[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00302.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e58A.bssp"
#ERROR : Can't open dsspfile "3d8hA.bssp"
#ERROR : Can't open dsspfile "3d8hB.bssp"
#ERROR : Can't open dsspfile "2a9jA.bssp"
#ERROR : Can't open dsspfile "3c7tA.bssp"
#ERROR : Can't open dsspfile "1c7zA.bssp"
#ERROR : Can't open dsspfile "3e9eA.bssp"
#ERROR : Can't open dsspfile "3dcyA.bssp"
#ERROR : Can't open dsspfile "2a6pA.bssp"
#ERROR : Can't open dsspfile "3e9eB.bssp"
#ERROR : Can't open dsspfile "1ebbA.bssp"
#ERROR : Can't open dsspfile "3e9dB.bssp"
#ERROR : Can't open dsspfile "1dklA.bssp"
#ERROR : Can't open dsspfile "3e9dA.bssp"
#ERROR : Can't open dsspfile "3d4iD.bssp"
#ERROR : Can't open dsspfile "3d4iA.bssp"
#ERROR : Can't open dsspfile "3db1A.bssp"
#ERROR : Can't open dsspfile "3d4iC.bssp"
#ERROR : Can't open dsspfile "3d6aA.bssp"
#ERROR : Can't open dsspfile "2ekzB.bssp"
#ERROR : Can't open dsspfile "2ekbB.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "3d4iB.bssp"
#ERROR : Can't open dsspfile "2ekzA.bssp"
#ERROR : Can't open dsspfile "3d6aC.bssp"
#ERROR : Can't open dsspfile "1dkpA.bssp"
#ERROR : Can't open dsspfile "1bq3D.bssp"
#ERROR : Can't open dsspfile "3e9cA.bssp"
#ERROR : Can't open dsspfile "1dklB.bssp"
#ERROR : Can't open dsspfile "3e9cB.bssp"
#ERROR : Can't open dsspfile "1dkmA.bssp"
#ERROR : Can't open dsspfile "1bq3C.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"

## Summary of PDB Search
:228
    2e-63  53%  1e58A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-57  53%  3d8hA  [x.x.x] GLYCOLYTIC PHOSPHOGLYCERATE MUTASE
    5e-56  53%  3d8hB  [x.x.x] GLYCOLYTIC PHOSPHOGLYCERATE MUTASE
    2e-50  48%  2a9jA  [x.x.x] BISPHOSPHOGLYCERATE MUTASE
    1e-41  14%  3c7tA  [x.x.x] ECDYSTEROID-PHOSPHATE PHOSPHATASE
    4e-39  25%  1c7zA  [c.60.1] FRUCTOSE-2,6-BISPHOSPHATASE
    9e-39  21%  3e9eA  [x.x.x] ZGC:56074
    1e-38  16%  3dcyA  [x.x.x] REGULATOR PROTEIN
    1e-37  22%  2a6pA  [x.x.x] POSSIBLE PHOSPHOGLYCERATE MUTASE GPM2
    3e-37  22%  3e9eB  [x.x.x] ZGC:56074
    4e-36  26%  1ebbA  [c.60.1] PHOSPHATASE
    5e-36  22%  3e9dB  [x.x.x] ZGC:56074
    8e-36   9%  1dklA  [c.60.1] PHYTASE
    4e-34  22%  3e9dA  [x.x.x] ZGC:56074
    1e-33  15%  3d4iD  [x.x.x] STS-2 PROTEIN
    2e-33  17%  3d4iA  [x.x.x] STS-2 PROTEIN
    8e-33  17%  3db1A  [x.x.x] STS-2 PROTEIN
    1e-32  15%  3d4iC  [x.x.x] STS-2 PROTEIN
    2e-32  17%  3d6aA  [x.x.x] STS-2 PROTEIN
    3e-32  25%  2ekzB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    6e-32  27%  2ekbB  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    8e-32  27%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    8e-32  18%  3d4iB  [x.x.x] STS-2 PROTEIN
    1e-31  26%  2ekzA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    7e-31  17%  3d6aC  [x.x.x] STS-2 PROTEIN
    2e-30  10%  1dkpA  [c.60.1] PHYTASE
    6e-29  53%  1bq3D  [c.60.1] PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
    8e-29  20%  3e9cA  [x.x.x] ZGC:56074
    2e-27  10%  1dklB  [c.60.1] PHYTASE
    6e-27  21%  3e9cB  [x.x.x] ZGC:56074
    7e-24   8%  1dkmA  [c.60.1] PHYTASE
    2e-23  53%  1bq3C  [c.60.1] PROTEIN (PHOSPHOGLYCERATE MUTASE 1)
    1e-22  21%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-18  19%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-18  19%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    6e-18  12%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-17  19%  2bifA  [c.37.1 - c.60.1] PROTEIN
    3e-13  21%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-09  14%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-08  56%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-06  12%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-05  14%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTRAIKTLHFALE
1e58A           --TKLVLVRGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
3d8hA           --KLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLK
3d8hB           TYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLK
2a9jA           --KLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILE
3c7tA           -NDTYVRKDLNLPLKLAHRAGGKGDTPLTRLGWFQAQLVGEGMRMAGVSIKHVYASPALRCVETAQGFLD
