"
#ERROR : Can't open dsspfile "3d3nA.bssp"
#ERROR : Can't open dsspfile "1auoA.bssp"
#ERROR : Can't open dsspfile "3d0kA.bssp"
#ERROR : Can't open dsspfile "3biwA.bssp"
#ERROR : Can't open dsspfile "3eblC.bssp"
#ERROR : Can't open dsspfile "3c8dB.bssp"
#ERROR : Can't open dsspfile "3bl8A.bssp"
#ERROR : Can't open dsspfile "3dyvA.bssp"
#ERROR : Can't open dsspfile "2bceA.bssp"
#ERROR : Can't open dsspfile "2ajlI.bssp"
#ERROR : Can't open dsspfile "3c8hA.bssp"
#ERROR : Can't open dsspfile "3ed1B.bssp"
#ERROR : Can't open dsspfile "3c8dD.bssp"
#ERROR : Can't open dsspfile "3cn7A.bssp"
#ERROR : Can't open dsspfile "3ed1E.bssp"
#ERROR : Can't open dsspfile "3dltA.bssp"
#ERROR : Can't open dsspfile "3c87A.bssp"
#ERROR : Can't open dsspfile "1aknA.bssp"
#ERROR : Can't open dsspfile "3eblD.bssp"
#ERROR : Can't open dsspfile "2e3jA.bssp"
#ERROR : Can't open dsspfile "2b20A.bssp"
#ERROR : Can't open dsspfile "3dohB.bssp"
#ERROR : Can't open dsspfile "2dcmA.bssp"
#ERROR : Can't open dsspfile "3d7rB.bssp"
#ERROR : Can't open dsspfile "3c8dA.bssp"
#ERROR : Can't open dsspfile "3e4dA.bssp"
#ERROR : Can't open dsspfile "3dkrA.bssp"
#ERROR : Can't open dsspfile "3d7rA.bssp"
#ERROR : Can't open dsspfile "1cujA.bssp"
#ERROR : Can't open dsspfile "1bcrA.bssp"
#ERROR : Can't open dsspfile "1bcsA.bssp"
#ERROR : Can't open dsspfile "1cuzA.bssp"
#ERROR : Can't open dsspfile "3d0kB.bssp"
#ERROR : Can't open dsspfile "2d5lA.bssp"
#ERROR : Can't open dsspfile "3dohA.bssp"
#ERROR : Can't open dsspfile "3c87B.bssp"
#ERROR : Can't open dsspfile "2bklA.bssp"
#ERROR : Can't open dsspfile "2ecfA.bssp"
#ERROR : Can't open dsspfile "2czqA.bssp"
#ERROR : Can't open dsspfile "1cuxA.bssp"
#ERROR : Can't open dsspfile "1agyA.bssp"
#ERROR : Can't open dsspfile "3dd5C.bssp"
#ERROR : Can't open dsspfile "2d80A.bssp"
#ERROR : Can't open dsspfile "1cuyA.bssp"

## Summary of PDB Search
:273
    8e-15  12%  1c00A  [x.x.x] PARA-NITROBENZYL ESTERASE
    3e-14   9%  1b41A  [c.69.1] ACETYLCHOLINESTERASE
    6e-14  20%  2c7bB  [x.x.x] CARBOXYLESTERASE
    2e-13   8%  3djyA  [x.x.x] CHOLINESTERASE
    3e-13   8%  3dl7A  [x.x.x] ACETYLCHOLINESTERASE
    3e-13  29%  3bjrA  [x.x.x] PUTATIVE CARBOXYLESTERASE
    3e-13   9%  2c58A  [x.x.x] ACETYLCHOLINESTERASE
    4e-13  12%  1amnA  [c.69.1 (1eeaA)] ACETYLCHOLINESTERASE
    6e-13  11%  1cpyA  [x.x.x] SERINE CARBOXYPEPTIDASE
    8e-13   6%  3dl4A  [x.x.x] ACETYLCHOLINESTERASE
    3e-12  18%  2c7bA  [x.x.x] CARBOXYLESTERASE
    4e-12  11%  1ea5A  [c.69.1] ACETYLCHOLINESTERASE
    4e-12  11%  1crlA  [x.x.x] LIPASE
    6e-12  14%  3ccbA  [x.x.x] DIPEPTIDYL PEPTIDASE 4
    1e-11  11%  1acjA  [c.69.1 (1dx6A)] ACETYLCHOLINESTERASE
    1e-11  18%  3dnmA  [x.x.x] ESTERASE/LIPASE
    2e-11  12%  1e3qA  [c.69.1] ACETYLCHOLINESTERASE
    2e-11  14%  1aclA  [c.69.1 (1qtiA)] ACETYLCHOLINESTERASE
    2e-11   8%  3dl7B  [x.x.x] ACETYLCHOLINESTERASE
    2e-11  10%  2dfpA  [c.69.1] PROTEIN (ACETYLCHOLINESTERASE)
    2e-11   9%  3dl4B  [x.x.x] ACETYLCHOLINESTERASE
    4e-11  12%  1c7jA  [c.69.1] PROTEIN (PARA-NITROBENZYL ESTERASE)
    5e-11  16%  3dnmD  [x.x.x] ESTERASE/LIPASE
    5e-11  11%  3bl8D  [x.x.x] NEUROLIGIN-2
    2e-10   9%  3c8hB  [x.x.x] ENTEROCHELIN ESTERASE
    2e-10  23%  3bxpA  [x.x.x] PUTATIVE LIPASE/ESTERASE
    2e-10  11%  1cleA  [c.69.1] CHOLESTEROL ESTERASE
    2e-10  30%  3bxpB  [x.x.x] PUTATIVE LIPASE/ESTERASE
    2e-10  12%  3ccbB  [x.x.x] DIPEPTIDYL PEPTIDASE 4
    3e-10  29%  3d3nB  [x.x.x] PUTATIVE LIPASE/ESTERASE
    5e-10  12%  1c7iA  [c.69.1] PROTEIN (PARA-NITROBENZYL ESTERASE)
    2e-09  13%  2d81A  [x.x.x] PHB DEPOLYMERASE
    2e-09  15%  3eblA  [x.x.x] GIBBERELLIN RECEPTOR GID1
    3e-09  11%  3be8A  [x.x.x] NEUROLIGIN-4, X-LINKED
    4e-09  17%  3dnmB  [x.x.x] ESTERASE/LIPASE
    4e-09  17%  3dnmC  [x.x.x] ESTERASE/LIPASE
    5e-09  12%  3bl8C  [x.x.x] NEUROLIGIN-2
    5e-09  12%  3bl8B  [x.x.x] NEUROLIGIN-2
    9e-09  10%  3bixA  [x.x.x] NEUROLIGIN-1
    2e-08  12%  1c2bA  [c.69.1] ACETYLCHOLINESTERASE
    2e-08  15%  1e5tA  [b.69.7 - c.69.1] PROLYL ENDOPEPTIDASE
    3e-08  15%  3eblF  [x.x.x] GIBBERELLIN RECEPTOR GID1
    4e-08  11%  3c8dC  [x.x.x] ENTEROCHELIN ESTERASE
    4e-08  11%  1dx4A  [c.69.1] ACETYLCHOLINESTERASE
    4e-08  11%  1aqlA  [c.69.1] BILE-SALT ACTIVATED LIPASE
    4e-08  14%  2eepA  [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE
    6e-08  11%  3be8B  [x.x.x] NEUROLIGIN-4, X-LINKED
    8e-08  11%  1dqzA  [c.69.1] PROTEIN (ANTIGEN 85-C)
    1e-07  16%  3b3qA  [x.x.x] NLGN1 PROTEIN
    1e-07  11%  1dqyA  [c.69.1] PROTEIN (ANTIGEN 85-C)
    2e-07  14%  3eblB  [x.x.x] GIBBERELLIN RECEPTOR GID1
    2e-07  15%  3ed1A  [x.x.x] GIBBERELLIN RECEPTOR GID1
    2e-07  14%  3eblE  [x.x.x] GIBBERELLIN RECEPTOR GID1
    3e-07  13%  1e8mA  [b.69.7 - c.69.1] PROLYL ENDOPEPTIDASE
    3e-07  28%  3d3nA  [x.x.x] PUTATIVE LIPASE/ESTERASE
    3e-07  13%  1auoA  [c.69.1] CARBOXYLESTERASE
    3e-07  12%  3d0kA  [x.x.x] PUTATIVE POLY(3-HYDROXYBUTYRATE) DEPOLYMERASE
    5e-07  10%  3biwA  [x.x.x] NEUROLIGIN-1
    5e-07  14%  3eblC  [x.x.x] GIBBERELLIN RECEPTOR GID1
    1e-06  11%  3c8dB  [x.x.x] ENTEROCHELIN ESTERASE
    1e-06  12%  3bl8A  [x.x.x] NEUROLIGIN-2
    1e-06  12%  3dyvA  [x.x.x] ESTERASE D
    2e-06  10%  2bceA  [x.x.x] CHOLESTEROL ESTERASE
