[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00312.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eetA.bssp"
#ERROR : Can't open dsspfile "3ddvB.bssp"
#ERROR : Can't open dsspfile "3ddvD.bssp"
#ERROR : Can't open dsspfile "3eetB.bssp"
#ERROR : Can't open dsspfile "3cnvC.bssp"
#ERROR : Can't open dsspfile "3cnvA.bssp"
#ERROR : Can't open dsspfile "3cnvB.bssp"
#ERROR : Can't open dsspfile "3cnvD.bssp"
#ERROR : Can't open dsspfile "3ddvC.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "3ddvA.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "1e2xA.bssp"
#ERROR : Can't open dsspfile "2b7oB.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "3by6E.bssp"
#ERROR : Can't open dsspfile "3by6D.bssp"
#ERROR : Can't open dsspfile "3by6B.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "3c7jA.bssp"
#ERROR : Can't open dsspfile "3c7jB.bssp"
#ERROR : Can't open dsspfile "2ek5B.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "3d0sB.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "3d0sA.bssp"
#ERROR : Can't open dsspfile "2dk8A.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2co5A.bssp"
#ERROR : Can't open dsspfile "1b1bA.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "2acjA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "2co5B.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "1bi2B.bssp"
#ERROR : Can't open dsspfile "2d45D.bssp"
#ERROR : Can't open dsspfile "1bi3B.bssp"
#ERROR : Can't open dsspfile "2dtrA.bssp"
#ERROR : Can't open dsspfile "2acjB.bssp"
#ERROR : Can't open dsspfile "1bi0A.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "1c0wB.bssp"
#ERROR : Can't open dsspfile "1dprA.bssp"
#ERROR : Can't open dsspfile "3cuoA.bssp"
#ERROR : Can't open dsspfile "1efaB.bssp"
#ERROR : Can't open dsspfile "1c0wD.bssp"
#ERROR : Can't open dsspfile "1ddnA.bssp"
#ERROR : Can't open dsspfile "1efaA.bssp"
#ERROR : Can't open dsspfile "1bi2A.bssp"
#ERROR : Can't open dsspfile "3dkwA.bssp"
#ERROR : Can't open dsspfile "3e6bA.bssp"

## Summary of PDB Search
:241
    4e-32  17%  3eetA  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    7e-29  21%  3ddvB  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    3e-28  21%  3ddvD  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    1e-26  15%  3eetB  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    4e-26  15%  3cnvC  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    4e-26  16%  3cnvA  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    5e-26  14%  3cnvB  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-25  15%  3cnvD  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-23  24%  3ddvC  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    9e-23  15%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    1e-22  23%  3ddvA  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-22  25%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    8e-22  23%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-20  14%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    3e-19  26%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    9e-19  20%  3edpA  [x.x.x] LIN2111 PROTEIN
    6e-17  19%  3edpB  [x.x.x] LIN2111 PROTEIN
    2e-16  25%  1e2xA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    3e-14   9%  2b7oB  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    1e-13   9%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    1e-13  23%  3by6E  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    1e-13  23%  3by6D  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    4e-13  23%  3by6B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    5e-13  23%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-13  23%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    8e-13  24%  3c7jA  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    1e-12  24%  3c7jB  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    4e-12  24%  2ek5B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    7e-11  26%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    8e-11  16%  1aoyA  [x.x.x] ARGININE REPRESSOR
    1e-10  16%  3d0sB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-10  26%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-10  26%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    5e-09  21%  3d0sA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-08   8%  2dk8A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    5e-08  16%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    6e-08  14%  2co5A  [x.x.x] VIRAL PROTEIN F93
    1e-07  12%  1b1bA  [a.4.5 - a.76.1] PROTEIN (IRON DEPENDENT REGULATOR)
    1e-07  14%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    3e-07  15%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    8e-07  15%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-06  12%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    1e-06  16%  2acjA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    2e-06  14%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    3e-06  14%  2co5B  [x.x.x] VIRAL PROTEIN F93
    4e-06  26%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    5e-06  17%  1bi2B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    9e-06  13%  2d45D  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    1e-05  18%  1bi3B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    2e-05  18%  2dtrA  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    2e-05  15%  2acjB  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    5e-05  18%  1bi0A  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    1e-04  21%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-04  14%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    2e-04  18%  1c0wB  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    3e-04  18%  1dprA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    3e-04  21%  3cuoA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-04  22%  1efaB  [a.35.1 - c.93.1] LAC REPRESSOR