1c7zA           MRSIYLCRHGESELNLRGRIGG--DSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEA---
3e9eA           --ALTIVRAGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLK--DLHFTNVFVSNLQRAIQTAEIILG
3dcyA           --ALTVVRHGETRFNKEKIIQGQGDEPLSETGFKQAAAAGIFLNN--VKFTHAFSSDLRTKQTHGILERS
2a6pA           --RLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLA--
3e9eB           --ALTIVRAGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
1ebbA           --TLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLE--AVELAAIYTSTSGRALET---AEI
3e9dB           --ALTIVRHGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLK--DLHFTNVFVSNLQRAIQTAEIILG
1dklA           ---VIVSRHGVRAPTKATQLMQDVTPDLTPRGGELIAYLGHYQRQRLVADGLLIADVDERTRKTGEAFAA
3e9dA           --ALTIVRHGETQYNRDKLLQGQGDTPLSDTGHQQAAAAGRYLKD--LHFTNVFVSNLQRAIQTAEIILG
3d4iD           --PDLNFPRSLPRRS-NGIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
3d4iA           -PDLNFPRSLPRRSN--GIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
3db1A           --GILVIRHGERVDQVFGIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
3d4iC           --PDLNFPRSLPRRS-NGIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
3d6aA           --GILVIRHGERVDQVFGIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
2ekzB           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKG-----ALPSLPAFSSDMLRARRTAE----
2ekbB           --ELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQARRLKGALP-----SLPAFSSDLLRARRTAE----
2ekbA           --ELWLVRHGETLWNREGRMLGWTDLPLTAEGEAQARRLKGALP-----SLPAFSSDLLRARRTAE----
3d4iB           RPDLNFPRSLPRRSN--GIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
2ekzA           --ELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALP-----SLPAFSSDMLRARRTAE----
3d6aC           --GILVIRHGERVDQVFGIKDFENDPPLSSCGIFQARLAGEALLDSGVRVTAVFASPALRCVQTAKHILE
1dkpA           --VVIVSRAGVRAPTDAWPTWPVKLGWLTPRGGELIAYLGHYQRQRLVADGLLIADVDERTRKTGEAFAA
1bq3D           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
3e9cA           --ALTIVRHGET------------DTPLSDTGHQQAAAAGRYLK--DLHFTNVFVSNLQRAIQT---AEI
1dklB           --VVIVSRHGVRAPTKATQLMQDVLGWLTPRGGELIAYLGHYQRQRLVADGLLAKKGCPQSGQV------
3e9cB           --ALTIVRHGET------------DTPLSDTGHQQAAAAGRYLK--DLHFTNVFVSNLQRAIQTAEIILG
1dkmA           ---VIVSRHGVRAPTKATQLMQVKLGWLTPRGGELIAYLGHYQRQRLSGQVAIIADVDERTRKTGEAFAA
1bq3C           -PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALE
2dwpA           -------------------GRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTS-------QLKSTIQ
1bifA           -----------------------------------------------------------------KRTIQ
2dwoA           ----------------------------------------------------------------LKSTIQ
3ddwB           TLQDIIRRFKASKFG-GTVFDAFPDQVAIQLNDTHPALAIPELDIEKLPWSKAWELTQKTFAYTNHTVLP
2bifA           -----------------------------------------------------------------KRTIQ
2axnA           ----------------------------------------------------------------------
3cehA           TLQDIIRRFKASKFTVFDAFPDQVAIQLNDTHPALAIPELMRIDIEKLPWSKAWELTQKTFAYTNHTVLP
1e59A           VTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLD
3dd1B           IIRRFKASKFGSTGTVFDAFPDQVAIQLNDTHLAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLP
3ddsB           IIRRFKASKFGSTGTVFDAFPDQVAIQLNDTHPALAIPMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLP


                         .         .         *         .         .         .         .:140
query           ESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAANDRRYAD
1e58A           ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
3d8hA           ELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKG
3d8hB           ELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKG
2a9jA           ELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQENDRRYKV
3c7tA           GLRADPSVKIKVEGLFEFKNWHMPKGIDFMTPIELCKAGLNVDMTYKPYVEMD-----------------
1c7zA           ----LGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRY-------------------
3e9eA           NNLHSATEMILDPLLRERGFGVAEGRPKEHLKNMANAA----GQSCRDYTPPGGETLEQ----VKTRFKM
3dcyA           KFC--KDTVKYDSRLRERKYGVVEGKALSELRAAKAAREECPVFTPPGGETL---DQVKRGIDFFEFLC-