    2e-06  12%  2ajlI  [x.x.x] DIPEPTIDYL PEPTIDASE 4
    2e-06  11%  3c8hA  [x.x.x] ENTEROCHELIN ESTERASE
    2e-06  12%  3ed1B  [x.x.x] GIBBERELLIN RECEPTOR GID1
    2e-06  11%  3c8dD  [x.x.x] ENTEROCHELIN ESTERASE
    2e-06  12%  3cn7A  [x.x.x] CARBOXYLESTERASE
    3e-06  11%  3ed1E  [x.x.x] GIBBERELLIN RECEPTOR GID1
    4e-06   9%  3dltA  [x.x.x] ESTERASE D
    5e-06   9%  3c87A  [x.x.x] ENTEROCHELIN ESTERASE
    5e-06  10%  1aknA  [x.x.x] BILE-SALT ACTIVATED LIPASE
    7e-06  12%  3eblD  [x.x.x] GIBBERELLIN RECEPTOR GID1
    7e-06   9%  2e3jA  [x.x.x] EPOXIDE HYDROLASE EPHB
    7e-06  10%  2b20A  [x.x.x] ENTEROCHELIN ESTERASE
    9e-06  16%  3dohB  [x.x.x] ESTERASE
    1e-05  21%  2dcmA  [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE
    2e-05  21%  3d7rB  [x.x.x] ESTERASE
    2e-05   9%  3c8dA  [x.x.x] ENTEROCHELIN ESTERASE
    2e-05  15%  3e4dA  [x.x.x] ESTERASE D
    2e-05  11%  3dkrA  [x.x.x] ESTERASE D
    4e-05  12%  3d7rA  [x.x.x] ESTERASE
    4e-05  13%  1cujA  [x.x.x] CUTINASE
    4e-05  15%  1bcrA  [c.69.1] SERINE CARBOXYPEPTIDASE II
    5e-05  13%  1bcsA  [c.69.1] SERINE CARBOXYPEPTIDASE II
    6e-05  12%  1cuzA  [x.x.x] CUTINASE
    1e-04  11%  3d0kB  [x.x.x] PUTATIVE POLY(3-HYDROXYBUTYRATE) DEPOLYMERASE
    1e-04  16%  2d5lA  [x.x.x] DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE
    2e-04  20%  3dohA  [x.x.x] ESTERASE
    2e-04   7%  3c87B  [x.x.x] ENTEROCHELIN ESTERASE
    3e-04  20%  2bklA  [x.x.x] PROLYL ENDOPEPTIDASE
    5e-04  33%  2ecfA  [x.x.x] DIPEPTIDYL PEPTIDASE IV
    5e-04   9%  2czqA  [x.x.x] CUTINASE-LIKE PROTEIN
    7e-04  13%  1cuxA  [x.x.x] CUTINASE
    7e-04  14%  1agyA  [x.x.x] CUTINASE
    7e-04   9%  3dd5C  [x.x.x] CUTINASE
    8e-04   9%  2d80A  [x.x.x] PHB DEPOLYMERASE
    9e-04  13%  1cuyA  [x.x.x] CUTINASE
:273

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQKITEKITVAGHTAELMGYTIEKKNDWGVQDKHATIIICPGGGYHFVSDREADPVALKLITMGYNAFVL
1c00A           ------------------------------------VWIHGGAFYLGAGSEPLYDGSKLAAQGEVIVVTL
1b41A           TEMWNPNRELSEDCLYLNVWTPYPRPTS----PTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVS
2c7bB           ----TRDVHIPVSGGSIRARVYFPKKA----AGLPAVLYYHGGGFVFGSIETHDHICRRLSRLSDSVVVV
3djyA           -------------------LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVS
3dl7A           --------------------------------PTPVLIWIYGGGFYSGAASLDVYDGRFLAQVGAVLVSM
3bjrA           -------------------------TGYL-HTNLPAIIIVPGGSYTHIPVAQAESL-AAFAGHGYQAFYL
2c58A           -------------------LYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
1amnA           -------------------LYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
1cpyA           ----TGYLDVEDEDKHFFFWTFESRND---PAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGN
3dl4A           ---------------------------PRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVS
2c7bA           ----TRDVHIPVSGGSIRARVYFPKKAA----GLPAVLYYHGGGFVFGSIETHDHICRRLSRLSDSVVVV
1ea5A           ---------------------------SPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
1crlA           --------------------------------NLPVMLWIFGGGFEVGGPPAQMITKSIAMGKPIIHVSV
3ccbA           --------------------------------------------------------------RGSGYQGD
1acjA           SGSEMWNPNREMSEDCLYLNIWVPSPR---PKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
3dnmA           ------------------LGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSATLWSL
1e3qA           -------------------LYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
1aclA           --------------------------------STTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
3dl7B           --------------------------------PTPVLIWIYGGGFYSGAASLDVYVSMNYRVGTFGFLAL
2dfpA           -------------------LYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVS
3dl4B           --------------------------------PTPVLIWIYGGGFYSGAASLDVYDGRFLAQVGAVLVSM
1c7jA           ---------------------------------LPVMVWIHGGAFYLGASEPLYDGSKLAAQGEVIVVTL
3dnmD           ------------------LGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVL-TTQLAKQSSATLW
3bl8D           -------------------------NLYVPTGKKPVMLFLHGGSYMEGTGNMFDGSVL-AAYGNVIVVTL
3c8hB           QAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSPVWPVLTSLTHRQQLPPAVYVLI
3bxpA           -------LNTAAHPFQITAYWLDQISDFETAVDYPIIICPGGGFTYHSGREEAPIATRAAGHTVVLNYQL
1cleA           --------------------------------NLPVMLWIFGGGFEIGSPPAQMVTKSVLMGKPIIHVAV
3bxpB           ------TLNTAAHPFQITAYWLDQISDFE-TAVDYPIIICPGGGFTYHSGREEAPIATRA---AGHTVVL
3ccbB           ------------------------------------DVYAGPCSQKADTVFRLNWATYLASTENIIVASF
3d3nB           -------LNTAAHPFQITAYWL-DQISDF-EAVDYPIIICPGGGFTYHSGREEAPIATR---AAGHTVVL
1c7iA           ----LSLSYKELPRQSEDCLYVNVFAPDTPSQNLPVMVWIHGGAFYLGASEPLYDGSKLAAQGEVIVVTL
2d81A           ----------------------------------------------------------------------
3eblA           -----------GLEVRIYRAALEFLTDAPAAEPFPVIIFFHGGSFVHSSASSDSLCRRFVKLSKGVVVSV
3be8A           --------------------------------KKPVMVYIHGGSYMEGTGNMIDGSIL-ASYGNVIVITI
3dnmB           ------------------LGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAK-QSSATLW
3dnmC           ------------------LGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLA-KQSSATLW