    3e-04  18%  1c0wD  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    4e-04  18%  1ddnA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    5e-04  22%  1efaA  [a.35.1 - c.93.1] LAC REPRESSOR
    0.001  18%  1bi2A  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    0.001  18%  3dkwA  [x.x.x] DNR PROTEIN
    0.001  29%  3e6bA  [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL
3eetA           FEQPAYLRVAGDLRKKIVDGSLPHTRLPSQARIREEYGVSDTVALEAR-KVLAEGLVEGRSGTYVRERP-
3ddvB           ----------------------------------------------------------------------
3ddvD           ----------------------------------------------------------------------
3eetB           -----YLRVAGDLRKKIVDGSLPHTRLPSQARIREEYGVSDTVALEARKVLAEGLVETYVRE-----RPV
3cnvC           ----------------------------------------------------------------------
3cnvA           ----------------------------------------------------------------------
3cnvB           ----------------------------------------------------------------------
3cnvD           ----------------------------------------------------------------------
3ddvC           ----------------------------------------------------------------------
2di3A           -----HESVMDWVTEELRSGRLKIDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSGPRSGTI
3ddvA           ----------------------------------------------------------------------
3bwgB           -----YQQIATEIETYIEEHQLQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKH
3bwgA           --------IATEIETYIEEHQLQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKH
2di3B           ----AHESVMDWVTEELRSGRLKGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSGPRSGTI
3bwgC           -----YQQIATEIETYIEEHQLQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFVRKH
3edpA           -----FEVIASKIKDSINRDEYKT--GPNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQPK
3edpB           -----FEVIASKIKDSINRDEYKT--GPNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGLYVQP-
1e2xA           -----AGFAEEYIIESIWNNRFPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNF
2b7oB           -PPVTVPSEIVRLQEQLAQVAKGEAFLLQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPVVKVAR-
2b7oA           -PPVTVPSEIVRLQEQLAQVAKGAFLLQ-GGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPVVKVAR-
3by6E           -----YLQLVDRIKNEVATDVLSADQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGN
3by6D           -----YLQLVDRIKNEVATDVLSADQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITG-
3by6B           -----YLQLVDRIKNEVATDVLSADQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGN
3by6A           -----YLQLVDRIKNEVATDVLSADQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGN
3by6C           -----YLQLVDRIKNEVATDVLSADQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGN
3c7jA           -----RTVIEEKLRNAIIDGSLPGTALR-QQELATLFGVSRP-VREALRQLEAQSLLRVETHKGAVVAPL
3c7jB           -----RTVIEEKLRNAIIDGSLPGTALR-QQELATLFGVSRP-VREALRQLEAQSLLRVETHKGAVVAPL
2ek5B           -----------LIEDSIVDGTLSDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
2du9A           -----YKQIASLIEDSIVDGTLSIQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
1aoyA           -----QEELVKAFKALLKEEKFSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPA-
3d0sB           -----KQLLQLAQRFGTQEGGALRVTHLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISD--
2ek5A           -----YKQIASLIEDSIVDGTLSIQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
2ek5C           -----YKQIASLIEDSIVDGTLSIQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA
3d0sA           -------------------------HDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSE
2dk8A           ------DADPVEIENRIIELCHQFPHGITDQVIQNEPHIEAQQRAVAINRLLSMGQLDLLRSNTGLL---
2acjC           ----------SHMEQRILKEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLW---
2co5A           -----------------------KKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKV--L
1b1bA           -----LVDTTEMYLRTIYDLE-EEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEK
2d45B           -------------------------SANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQ---
2acjD           -----------EQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPL----
2b0lA           ----LSYSELEAIEHIFEELDGNE-GLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGM------
2d45A           -----------SSAEWEVNIIWKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQ---
2acjA           -----------------------------AHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPL----
1bibA           -----------------------------GEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPE
2co5B           ----------------INGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKV--L
2b0lB           --------SELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLKGTYIKVL
1bi2B           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
2d45D           ------------SAEWEVNIIWKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIF----
1bi3B           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
2dtrA           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
2acjB           ------------MEQRILKEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP------
1bi0A           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
3cuoD           MSHPKRLLILCMLSGS---PGTS------AGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRI----
1biaA           -----------------------------GEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGY----
1c0wB           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
1dprA           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP-
3cuoA           MSHPKRLLILCMLSGS---PGTS------AGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRI----
1efaB           -------------------------KPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELN
1c0wD           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT
1ddnA           -------------------------VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP-
1efaA           -------------------------KPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELN
1bi2A           ------------------------GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP-
3dkwA           ---------------------------------AGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRE
3e6bA           --------------------------------IGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLG


                         .         .         *         .         .         .         .:140
query           YLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEP
3eetA           -VPRRVARSGYRPSGATPFRQEQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVCTKYVFR---DAG
3ddvB           ------------------------------SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3ddvD           ------------------------------SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3eetB           PRRVARSGYRSGATPF---RQEQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVCTKYVF---RDAG
3cnvC           ---------------LRLAPDEEGEGGRAESRILECRRLRAPAEIARALELRAGETVVT--IRRQLSNHP
3cnvA           -------------------RFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHP
3cnvB           ----------------RFLRLAPDEEGEAESRILECRRLRAPAEIARALELRAGETVVT--IRRQLSNHP
3cnvD           -----------------YRFLRLAPDERAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHP
3ddvC           ------------------------QNRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
2di3A           -----ITAAPGQALSL-SVTLQLVTNQVGHHDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMDDPSL
3ddvA           --------------------------RVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3bwgB           ----------KRKGYISLLSNQDLEDFNVTSKVIELDVRKPTPE-AAENLNIGDEDIYYVKRVRYINGQT
3bwgA           KRKG-------------YISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYINGQT
2di3B           -----ITAAPGQALSLSVTLQLVT-NQVGHHDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMDDPSL
3bwgC           KRKG-------------YISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYIN-GQT
3edpA           LTA----------------QNILETGVKNLKKDIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSEHGA
3edpB           -----------------KLTAQNILETGVLKKDIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSEHGA
1e2xA           ----------------------------------------------------------------------
2b7oB           ----------------------------------------------------------------------
2b7oA           ----------------------------------------------------------------------
3by6E           ----------------------------------------------------------------------
3by6D           ----------------------------------------------------------------------
3by6B           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
3c7jA           ITED------------------------------------------------------------------
3c7jB           ITED------------------------------------------------------------------
2ek5B           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
3d0sB           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
3d0sA           RLA-------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2co5A           FLTEKGMKEFEE----------------------------------------------------------
1b1bA           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
2d45A           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
1bibA           P---------------------------------------------------------------------
2co5B           FLTEKGMKEFEE----------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1bi2B           G---------------------------------------------------------------------
2d45D           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2dtrA           ----------------------------------------------------------------------
2acjB           ----------------------------------------------------------------------
1bi0A           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
1c0wB           ----------------------------------------------------------------------
1dprA           ----------------------------------------------------------------------
3cuoA           ----------------------------------------------------------------------
1efaB           YIPN------------------------------------------------------------------
1c0wD           ----------------------------------------------------------------------
1ddnA           ----------------------------------------------------------------------
1efaA           YIPN------------------------------------------------------------------
1bi2A           ----------------------------------------------------------------------
3dkwA           RLE-------------------------------------------------------------------
3e6bA           ELK-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEG
3eetA           EVLSTSWEPLAVTGRTPVLPEEGPVGGGVRAAIDVIVDNVTEEVGARPGLAEELLTLGGVPGHVVLVIQR
3ddvB           ICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQ
3ddvD           ICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQ
3eetB           EVLSTSWEPLAVTGRTPVLPEEGPVGGGVRAAIDVIVDNVTEEVGARPGLAEELLTLGGVPGHVVLVIQR
3cnvC           TVIDDLWLPGTHFRGLTLELLTAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDR
3cnvA           TVIDDLWLPGTHFRGLTLELLTAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDR
3cnvB           TVIDDLWLPGTHFRGLTLELLTAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDR
3cnvD           TVIDDLWLPGTHFRGLTLELLTAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDR
3ddvC           ICFEVASIPYSLVG------------------------HSNQTISAVQASEQIAEYLEIKRGDAILRVRQ
2di3A           PLEDFLRFDAEFHVVISKGAENPLISTLME-ALRLSVADHTVARARALPDWRATSARLQKEHRAI-----
3ddvA           ICFEVASIPYSLVK-IGHSNQT---------------------ISAVQASEQIAEYLEIKRGDAILRVRQ
3bwgB           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIES
3bwgA           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIES
2di3B           PLEDFLRFDAEFHVVISKGAENPLISTLME-ALRLSVADHTVARARALPDWRATSARLQKEHRAI-----
3bwgC           LCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIES
3edpA           TLDRLILPLGLYPDLQAKDFQIINIIELVNSGKYKLFEQELQLILAGN----EQIKNHLNENDPVFKLSS
3edpB           TLDRLILPLGLYPDLQAKDFQIINIIELVNSGKYKLFEQELQLILAG----NEQIKNHLNENDPVFKLSS
1e2xA           ----------------------------------------------------------------------
2b7oB           ----------------------------------------------------------------------
2b7oA           ----------------------------------------------------------------------
3by6E           ----------------------------------------------------------------------
3by6D           ----------------------------------------------------------------------
3by6B           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
3c7jA           ----------------------------------------------------------------------
3c7jB           ----------------------------------------------------------------------
2ek5B           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
3d0sB           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
3d0sA           ----------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2co5A           ----------------------------------------------------------------------
1b1bA           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
2d45A           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------
2co5B           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1bi2B           ----------------------------------------------------------------------
2d45D           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2dtrA           ----------------------------------------------------------------------
2acjB           ----------------------------------------------------------------------
1bi0A           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
1c0wB           ----------------------------------------------------------------------
1dprA           ----------------------------------------------------------------------
3cuoA           ----------------------------------------------------------------------
1efaB           ----------------------------------------------------------------------
1c0wD           ----------------------------------------------------------------------
1ddnA           ----------------------------------------------------------------------
1efaA           ----------------------------------------------------------------------
1bi2A           ----------------------------------------------------------------------
3dkwA           ----------------------------------------------------------------------
3e6bA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IFFLDNGTPFEFSQMRLHFKYLKFxxxxxxx
3eetA           T-YFASGRPVETADVVVPADRYRV-------
3ddvB           VSYFENGLPFEYVRTQYAGSRFEF-------
3ddvD           VSYFENGLPFEYVRTQYAGSRFEF-------
3eetB           T-YFASGRPVETADVVVPADRYRV-------
3cnvC           ISYTYGD-RPEVRRGLYLTDHYHY-------
3cnvA           ISYTYGD-RPEVRRGLYLTDHYHY-------
3cnvB           ISYTYGD-RPEVRRGLYLTDHYHY-------
3cnvD           ISYTYGD-RPEVRRGLYLTDHYHY-------
3ddvC           VSYFENGLPFEYVRTQYAGSRFEF-------
2di3A           -------------------------------
3ddvA           VSYFENGLPFEYVRTQYAGSRFEF-------
3bwgB           IFHLTNGQPFDYSKISYNYEQSQF-------
3bwgA           IFHLTNGQPFDYSKISYNYEQSQF-------
2di3B           -------------------------------
3bwgC           IFHLTNGQPFDYSKISYNYEQSQF-------
3edpA           VFY-AENDPIAIQYHYED-------------
3edpB           V-FYAENDPIAIQYHYEDAESTKY-------
1e2xA           -------------------------------
2b7oB           -------------------------------
2b7oA           -------------------------------
3by6E           -------------------------------
3by6D           -------------------------------
3by6B           -------------------------------
3by6A           -------------------------------
3by6C           -------------------------------
3c7jA           -------------------------------
3c7jB           -------------------------------
2ek5B           -------------------------------
2du9A           -------------------------------
1aoyA           -------------------------------
3d0sB           -------------------------------
2ek5A           -------------------------------
2ek5C           -------------------------------
3d0sA           -------------------------------
2dk8A           -------------------------------
2acjC           -------------------------------
2co5A           -------------------------------
1b1bA           -------------------------------
2d45B           -------------------------------
2acjD           -------------------------------
2b0lA           -------------------------------
2d45A           -------------------------------
2acjA           -------------------------------
1bibA           -------------------------------
2co5B           -------------------------------
2b0lB           -------------------------------
1bi2B           -------------------------------
2d45D           -------------------------------
1bi3B           -------------------------------
2dtrA           -------------------------------
2acjB           -------------------------------
1bi0A           -------------------------------
3cuoD           -------------------------------
1biaA           -------------------------------
1c0wB           -------------------------------
1dprA           -------------------------------
3cuoA           -------------------------------
1efaB           -------------------------------
1c0wD           -------------------------------
1ddnA           -------------------------------
1efaA           -------------------------------
1bi2A           -------------------------------
3dkwA           -------------------------------
3e6bA           -------------------------------