2a6pA           ----GLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGC-------------------------
3e9eB           NNHSSATEMILDPLLRERGFGVAEGRPKEHLKNMANAA----GQSCRDYTPP----GGETLEQVKTRFKM
1ebbA           VRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAP-------------------
3e9dB           NNLSSATEMILDPLLRERGFGVAEGRPKEHLKNMANAA----GQSCRDYTPPGGETLEQVKTRFKMFLKS
1dklA           GLAPDCAITVH-TQADTSSPDPLFNPLKTGVCQLDNANVTDAILSRAGGSIADFTGHRQTAFRELERVLN
3e9dA           NNLSSATEMILDPLLRERGFGVAEGRPKEHLKNMANAA----GQSCRDYTPP----GGETLEQVKTRFKM
3d4iD           ELKIRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSL-------------------
3d4iA           ELKLRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
3db1A           ELKIRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
3d4iC           ELKLRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
3d6aA           ELKLRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
2ekzB           ---LAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHP-----------------------
2ekbB           ---LAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHP-----------------------
2ekbA           ---LAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHP-----------------------
3d4iB           ELKIRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
2ekzA           ---LAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHP-----------------------
3d6aC           ELKLRVEPGIFEWMKWEASKATLTFLTLEELKEANFNVDLDYRPALPRCSLM------------------
1dkpA           G----LAPDCAITVHTQTDTSSPDPLFNPLKTGVC---QLDNANVTDAILSRAGGSIADFTGHRQTAFRE
1bq3D           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
3e9cA           ILGNNLHSSATEMILDPLLRERGFGETLEQVKTRFKMFLKSLFQRMFE----------------------
1dklB           -----AIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDPLFNPLKTGVCQLDNANVTDAILSAD
3e9cB           NLHSSATEMILDPLLRERGFP-PGGETLEQVKTRFKMFLKSLFQRMFEEHGQ------------------
1dkmA           GLAPDCAITV-HTQTDTSSPDPLFNPLKTGVCQLDNANVTDAILSRAGGSIADFTGHRQTAFRELERVLN
1bq3C           KADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKY
2dwpA           TAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYP------------------
1bifA           TAEALSVPYEQFKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYP------------------
2dwoA           TAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQ--------
3ddwB           EALE-RWPVDLVEKLLPRHLEIIYEINQ----KHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCI
2bifA           TAEALSVPYEQFKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYP------------------
2axnA           -----RLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPT-----------------
3cehA           EALE-RWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIE------------------
1e59A           ELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAK
3dd1B           E-ALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLI-------------------
3ddsB           EALERW-PVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRM----------------------


                         +         .         .         .         .         *         .:210
query           LDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVAAHGNSLRALTKYIEQISDEDIMNVEMATGQ
1e58A           LSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGV
3d8hA           ICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTAC
3d8hB           ICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTAC
2a9jA           CDVPQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGV
3c7tA           ------ASAETMDEFFKRGEVAMQAAVNDTEKDGGNVIFIGHAITLDQMVGALHRLRDDMEDVQPYEIGR
1c7zA           ------PKGESYEDLVQRLEPVIM-----ELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHT
3e9eA           FLKSLFQRMFEEHGSAQPVIAGLADDGAQN--VPVHALMVSHGAFIRISVRHLVEDLQCCLPAGLKMNQ-
3dcyA           ------QLILKEADQKNCLETSLAEIFPLIPGLAASVLVVSHGAYRSLFDYFLTATLSRSELSVTPNTGS
2a6pA           ------PAGESVAQVNDRADSAVALALEHM--SSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTAS
3e9eB           FLKSLFQ-RMFEEHGSQPVIAGLADDGAQNV--PVHALMVSHGAFIRISVRHL--VEDLQC---CLPAGL