3bl8C           ---------------------------LYVPTKKPVMLFLHGGSYMEGTGNMFDGSVL-AAYGNVIVVTL
3bl8B           --------------------------------KKPVMLFLHGGSYMEGTGNMFDGSVL-AAYGNVIVVTL
3bixA           --------------------------------PKPVMVYIHGGSYMEGTGNLYDGSVL-ASYGNVIVITV
1c2bA           --------------------------------PTPVLIWIYGGGFYSGAASLDVYDGRFLAQVGAVLVSM
1e5tA           ----------------------------------------------------------------------
3eblF           --------------------------------AFPVIIFFHGGSFVHSSSSTIYDSLCRRFVKLSKGVVV
3c8dC           DCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYV
1dx4A           ------------------------------------IWIYGGGFMTGSATLDIYNADIMAAVGNVIVASF
1aqlA           ---------TYGNEDCLYLNIWVPQGRKEVSHDLPVMIWIYGGAFLMIATRGNVIVVTFNYRVGPLGFLS
2eepA           -----------------MPLHFDPAKKYPVIVYVYGGPHAQLVTKTWRVGGWDIYMAQKGYAVFTVDSRG
3be8B           IWFTANLDTLMTYVQDQNEDCLYLNIYVPTESKKPVMVYIHGGSYMEGTGNMIDGSIL-ASYGNVIVITI
1dqzA           ----------------------------------------------------------------------
3b3qA           ------------------CLYLNIYVPTEDGGPKPVMVYIHGGSYMEGTGNLYDGSVL-ASYGNVIVITV
1dqyA           --------------------------------GPHAVYLLDGLRAQDDYNGWDTPAFEEYYQSGLSVIMP
3eblB           ----DHIIDQSVGLEVRIYRAAFLTDAPAAEPFPVIIFFHGGSFVHSSASIYDSLCRRFVKLSKGVVVSV
3ed1A           ---------------------------------------GSFVHSSASSTIYDSLCRRFVKLSKGVVVSV
3eblE           -----------EVRIYRALEFLTDAPAAE---PFPVIIFFHGGSFVHASSTIYDSLCRRFVKLSKGVVVS
1e8mA           --------------------------FLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGE
3d3nA           -------LNTAAHPFQITAYWLDQISDA----VDYPIIICPGGGFTYHSGREEAPIATR---AAGHTVVL
1auoA           --------------------------------ADACVIWLHGLGADRYD---FMPVAEALQESLLTTRFV
3d0kA           ----------------------------GYTPDRPVVVVQHGVLRNGADYRDFWIPAADRHKLLIVAPTF
3biwA           --------------------------------PKPVMVYIHGGSYMEGTGNLYDG-SVLASYGNVIVITV
3eblC           ---------------------------VRIYRAFPVIIFFHGGSFVHSSSSTIYDSLCRRFVKLSKGVVV
3c8dB           --------------------------------ERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYV
3bl8A           -----------CLYLNLYVPTEDGPLTKKDSGKKPVMLFLHGGSYMEGTGNMFDGSVL-AAYGNVIVVTL
3dyvA           --------------------------------TDTGVVLLHAYTGSP---NDMNFMARALQRSGYGVYVP
2bceA           --------------------------RKEVSHDLPVMIWIYGGAFLMGLSNYLYDGEEIATRGNVIVVTF
2ajlI           -----------------KSKKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGD
3c8hA           ------------------------------DVERPLAVLLDGEFWAQSPVWPVLTSLTHRQQPPAVYVLI
3ed1B           GVSSFDHIIDQSVGLEVRIYRAAFLTDAPAAEPFPVIIFFHGGSFHSSASSTIYDSLCRRFVKLSKGVVV
3c8dD           ----------------------------------------------------------------------
3cn7A           --------------------------------ADACIIWLHGLGADRTDFKPVAEALQMVLPTRFILPQA
3ed1E           ----SFDHIIDQSVGLEVRIYRADAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSV
3dltA           --------------------------PFEYEGTDTGVVLLHAYTGSPNDMNFARALQRSGYGVYVPLFSG
3c87A           EIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSPVWPVLTSLTHRQQLPPAVYVLI
1aknA           LQATLTQDSTYGNEDCLYLNIWVPQGRKEVSHDLPVMIWIYGGAFANFLSNYLYDGEEIATRGNVIVVTF
3eblD           ------------------------------------FHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSV
2e3jA           --------------------------------QGPLVVLLHGFPESW---YSWRHQIPALAGAGYRVVAI
2b20A           ---------------------------TGDVTERPLAVLLDGEFWAQSPVWPVLTSLTHRVLIDAIDTTH
3dohB           ----LAFTFKDPETGVEIPYRLFVPKDVNPDRKYPLVVFLHGAGERGWAQPRYQVVHPCFVLAPQCPPNS
2dcmA           ----------------------------------------------------------------------
3d7rB           -----------------------------------------GGFNALQPSPFHWRLLDKITLSLYEVVLP
3c8dA           ----------------ERLKNSRRVWIFTTEERPLAVLLDGEFWAQSMPVWPVTSLTHRQQLPPAVYVLI
3e4dA           ----------------------------------------------------------------------
3dkrA           --------------------------------TDTGVVLLHAYTGSP---NDMNFMARALQRSGYGVYVP
3d7rA           PSTLNVKANLEKLSLDDQVFRF-----NFRHQIDKKILYIHGGFNALQPSPFHWRLLDKIT-LSTLYEVV
1cujA           --------------------------------ADVIFIYARGSTETGNLPSIASNLESAFGKDGVWIQGV
1bcrA           ---------------------------------------------------------------AGVGFSY
1bcsA           ---------------------------GPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFL
1cuzA           --------------------------------ADVIFIYARGSTETGNLPSIASNLESAFGKDGVWIQGV
3d0kB           --------------------------------------------------------------ESYNNGRA
2d5lA           -----------------KKYPVIVYVYGGPHAQLVTKTWRSSVGGWDIYMAQKGYAVFTVDSRGSANRGA
3dohA           ----------------------------------------------------------------------
3c87B           IPAKEIIWKSERLKNSRRVWIFTTGDVTA-EERPLAVLLDGEFWAQSPVWPVLTSLTHRQQLPPAVYVLI
2bklA           ----------------------------------------------------------------------
2ecfA           ----------------------------------------------------------------------
2czqA           --------------------------------PQYVLINTRGTGEPQGQSAGFRTMNSQISGGTIYNTVY
1cuxA           --------------------------------ADVIFIYARGSTETGNLPSIASNLESAFGKDGVWIQGV
1agyA           --------------------------------RDVIFIYARGSTETGNLPSIASNLESAFGKDGVWIQGV
3dd5C           --------------------------------PKVIYIFARASTGISAGPIVADALERIYGANDVWVQGV
