[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for lsal0:ABE00338.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b9vA.bssp"
#ERROR : Can't open dsspfile "2dbiA.bssp"

## Summary of PDB Search
:801
    4e-23  10%  2b9vA  [x.x.x] ALPHA-AMINO ACID ESTER HYDROLASE
    2e-04  10%  2dbiA  [x.x.x] HYPOTHETICAL PROTEIN YBIU
:801

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b9vA           ----------------------------------------------------------------------
2dbiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b9vA           ----------------------------------------------------------------------
2dbiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2b9vA           ----------------------------------------------------------------------
2dbiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLPITRKEVKPLSYQDIEYHKPETKLPKKRPVVIS
2b9vA           -----------------------------------DYIKREVMVPMRDGVKLYTVIVIPKNARNAPILLR
2dbiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKNAEESWEHLFTYTFNDYMLARGFAVVYSGGVGTLDSDGYRTCGDEAETLGAKDVVEWLNGKRTAFTTK
2b9vA           ANRVPNALTMREVLPQGDDVFVGGYIRVFQDIRGKYGSQGDYVMTRPPHGPLNPTKTDETTDAWDTVDWL
2dbiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANKAIPAWWSNGKVAMTGKSYXXXXXXXXXXXXXXXXXXIISEAAISSWYDYYREGGLVIAPGGFPGED
2b9vA           VHNVPESNGR----VGMTGSSYEGFTVVMALLDPHPALKVAAPESPMVDGWMGDDWFHYGAFRQGAFDYF
2dbiA           ----------------------------------------IKAGHVTAEQREQIKRRGCAVIKGHFPREQ


                         .         .         +         .         .         .         .:490
query           ADILAEECFSRQKSAGDYNHSKDGFNKFLSTITKDQDRTTGNYNTFWDARNYLKDVGNIKCDIVMVHGLN
2b9vA           VSQMTARGGGNDIPRRDADDYTNFLKAGSAGSFATQAHPAYDAFWQGQALDKILAQRKPTVPMLWEQGLW
2dbiA           ALGWDQSMLDYLDRNRFDEVYPEIYPIYWSQMQARQSEEMANAQSFLNRLWTFESDGKQWFNPDVSVIYP


                         *         .         .         .         .         +         .:560
query           DWNVKLKNVFNLYNKLGDVEVTKKLILHQGQHIYINNFQSLDFTDMMNLWLSHKLYGVENNAKELLPDIL
2b9vA           DQEDMWGAIHAWQALKDADVKAPNTLVMGPWRHSGVNYNGSTLGPLEFEGDTAHQYRRDVFRPFFDNTGD
2dbiA           DRIRRRPPGTTSKGLGAHTD-SGALERWLLANVFNEYTVKCSVFRTFQGWTALSDMLPGQGLLHVVPI--


                         .         .         .         *         .         .         .:630
query           VQNNTKESTWETYSSWQSKNFTKLYLNSDSLSAQKKENQTLEFSDHLPETTFKHYQTDIANWKEEILAST
2b9vA           QKWDYYRSWPSVCESNCTGGLTPLYLADGHGLSFTHPAADGADSPVPFISRPFAFAQSSRWKPWLVQDQR
2dbiA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SPKLETNRLILTSKPLKHETLLKGVAKIKLKIASQLDHGLVSVKLVDYGDAKRLGATPTILERRGLDLGY
2b9vA           EAESRPDVVTYETEVLDEPVRVSGVPVADLFAATSGTDSDWVVKLIDVQPAMTPD-----------DPKM
2dbiA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           HWKEDNLVEFKLAKETPFKMITQAHLNLQNRHNDFSTDELEANKFYDVEITTQPMFYHLPKGHKLGLVIY
2b9vA           GGYE--------------LPVSMDIFRGRYRKDFAKPEALQPDATLHYHFTLPAVNHVFAKGHRIMVQIQ
2dbiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           ATDMEMTLQGNEENSYRIDTTGSYCLLPIEx
2b9vA           SSWFPLYDRNPQKFVPNIFDAKPADYTVAT-
2dbiA           -------------------------------