1ebbA           ------QRGERFCDVQQRALEAVQSIVDRH--EGETVLIVTHGVVLKTLMAAFKDTPLDHLWSPPYMYGT
3e9dB           LF------QRMFEEHGQPVIAGLADDGAQN--VPVHALMVSHGAFIRISVRHLVEDLQCCLPAGLK----
1dklA           FPQSN----LCLKRSCSLTQALPSELKVSADNVSLTGAVSLASMLTEIFLQQAQGMPEPGWGRITDSHQW
3e9dA           FLKSLFQRMFEEHGSALSSVPSEADQPVIAGLVPVHALMVSHGAFIRISVRHLVEDLQCCL-----PAGL
3d4iD           ------MPAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVR-
3d4iA           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVRK
3db1A           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVRK
3d4iC           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVRK
3d6aA           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVRK
2ekzB           ------PGGESLSAFQERVFRFLEGL-------KAPAVLFTHGGVVRAVLRALGLVPPGSAVAVDWPRRV
2ekbB           ------PGGESLSAFQERVFRFLEGL-------KAPAVLFTHGGVVRAVLRALGLVPPGSAVAVDWPRRV
2ekbA           ------PGGESLSAFQERVFRFLEGL-------KAPAVLFTHGGVVRAVLRALGEDPPGSAVAVDWPRRV
3d4iB           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVR-
2ekzA           ------PGGESLSAFQERVFRFLEGL-------KAPAVLFTHGGVVRAVLRALGLVPPGSAVAVDWPRRV
3d6aC           -------PAESYDQYVERCAVSMGQIINTCPQDMGITLIVSHSSALDSCTRPLLGLPPRECGDFAQLVRK
1dkpA           LERVLNFPQSNLCLKREKQDESCSLTQALPSELKVSADNVSLTGAVSLASMLTEIFLLQQAQGMPEGWGR
1bq3D           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
3e9cA           ------EHGSALSSADQPVIAGLADDGAQN--VPVHALMVSHGAFIRISVRHLVEDLQCCLPAGLKMNQV
1dklB           FTGHRQTAFRELERVLNFPQSNLCLKRSCSLTQALPSELKVSADNVSLTGAVSLASMLTEIFLLQQAQGM
3e9cB           -----------------PVIAGLADDGAQNV--PVHALMVSHGAFIRISVRHLAGLKMNQVFSPCPNTGI
1dkmA           FPQSNLCLKREKQDESCSLTQALPSELKVSADNVSLLLQQAQGMPEPGWGRITDSHQWNTLLSLARSRAT
1bq3C           VDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGI
2dwpA           -------TGESYQDLVQRLEPVIME-----LERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHT
1bifA           -------KGESYEDLVQRLEPVIME-----LERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHT
2dwoA           -----------------RLEPVIME-----LERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHT
3ddwB           VGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIG--------
2bifA           -------KGESYEDLVQRLEPVIME-----LERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHT
2axnA           --------GESYQDLVQRLEPVIME-----LERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHT
3cehA           ----------------------------------------------------------------------
1e59A           LSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEI--LELNIPT
3dd1B           ----------------------------------------------------------------------
3ddsB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PVVYDLDDKLNIVNKEKL
1e58A           PLVYEFDENFKPLKRYYL
3d8hA           PLVLELDDYLKVT-----
3d8hB           PLVLELDDYLKVT-----
2a9jA           PILLELDENLRAV-----
3c7tA           NLKVPYCALGAMR-----
1c7zA           VLKLTPVA----------
3e9eA           ------------------
3dcyA           LFIINFEEGREVK-----
2a6pA           IGICGFEHGVRQL-----
3e9eB           KMNQVFSPCPN-------
1ebbA           SVIIEVDGG---------
3e9dB           ------------------
1dklA           NTLLSLHN----------
3e9dA           KMNQVFSPCPN-------
3d4iD           ------------------
3d4iA           IP----------------
3db1A           IPS---------------
3d4iC           IP----------------
3d6aA           IP----------------
2ekzB           LVRLAL------------
2ekbB           LVRLAL------------
2ekbA           LVRLALD-----------
3d4iB           ------------------
2ekzA           LVRLALD-----------
3d6aC           IPS---------------
1dkpA           ITDSHQWNTLLSLHNAQF
1bq3D           PLVFELDENLKPSK----
3e9cA           RFIFTIHREESVLRATR-
1dklB           PEPGWGRITDSHQWNT--
3e9cB           SFIFTIHREESVLRATRI
1dkmA           PLLDLIKTALT-------
1bq3C           PLVFELDENLKSKP----
2dwpA           VLKLTPVAYGCRV-----
1bifA           VLKLTPVAYGCKVESIFL
2dwoA           VLKLTPVAYGCRVESIYL
3ddwB           ------------------
2bifA           VLKLTPVAYGCKV-----
2axnA           VLKLTPVAYGCRV-----
3cehA           ------------------
1e59A           GVPLVYE-----------
3dd1B           ------------------
3ddsB           ------------------