2d80A           ---------YGANGMDTTGYLYVPQSCASGATVCSLHVALHGCLQSYSSFIQNTGYNKWADTNNMIILYP
1cuyA           --------------------------------ADVIFIYARGSTETGNLPSIASNLESAFGKDGVWIQGV


                         .         .         *         .         .         .         .:140
query           NYTCQVRYPVALEQLAQSVKLVRDNADEWNVREDKIIIMGMSAGGHLAASLGVKWNSNELKQMGYKSEEI
1c00A           NYDEAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKGLFQKAIMESGA
1b41A           MNYREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGA
2c7bB           DYRLEYKFPTAVEDAYAALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSILDRNSGE---------K
3djyA           MNYREAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGEAGAASVSLHL-LSPGSHSLFTRAI----L
3dl7A           NYRVGAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAGAASVGMHILSLPSRSLFHR-------A
3bjrA           EYDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDPQQITPAGFSVGGHIVALYNDYWAT-------------
2c58A           LSSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGEAGGASVGMHILSPGSRDLFRRAI-----L
1amnA           LGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILSGSP
1cpyA           PYSWNSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRN-------F
3dl4A           MNYREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAGAASVGMHILSLP-----SRSLFHRAVL
2c7bA           DYRLEYKFPTAVEDAYAALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSINSGEKLVKKQVLIYPVV
1ea5A           LSYREAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGS
1crlA           NYRVSSWGFAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKMVPSDAVD
3ccbA           KIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAV-----
1acjA           LSYRVAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGS
3dnmA           DYRLAPENPFPAAVDDCVAAYRALLKTAGSA--DRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLS
1e3qA           LSSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRNCPWASVS
1aclA           LSYQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMH-ILSPGSRDLFRRAILQSG
3dl7B           PGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAGAASVGMHILSLPSRSLFHR-------A
2dfpA           LSYREAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGEAGGASVGMHILSPG-----SRDLFRRAIL
3dl4B           NYSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEAGAASVGMHILSLPS-------RSLFHRA
1c7jA           NYREAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKGLFQKAIMESGA
3dnmD           SLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLS
3bl8D           NYDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLL----------ILSHHSEGL
3c8hB           DAIDLPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPE-------------
3bxpA           IVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLD---
1cleA           NYRAEGSGNAGLKDQRLGMQWVADNIAGFGGDPSKVTIFGESAGSMSVLCHLIWNDGDNTYKMVPSDPVD
3bxpB           NYQLISVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLD---
3ccbB           DGRGAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAV-----
3d3nB           NYQDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLD---
1c7iA           NYDEAYSDNLGLLDQAAALKWVRENISAFGGDPDNVTVFGESAGGMSIAALLAMPAAKGLFQKAIMESGA
2d81A           ------------------------ALPAFNVNPNSVSVSGLASGGYMAAQLGVAYS--DVFNVGFG---V
3eblA           NYEHRYPCAYDDGWTALKWVMSQPFMRSGGDAQARVFLSGDSSGGNIAHHVAVRAADEGVKVCGFGGTER
3be8A           NYRLGILGFYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCV-----------SLLTLSHYSEG
3dnmB           SLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLS
3dnmC           SLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLS
3bl8C           NYRLGAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGT
3bl8B           NYRLAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQK-------
3bixA           NYRLGVLGFYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEKGLFQRA-----
1c2bA           NYRVGAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFQSGTPNGPW
1e5tA           ---KGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVA-----TCANQRPDLFGCVIAQ
3eblF           SVNYRRAYPCAYDDGWTALKWVMSQPFMRA----RVFLSGDSSGGNIAHHVAVRAADEGVKLLNAMFGGT
3c8dC           LIDAIDTNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPE-------------
1dx4A           QYRVEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLGMMQSGTMNA
1aqlA           TGDSNLPGNYGLWDQHMAIAWVKRNIEAFGGDPDNITLFGESAGGASVSLQTLSPYNKGLIKRAI-----
2eepA           SANRVIHRRLGQTEMADQMCGVDFLKSQSWVDADRIGVHGWSYGGFMTTNLMLTHG--------------
3be8B           NYRLGILGFYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLL-----------TLSHYSEG
1dqzA           --------------------MPAWLQANKGVSPTGNAAVGLSMSGGSALILGFLNPSESWWPTLIGLAMN
3b3qA           NYRLGVLGFYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGLFQRA-----I
1dqyA           VGQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYP----QQFPYAAS-L
3eblB           NYRPEHRYPCAYDDGWTALKWVMSQPF-MRSAQARVFLSGDSSGGNIAHHVAVRAADEGVKVCG------
3ed1A           NYRRAPRYPCAYDDGWTALKWVMSQPFMRSDAQARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILNAM
3eblE           VNYRRAPEHRYPCAYDDGWTALKWVMSQPFMRSARVFLSGDSSGGNIAHHVAVRA-----ADEGVKVCGN
1e8mA           TWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGANGGLLVATCANQRP-----DLFGCVIAQ
3d3nA           NYQDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQ
1auoA           LPQAPTRPTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDA-------------
3d0kA           SDEIWPGVESYNNGRAFTAAGNPRHLANIRAAEEQVYLFGHSAGGQFVHRLSSQPHAPFHAV-------T
3biwA           NYRQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEKGLFQRA-----
3eblC           SVNYRRAPEHRYPCAYDDGWTALKWVMSQPFMRARVFLSGDSSGGNIAHHVAVRAADEGVKVCGFGGTER
3c8dB           LIDALPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCV-------L
3bl8A           NYRLAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGT
3dyvA           LFTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILP
2bceA           NYRSNLPGNYGLWDQHMAIAWVKRNIEAFGGDPDQITLFGESAGGASVSLQTLSPYN---KGLIKRAISQ
2ajlI           KIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGS-------------G
3c8hA           DAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHW-------PERFGCVL
3ed1B           SVNYRRAPEHRYPCAYDDGWTALKWVMSQPMRSARVFLSGDSSGGNIAHHVAVRAADEGVKVCNAMFGGT
3c8dD           ----------------------------------------------------------------------
3cn7A           PSQTVNGGWVMPSWYDILAFSPARAIDEDQLNASADQVIALIDEQRAKGIAAERIILAGFSQGGA-----
3ed1E           NYRRAPEHRYPCAYDDGWTALKWVMSQFMRSAQARVFLSGDSSGGNIAHHVAVRAADEGVKVCGNILLNA
3dltA           HGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPGKH
3c87A           DAIDTPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPE-------------
1aknA           NYRSNLPGNYGLWDQHMAIAWVKRNIEAFGGDPDNITLFGESAGGASVSLQTLSPYN---KGLIKRAISQ
3eblD           NYRRAPEHRYPCAYDDGWTALKWVMSQPFMRSGARVFLSGDSSGGNIAHHVAVRAADEGVKVLNAMFGGT
2e3jA           DQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGQAFVVGHDWGAPVAWTFAWLHPD-------------
2b20A           RAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPE-------------
3dohB           SWSTLFTDNNPEKPLLAVIKIIRKLLDEYNIDENRIYITGLSMGGYGTWTAIMEFPELFAAAIPI-----
2dcmA           ----------------------------------------------------------------------
3d7rB           IYPKEFHIDDTFQAI---QRVYDQLVSEV---GHQNVVVGDGSGGALALSFVQSLLDNQQPL--------
3c8dA           DAIDTTHRADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQ-----
3e4dA           ------------------TEELPALIGQHFRADSRQSIFGHSGGHGAT--IALKNPE-------------
3dkrA           LFSGHPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGKALETLPGITAGGVFSSPILPGKHH
3d7rA           LPIYPKTPEFHIDDTFQAIQRVYDQLVSEV--GHQNVVVGDGSGGALALSFVQSLLDNQQPLPNLISPIL
1cujA           GGAYRATLGDNTSSAAIREMLGLFQQANTKCPDATLIAGGYCQGAALAAASIEDLDSAIRD---------
1bcrA           TNTSSDIYTSGDNRTAHDSYAFLAKWFERHYKYRDFYIAGESYAGHYVPELSQL-VHRSKNPV------I
1bcsA           DSPASDIYTSGDNRTAHDSYAFLAKWFERHYKYRDFYIAGESYAGHYVPELSQLVHRSKNPVINLK----
1cuzA           GGAYRATGGDNALPRGTSSAAIREMLGLFQQANTTLIAGGYSQGAALAAASIEDLDS-------------
3d0kB           FTAAGNPRHVDGWTYALVARVLANIRAAEIADCEQVYLFGHSAGGQFVHRLSSQPHAPFHAVTAA-----
2d5lA           AFEQVIHRRLGQTEMADQMCGVDFLKSQSWVDADRIGVHGWSYGGFM-------------TTNLMLTHGD
3dohA           ------------------IKIIRKLLDEYNIDENRIYITGLSMGGYGTWTAIMEFPELFAAAIPICGGGD
3c87B           DATTHRAHELPCNADFWLAVQQELLPLVKVIAPFRTVVAGQSFGGLSALYAGLHWP-------ERFGCVL
2bklA           ----------------------------------------------------------------------
2ecfA           ----------------------------------------------------------------------
2czqA           TADFSQNSAAGTADIIRRINSGLAA-----NPNVCYILQGYSQGAAATAAFNAVKGVFLIGNPDHKSGLT
1cuxA           GGLGDNALPRGTSSAAIREMLGLFQQANTKCPDATYIAGGYSQGAALAAASIEDL-----------DSAI
1agyA           GGAYRATLGDNALPRGTSSAAIREMLGLTKCPDATLIAGGYSQGAALAAASIED----------------
3dd5C           GGLASNFLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQGTAVMAGSISGLST-------------
2d80A           QADYTIHAIWNGGV-------LSNPNGCWDWVGWYGSNADQIGGVQMAAIVG------------------
1cuyA           GGAGDNALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLDS-------------


                         +         .         .         .         .         *         .:210
query           KPNGLVLSYPVITTNKDFWHQGSFEQILGKDGIEDEKALANQSLEKLVTEDVPPVFMWHTFEDKAVPMEN
1c00A           SRTMTKEQAASTAAAFLQVLGINESQLDRLHTVAAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPEE
1b41A           PNGPWATVGMGEARRRATQLAHLVGCPNDTELVACLRTRPAQVLVHVLPQESVFRFSFVPVVDGDFLSDT
2c7bB           LVKKQVLIYPVVNTGVPTASLVEFGVAETTSLPIELVWFGRQYLKRPEEAYLPPALVVTAEYDPLRDEGE
3djyA           QSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLNEAFVVPYGTPLSVNFGPTVDGDFLTDM
3dl7A           VLQSGTPNGPWATVSAGLVGCPNDTELIACLRTRPAQDLVD-HEWHVLPQESIFRFSFVPVVDGDFLSDT
3bjrA           RVATELNVTPALKPNNVVLG---YPVISPLLGFTWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATN
2c58A           QSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCDVEWNVLPFDSIFRFSFVPVIDGEFFPTS
1amnA           NCPWASVSVA--EGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRDGEFFPTS
1cpyA           NLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGATIYCNNAQLA--PYQRT
3dl4A           QSGTPNGPWATVSAGEALVGCPGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDT
2c7bA           NTGVPTASLVEFGVAETTSLPIELVWFGRQYLKRPEEAYDFKASPLLALGGLPPALVVTAEYDPLRDEGE
1ea5A           PNCPWASVSVAEGRRRALNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTS
1crlA           GIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNT---PGFLAYSSLRLSYLPRPDGVNITDD
3ccbA           --------APVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQ
1acjA           PNCPWASVSVAEGRRNLNCNLNSDEELIHCLREKKPQELIDVE-WNVLPFDSIFRFSFVPVIDGEFFPTS
3dnmA           PFVDLTLSRWSNSNLADRDFLAPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSD
1e3qA           VAEGRRRAVELGRNLNCNSDEELIHCLREKKPQELIDVEWNVLPF-----DSIFRFSFVPVIDGEFFPTS
1aclA           SPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRDGEFFPTS
3dl7B           VLQSGTPNGPWATVSAGEARRRALARLVGCNDTELIACLRTDHEWHVLPQESIFRFSFVPVVDGDFLSDT
2dfpA           QSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCDVEWNVLPFDSIFRFSFVPVIDGEFFPTS
3dl4B           VLQSGTPNGPWATVSAGEGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDT
1c7jA           SRTMTKEQAASTAAAFLQVLGINESQLDRLHTVAAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPEE
3dnmD           PFVDLTLSRWSNSNLADRDFLAEPDTLGEMSEYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSD
3bl8D           FQKAIAQSGTAISS--WSVNYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIDD
3c8hB           RFGCVLSQSGSYWWPHRGGQ--------------QEGVLLEKLKAGEVSAEGLRIVLEAGIREPIRANQA
3bxpA           ---HYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPIN
1cleA           GTYGNEIYDLFVSSAGCGSASDKLACLRSAS---SDTLLDATNNTPGFLAYSSLRLSYLPRPDGKNITDD
3bxpB           ---HYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPIN
3ccbB           --------APVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQ
3d3nB           ---HYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPIN
1c7iA           SRTMTKEQAASTAAAFLQVLGINESQLDRLHTVAAEDLLKAADQLRIAEKENIFQLFFQPALDPKTLPEE
2d81A           FAGGPYDCARNQYYTSCMYNGYPSI----TTPTANMKSWSGNQIASVANLGQRKIYMWTGSSDTTVGPNV
3eblA           TESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLD--LTCDR
3be8A           LFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECL-RNKNYKELIQQTITPATYHIDD
3dnmB           PFVDLTLSRWSNSNLADRFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSD
3dnmC           PFVDLTLSRWSNSNLADRDFLAEPDLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSD
3bl8C           AISSWSVNYQPLKYTRLLAAKVGCDREDSTEAVECLRRKS------------SRELVDQDVQPARYHIDD
3bl8B           ---AIAQSGTAISSWSVNYQPLKYTRLL--AAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIDD
3bixA           ------IAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYKELVDQDVQPARYHIDD
1c2bA           ATVSAGEARRRATVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDT
1e5tA           VGVMDMLKFHKYTIGHAWTTYGCSDSKQHFEWLIKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLH
3eblF           ERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
3c8dC           ------RFGCVLSQSGSYWWPHRGG--------QQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIM-RA
1dx4A           PWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTINSYSGILSFPSAPTIDGAFLPAD
1aqlA           -SQSGVGLCPWAIQQDPLFWAKRIAEKVGKITDPRALTLAYKLPLGSTEYPKLHYLSFVPVIDGDFIPDD
2eepA           DVFKVGVAGGPVIDWNRYEIMYGERYFDAPQE--NPEGYDAANLLKRAGDLKGRLMLIHGAIDPVVVWQH
3be8B           LFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKN-YKELIQQTITPATYHIDD
1dqzA           DSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGN---GTPSDLGGDNIPAKFLEGLTLRT
3b3qA           AQSGTALSSWAVSFQPAKYARATKVGCQVSDTVELVECLQKKPYKELVDQDVQPARYHIAFGDGDVIPDD
1dqyA           SGFLNPSESWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTIPAKFLEGLTLRTN
3eblB           ----NILLNAMFGGTERTESERRLKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
3ed1A           FGGTERTESERRLDGKYFVTLQYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
3eblE           ILLNAMFGGTERTESERRLDGKYFVAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
1e8mA           VGVMDMLKFHKYTIGHAWTTYGCSDSKQHFEWLIKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLH
3d3nA           GQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVT------PASKPAFVWQTATDESVPPIN
1auoA           SRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAM
3d0kA           AANPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPTILAGDQTPNLPSEPAALRQGPHRYARARHYYE
3biwA           ----IAQSGT--ALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYKELVDQDVQPARYHIDD
3eblC           TESERRLDGKYFVTLQDRDWY--WKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
3c8dB           SQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEG--------------------LRIVLEAGIREP-MIMRA
3bl8A           AISSWSVNYQPLKYTRLLAAKVGCDREDSTEAVECLRRKSSRELVDQDVQPARYHIAFGPVVDGDVVPDD
3dyvA           GKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAFATTVAADLNLVKQPTFIGQAGQDELVDGRL
2bceA           SGVGLCPWAIQQDPLFWAKRIAEKVGCPVDDTSKMAGCLKITDPRALTLAYKLPLGSTEYPKLHYLSPDD
2ajlI           VFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQ
3c8hA           SQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRI--------------------VLEAGIREPIRANQA
3ed1B           ERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
3c8dD           -------------------------------------------------------IVLEAGIREPMIMRA
3cn7A           ------VVLHTAFRRYAQPLGGVLALSTYAPTFDDLALDERH--------KRIPVLHLHGSQDDVVDPAL
3ed1E           MFGGTRTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLGLDLTCDR
3dltA           HLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRL
3c87A           RFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGL----------------RIVLEAGIREPIRANQA
1aknA           SGVGLCPWAIQQDPLFWAKRIAEKVGCPVDDTSKMAGCLKITDPRALTLAYKLPLGSTEYPKDGDFIPDD
3eblD           ERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDR
2e3jA           RCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGL
2b20A           RFGCVLSQSGSYWWPHRGG--------------QQEGVLLEKLKAGEVSAEGLRIVLEAGIREPIRANQA
3dohB           -----CGGGDVSKVERIKDI---------------------------------PIWVFHAEDDPVVPVEN
2dcmA           -----------------------------------------------------RLMLIHGAIDPVVVWQH
3d7rB           -PNKLYLISPILLSNKDISDLIEQDAVLSQFGVNEIKKWAN-----------------------------
3c8dA           --SGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRI---------------------VLEAGIREPMIMRA
3e4dA           RFKSCSAFAPIVAPSSADWSEPALEKYLGADRAAWRRYDACSLVEDG--ARFPEFLIDQGKADSFLEKGL
3dkrA           LVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVK-QPTFIGQAGQDELVDGRL
3d7rA           DATLSNKDISDALIEQDAVLSQFGVNEIKKWANGLPLTDKRISPINGTIEGLPPVYFGGGRETHPDK---
1cujA           KIAGTVLFGYTK----NLQNRGRIPNYP------ADRTKVFCNTGDLVCTGSLIVAAPHLAYGPDARGPA
1bcrA           NLKGFMVGNGLIDDYHDYVGTFEFWWNHGDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYS
1bcsA           ---GFMVGNGLIDDYHDYVGTFEFWWIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYS
1cuzA           AIRDKIAGTVLFGYTKNLQNRGRIPNYP------ADRTKVFCNTGDLVCTGSGIVAAPHLAYGPDARGPA
3d0kB           --NPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPTILAGDQDIATPNLPSEPRQGPHRYARARHYYE
2d5lA           VFKVGVAGGPVIDWNRYEIMYGER---YFDAPQENPEGYDAANLLKRAGDLKGRLMLIHGAIDPVVVWQH
3dohA           VSKV-------------------------------------------ERIKDIPIWVFHAEDDPVVPVEN
3c87B           SQSGSYWWPHRQQEGVLLEK----------------------LKAGEVSAEGLRIVLEAGIREPIRANQA
2bklA           -------------------------------------------------------LMMAADHDDRVDPMH
2ecfA           --------------------------------------------------------LIHGMADDNVLFTN
2czqA           CNVDSNGGTTTRNVNGLSVAYQGSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHL-SYPSDQGVQTMG
1cuxA           R--DKIAGTVLFGYTKNLQNRGRIPNYP------ADRTKVFCNTGDLVCTGSLIVAAPHLAYGPDARGPA
1agyA           ----------------------------------------------------------------------
3dd5C           TIKNQIKGVVLFGYTKNLQNLGRIPNFETSK-TEVYCDIADAVCYGTLFILPAHFLYQTDAAVAAPR---
2d80A           ----------------------------------------------------------------------
1cuyA           AIRDKIAGTVLFGYTKNLQNRGRIPNYP------ADRTKVFCNTGDLVCTGSLIVAAPHFAYGPDARGPA


                         .         .         .         +         .         .         .:280
query           SLLFASALRKAGVSTEYHIFPHGPHGLALANEETARVGRPEDIEPQAAQWVDLFHSWMQALLK
1c00A           PEKSIAEGAASGIPLLIGTTRDEGYFFFTPDSDVYSQETLDAALEYLLGKPLAEK--------
1b41A           PEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQV----
2c7bB           L---YAYKKASGSRAVAVRFAGVHGFVSFYP-----------FVDAGREALDLAAASIRSGLQ
3djyA           PDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGV----
3dl7A           PEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQA----
3bjrA           TLAYATALATAKIPYELHVFKHGPHGLA---------LANAQTAWKVAHWLTLALEWLA----
2c58A           LESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPH-----
1amnA           LESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMS-------------
1cpyA           GRNVYDIRKDCEGGNLCYPTLQDIDD-------------------------------------
3dl4A           PEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ-----
2c7bA           ---LYAYKKASGSRAVAVRFAGVHGFVSFYPF-----------VDAGREALDLAAASIRSGLQ
1ea5A           LESMLNSGNFKKTQILLGVNKDEGSF-------------------------------------
1crlA           MYALVREGKYANIPVIIGDQNDEGTFFGT----------------------------------
3ccbA           SAQISKALVDVGVDFQAMWYTDEDHGIA-----------------------------------
1acjA           LESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPH-----
3dnmA           STTLAERAGAAGVSVELKIWPDMPHVFQMYGKFV----------NAADISIKEICHWISARI-
1e3qA           LESMLNSGNFKKTQILLGVNKDEGS--------------------------------------
1aclA           LESMLNSGNFKKTQILLGVNKDEGSFFLL----------------------------------
3dl7B           PEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQA----
2dfpA           LESMLNSGNFKKTQILLGVNKDEGSFFLL----------------------------------
3dl4B           PEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ-----
1c7jA           PEKSIAEGAASGIPLLIGTTRDEGYLFFTSDSDVRSQETLDAALEYSLGK-------------
3dnmD           STTLAERAGAAGVSVELKIWPDMPHVFQM---YGKFVNAADISIKEICHWIS-----------
3bl8D           PEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEG---
3c8hB           ---LYAQLHPIKESIFWRQVDGGHDALCWRGG-------LQGLIDLWQPL-------------
3bxpA           SLKYVQALQ-HQVATAYHLFGSGDKYLNDQAAIWPQ---------------------------
1cleA           MYKLVRDGKYASVPVIIGDQNDEGTVFGLSSLNVTTNAQARAYFKQSFIHASDAEIDT-----
3bxpB           SLKYVQAL-QHQVATAYHLFGSGIHGLALALNDQAA---------------------------
3ccbB           SAQISKALVDVGVDFQAMWYTDEDHGIASSTA-------------------------------
3d3nB           SLKYVQALQ-HQVATAYHLFGSGIHYL------------------------------------
1c7iA           PEKSIAEGAASGIPLLIGTTRDEGYF-------------------------------------
2d81A           MNQLKAQLGNFDNSASYVTTTGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGAAL----
3eblA           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNANL-
3be8A           PQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYP-----
3dnmB           STTLAERAGAAGVSVELKIWPDMPHVFQMYGKFV----------NAADISIKEICHWISARI-
3dnmC           STTLAERAGAAGVSVELKIWPDMPHVFQMYGKF----------VNAADISIKEICHWISARI-
3bl8C           PEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYP-----
3bl8B           PEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYP-----
3bixA           PQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYP-----
1c2bA           PEALINTGDFQDLQVLVGVVKDEGSY-------------------------------------
1e5tA           SLKFVGRSRKQNNPLLIHVDTKAGHGAG-------------MPTAKVIEEVSDMFAFIARCLN
3eblF           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNANL-
3c8dC           NQALYAQLHPIKESIFWRQVDGGHDALCWRGG-------LMQGLIDLWQPL------------
1dx4A           PMTLMKTADLKDYDILMGNVRDEGTYFL-----------------------------------
1aqlA           PVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSNKQDVTEEDFYKLVSGLTVTKGL-----
2eepA           SLLFLDACVKARTYPDYYVYPSHEHNVMGPDRV------------------------------
3be8B           PQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYP-----
1dqzA           NTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAM--------------------------
3b3qA           PQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYD-----
1dqyA           QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAM--------------------------
3eblB           QLAYADALREDGHHVKVVQCENATVGFYLLPNTV----HYHEVMEEISDFLN-----------
3ed1A           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNANL-
3eblE           QLAYADALREDGHHVKVVQCENATVGFYLLPNTVHYHEVMEEI--------------------
1e8mA           SLKFVGRSRKQNNPLLIHVDTKAGHGAGKPTAKVIEE--------------------------
3d3nA           SLKYVQALQ-HQVATAYHLFGSAIWPQLA----------------------------------
1auoA           GRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGA---------------------------
3d0kA           AGQRAAAQRGLPFGWQLQVVPGIGHDGQASQVCASLW---FDGRPDAAELA------------
3biwA           PQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGVL-----
3eblC           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNA---
3c8dB           NQALYAQLHPIKESIFWRQVDGGHDALCWRGG-------LMQGLIDLWQP-------------
3bl8A           PEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGYP-----
3dyvA           AYQLRDAL-INAARVDFHWYDDAKHVITVNSA-------HHALEEDVIAFMQ-----------
2bceA           PVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSNKQDVTEEDFYKLVSGLTVTKGL-----
2ajlI           SAQISKALVDVGVDFQAMWYTDEDHGIA-----------------------------------
3c8hA           ---LYAQLHPIKESIFWRQVDGGHDALC----------WRGGLQGLIDLWQPLFH--------
3ed1B           QLAYADALREDGHHVKVVQCENATVGFYL----LPNTVHYHEVMEEISDFLN-----------
3c8dD           NQALYAQLHPIKESIFWRQVDGGHDALCWRGG-------------------------------
3cn7A           GRAAHDALQAQGVEVGWHDYPMGHEVSLEEIHDIGA---------------------------
3ed1E           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNANL-
3dltA           AYQLR-DALINAARVDFHWYDDAKHVITV----------------------------------
3c87A           ---LYAQLHPIKESIFWRQVDGGHDALCWRGG-------LQGLIDLWQPL-------------
1aknA           PVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSNKQDVTEEDFYKLVSGLTVTKGLRG---
3eblD           QLAYADALREDGHHVKVVQCENATVGFYL-----------LPNTVHYHEVMEEISDFLNANL-
2e3jA           TYTVSGEGMMAATKAAVSMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLD-----
2b20A           ---LYAQLHPIKESIFWRQVDGGHDALCWRGG-------LQGLIDLWQPL-------------
3dohB           SRVLVKKLAEIGGKVRYTEYEKGFMEKH---------GWDPHGSWIPTYENQEAIEWLFEQSR
2dcmA           SLLFLDACVKARTYPDYYVYPSHEHNVMG--------PDRVHLYETITRYFT-----------
3d7rB           ---------------------------------------------------------------
3c8dA           NQALYAQLHPIKESIFWRQVDGGHDALCWRGG-------------------------------
3e4dA           RPLFEEAIKGTDIGLTLR-HDRYDHS-------------------------------------
3dkrA           AYQLRDAL-INAARVDFHWYDDAKHVITVNSA-------------------------------
3d7rA           ---LFEQLQHHQY--IEFYDYPKVHDFPIYPIRQSH---------------------------
1cujA           PEFLIEKVRAVR---------------------------------------------------
1bcrA           LY-------------------------------------------------------------
1bcsA           LY-------------------------------------------------------------
1cuzA           PEFLIEKVRAVR---------------------------------------------------
3d0kB           AGQRAAAQRGLPFGWQLQVVPGIGHDGQASQVCASL---------------------------
2d5lA           SLLFLDACVKARTYPDYYVYPSHEHNV--------MGPDRVHLYETITRYFT-----------
3dohA           SRVLVKKLAEIGGKVRYTEYEKGFMEKH---------GWDPHGSWIPTYENQEAIEWLFEQSR
3c87B           ---LYAQLHPIKESIFWRQVDGGHDALCWRGG-------------------------------
2bklA           ARKFVAAVQNSPATALLRIEANAGHGGA-------------DQVAKAIESSVDLYSFLFQVLD
2ecfA           STSLMSALQKRGQPFELMTYPGAKHGLSGADALHR----------------------------
2czqA           YKFAVNKLGGSA---------------------------------------------------
1cuxA           PEFLIEKVRAVR---------------------------------------------------
1agyA           ---------------------------------------------------------------
3dd5C           --FLQARI-------------------------------------------------------
2d80A           ---------------------------------------------------------------
1cuyA           PEFLIEKVRAVR---------------------------------------------------